The MYB Transcription Factor Family in Eucommia ulmoides: Genome-Wide Identification, Characterization, and Network Analysis in Relation to the Rubber Biosynthetic Genes
Abstract
:1. Introduction
2. Materials and Methods
2.1. Plant Materials
2.2. Data Source
2.3. Identification and Characterization of the EuMYB Family
2.4. Phylogenetic Analysis of the EuMYB Family
2.5. Chromosome Location and Collinearity Analysis of the EuMYB Family
2.6. Analysis of Conserved Motifs, Gene Structures, and Domains of the EuMYB Family
2.7. Analysis of Cis-Acting Elements of EuMYB Family Promoters
2.8. Gene Expression of the EuMYB Family in Different Tissues
2.9. EuMYB and EUG Biosynthesis Gene Co-Expression Network Construction
2.10. EUG Synthesis-Related EuMYB Expression Analysis by RT-qPCR
3. Results
3.1. EuMYB Family Identification and Characterization
3.2. Phylogenetic Analysis of the EuMYB Family
3.3. Chromosome Location and Collinearity Analysis of the EuMYB Family
3.4. Analysis of Conserved Motifs, Gene Structures, and Domains of the EuMYB Family
3.5. Analysis of Cis-Acting Elements of EuMYB Family Promoters
3.6. Analysis of Gene Expression of EuMYB in Different Tissues
3.7. EuMYBs and EUG Biosynthesis Gene Co-Expression Network
3.8. Expression Patterns of EuMYBs in Different Tissues by qRT-PCR
4. Discussion
4.1. Analysis of Basic Characteristics of EuMYB Family Members
4.2. Analysis of Expression Patterns of EuMYB Family Members
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Acknowledgments
Conflicts of Interest
Abbreviations
References
- Paz-Ares, J.; Ghosal, D.; Wienand, U.; Peterson, P.A.; Saedler, H. The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J. 1987, 6, 3553–3558. [Google Scholar] [CrossRef]
- Frampton, J. Myb Transcription Factors: Their Role in Growth, Differentiation and Disease; Springer: Dordrecht, The Netherlands, 2004. [Google Scholar]
- Dubos, C.; Stracke, R.; Grotewold, E.; Weisshaar, B.; Martin, C.; Lepiniec, L. MYB transcription factors in Arabidopsis. Trends Plant Sci. 2010, 15, 573–581. [Google Scholar] [CrossRef] [PubMed]
- Oppenheimer, D.G.; Herman, P.L.; Sivakumaran, S.; Esch, J.; Marks, M.D. A myb gene required for leaf trichome differentiation in Arabidopsis is expressed in stipules. Cell 1991, 67, 483. [Google Scholar] [CrossRef]
- Lin, Y.; Schiefelbein, J. Embryonic control of epidermal cell patterning in the root and hypocotyl of Arabidopsis. Development 2001, 128, 3697–3705. [Google Scholar] [CrossRef]
- Di Cristina, M.; Sessa, G.; Dolan, L.; Linstead, P.; Baima, S.; Ruberti, I.; Morelli, G. The Arabidopsis Athb-10 (GLABRA2) is an HD-Zip protein required for regulation of root hair development. Plant J. 1996, 10, 393–402. [Google Scholar] [CrossRef]
- Cheng, H.; Song, S.; Xiao, L.; Soo, H.M.; Cheng, Z.; Xie, D.; Peng, J. Gibberellin Acts through Jasmonate to Control the Expression of MYB21, MYB24, and MYB57 to Promote Stamen Filament Growth in Arabidopsis. PLoS Genet. 2009, 5, e1000440. [Google Scholar] [CrossRef] [PubMed]
- Baumann, K.; Perez-Rodriguez, M.; Bradley, D.; Venail, J.; Bailey, P.; Jin, H.; Koes, R.; Roberts, K.; Martin, C. Control of cell and petal morphogenesis by R2R3 MYB transcription factors. Development 2007, 134, 1691–1701. [Google Scholar] [CrossRef]
- Zhang, Y.; Cao, G.; Qu, L.J.; Gu, H. Characterization of Arabidopsis MYB transcription factor gene AtMYB17 and its possible regulation by LEAFY and AGL15. J. Genet. Genom. 2009, 36, 99–107. [Google Scholar] [CrossRef] [PubMed]
- Zvi, M.M.B.; Negre-Zakharov, F.; Masci, T.; Ovadis, M.; Shklarman, E.; Ben-Meir, H.; Tzfira, T.; Dudareva, N.; Vainstein, A. Interlinking showy traits: Co-engineering of scent and colour biosynthesis in flowers. Plant Biotechnol. J. 2008, 6, 403–415. [Google Scholar] [CrossRef]
- Ampomah-Dwamena, C. A kiwifruit (Actinidia deliciosa) R2R3-MYB transcription factor modulates chlorophyll and carotenoid accumulation. New Phytol. 2018, 221, 309–325. [Google Scholar] [CrossRef]
- Onkokesung, N.; Reichelt, M.; van Doorn, A.; Schuurink, R.C.; van Loon, J.J.; Dicke, M. Modulation of flavonoid metabolites in Arabidopsis thaliana through overexpression of the MYB75 transcription factor: Role of kaempferol-3,7-dirhamnoside in resistance to the specialist insect herbivore Pieris brassicae. J. Exp. Bot. 2014, 65, 2203–2217. [Google Scholar] [CrossRef]
- Zhan, D. Identification and Expression Analysis of MYB Transcription Factors in Latex Cells of Hevea Brasiliensis. Master’s Thesis, Master’s Thesis, . Hainan University, Haikou, China, 2017. [Google Scholar]
- Li, L.; Liu, M.; Shi, K.; Yu, Z.; Zhou, Y.; Fan, R.; Shi, Q. Dynamic Changes in Metabolite Accumulation and the Transcriptome during Leaf Growth and Development in Eucommia ulmoides. Int. J. Mol. Sci. 2019, 20, 4030. [Google Scholar] [CrossRef]
- Yang, Y.; Zhu, J.; Chen, M.; Hui, Z.; Hongyan, D. Phenotypic and transcriptome analysis on red leaf and green leaf Eucommia ulmoides Oliver. Acta Physiol. Plant. 2020, 42, 1–11. [Google Scholar] [CrossRef]
- Yu, Y.; Zhang, S.; Yu, Y.; Cui, N.; Yu, G.; Zhao, H.; Meng, X.; Fan, H. The pivotal role of MYB transcription factors in plant disease resistance. Planta 2023, 258, 16. [Google Scholar] [CrossRef]
- Muhammad, N.; Luo, Z.; Liu, Z.; Liu, M. The Collaborative Role of the Regulatory (MYB-bHLH-WD40) and Structural Genes Results in Fruit Coloration in Plants Some Do This Under the Influence of External Stimuli. Plant Growth Regul. 2023, 23, 11102. [Google Scholar] [CrossRef]
- Lv, X.; Tian, S.; Huang, S.; Wei, J.; Han, D.; Li, J.; Guo, D.; Zhou, Y. Genome-wide identification of the longan R2R3-MYB gene family and its role in primary and lateral root. BMC Plant Biol. 2023, 23, 448. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Zhou, H.; He, Y.; Shen, X.; Lin, S.; Huang, L. MYB transcription factors and their roles in the male reproductive development of flowering plants. Plant Sci. 2023, 335, 111811. [Google Scholar] [CrossRef]
- He, X.; Wang, J.; Li, M.; Hao, D.; Yang, Y.; Zhang, C.; He, R.; Tao, R. Eucommia ulmoides Oliv.: Ethnopharmacology, phytochemistry and pharmacology of an important traditional Chinese medicine. J. Ethnopharmacol. 2014, 151, 78–92. [Google Scholar] [CrossRef] [PubMed]
- Bai, M.M.; Shi, W.; Tian, J.M.; Lei, M.; Kim, J.H.; Sun, Y.N.; Kim, Y.H.; Gao, J.M. Soluble Epoxide Hydrolase Inhibitory and Anti-inflammatory Components from the Leaves of Eucommia ulmoides Oliver (Duzhong). J. Agric. Food Chem. 2015, 63, 2198–2205. [Google Scholar] [CrossRef]
- Chinese Pharmacopoeia Commission. Chinese Pharmacopoeia; China Medical Science and Technology Press: Beijing, China, 2010; pp. 154–155. [Google Scholar]
- Luo, D.; Or, C.; Yang, L.; Lau, A.S. Anti-inflammatory activity of iridoid and catechol derivatives from Eucommia ulmoides Oliver. ACS Chem. Neurosci. 2014, 5, 855. [Google Scholar] [CrossRef] [PubMed]
- Cho, S.; Hong, R.; Yim, P.; Yeom, M.; Lee, B.; Yang, W.M.; Hong, J.; Lee, H.S.; Hahm, D.H. An herbal formula consisting of Schisandra chinensis (Turcz.) Baill, Lycium chinense Mill and Eucommia ulmoides Oliv alleviates disuse muscle atrophy in rats. J. Ethnopharmacol. 2018, 213, 328–339. [Google Scholar] [CrossRef]
- Bamba, T.; Murayoshi, M.; Gyoksen, K.; Nakazawa, Y.; Okumoto, H.; Katto, H.; Fukusaki, E.; Kobayashi, A. Contribution of Mevalonate and Methylerythritol Phosphate Pathways to Polyisoprenoid Biosynthesis in the Rubber-Producing Plant Eucommia ulmoides Oliver. Z. Für Naturforschung C 2010, 65, 363–372. [Google Scholar] [CrossRef]
- Suzuki, N.; Uefuji, H.; Nishikawa, T.; Mukai, Y.; Yamashita, A.; Hattori, M.; Ogasawara, N.; Bamba, T.; Fukusaki, E.; Kobayashi, A.; et al. Construction and analysis of EST libraries of the trans-polyisoprene producing plant, Eucommia ulmoides Oliver. Planta 2012, 236, 1405–1417. [Google Scholar] [CrossRef]
- Rohmer, M. The discovery of a mevalonate-independent pathway for isoprenoid biosynthesis in bacteria, algae and higher plants. Nat. Prod. Rep. 1999, 16, 565–574. [Google Scholar] [CrossRef]
- Kuzuyama, T. Mevalonate and Nonmevalonate Pathways for the Biosynthesis of Isoprene Units. J. Agric. Chem. Soc. Jpn. 2002, 66, 1619–1627. [Google Scholar] [CrossRef]
- Li, Y.; Wei, H.; Yang, J.; Du, K.; Li, J.; Zhang, Y.; Qiu, T.; Liu, Z.; Ren, Y.; Song, L.; et al. High-quality de novo assembly of the Eucommia ulmoides haploid genome provides new insights into evolution and rubber biosynthesis. Hortic. Res. 2020, 7, 183. [Google Scholar] [CrossRef] [PubMed]
- Nie, Z.; Kang, G.; Yan, D.; Qin, H.; Yang, L.; Zeng, R. Downregulation of HbFPS1 affects rubber biosynthesis of Hevea brasiliensis suffering from tapping panel dryness. Plant J. 2023, 113, 504–520. [Google Scholar] [CrossRef] [PubMed]
- Jie, B. Research on the Transcriptional Regulation of Key Enzymes of Rubber Biosynthesis by MYC and MYB Transcription Factors. Master’s Thesis, Hainan University, Haikou, China, 2014. [Google Scholar]
- Lin, X. Cloning and Characterization of the MYB Gene Family in Brazilian Rubber Tree. Master’s Thesis, Hainan University, Haikou, China, 2018. [Google Scholar]
- Hosoo, S.; Koyama, M.; Watanabe, A.; Ishida, R.; Hirata, T.; Yamaguchi, Y.; Yamasaki, H.; Wada, K.; Higashi, Y.; Nakamura, K. Preventive effect of Eucommia leaf extract on aortic media hypertrophy in Wistar-Kyoto rats fed a high-fat diet. Hypertens. Res. Off. J. Jpn. Soc. Hypertens. 2017, 40, 546–551. [Google Scholar] [CrossRef]
- Langmead, B.; Salzberg SL Langmead, B.; Salzberg, S.L. Fast gapped-read alignment with Bowtie 2. Nat. Methods 2012, 9, 357–359. [Google Scholar] [CrossRef]
- Anders, S.; Pyl, P.T.; Huber, W. HTSeq—A Python framework to work with high-throughput sequencing data. Bioinformatics 2014, 31, 166–169. [Google Scholar] [CrossRef] [PubMed]
- Grabherr, M.G.; Haas, B.J.; Yassour, M.; Levin, J.Z.; Thompson, D.A.; Amit, I.; Adiconis, X.; Fan, L.; Raychowdhury, R.; Zeng, Q.; et al. Full-length transcriptome assembly from RNA-Seq data without a reference genome. Nat. Biotechnol. 2011, 29, 644–652. [Google Scholar] [CrossRef]
- Haas, B.J.; Delcher, A.L.; Mount, S.M.; Wortman, J.R.; Smith, R.K., Jr.; Hannick, L.I.; Maiti, R.; Ronning, C.M.; Rusch, D.B.; Town, C.D.; et al. Improving the Arabidopsis genome annotation using maximal transcript alignment assemblies. Nucleic Acids Res. 2003, 31, 5654–5666. [Google Scholar] [CrossRef]
- Finn, R.D.; Coggill, P.; Eberhardt, R.Y.; Eddy, S.R.; Mistry, J.; Mitchell, A.L.; Potter, S.C.; Punta, M.; Qureshi, M.; Sangrador-Vegas, A.; et al. The Pfam protein families database: Towards a more sustainable future. Nucleic Acids Res. 2016, 44, D279–D285. [Google Scholar] [CrossRef] [PubMed]
- Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools: An Integrative Toolkit Developed for Interactive Analyses of Big Biological Data. Mol Plant. 2020, 13, 1194–1202. [Google Scholar] [CrossRef] [PubMed]
- Letunic, I.; Khedkar, S.; Bork, P. SMART: Recent updates, new developments and status in 2020. Nucleic Acids Res. 2021, 49, D458–D460. [Google Scholar] [CrossRef] [PubMed]
- Wilkins, M.R.; Gasteiger, E.; Bairoch, A.; Sanchez, J.C.; Williams, K.L.; Appel, R.D.; Hochstrasser, D.F. Protein Identification and Analysis Tools in the ExPASy Server. Methods Mol. Biol. 1999, 112, 531–552. [Google Scholar]
- Kumar, S.; Tamura, K.; Nei, M. MEGA: Molecular Evolutionary Genetics Analysis software for microcomputers. Comput. Appl. Biosci. 1994, 10, 189–191. [Google Scholar] [CrossRef]
- Ivica, L.; Peer, B. Interactive tree of life (iTOL) v3: An online tool for the display and annotation of phylogenetic and other trees. Nucleic Acids Res. 2016, 44, W242–W245. [Google Scholar]
- Chao, J.-T.; Kong, Y.-Z.; Wang, Q.; Sun, Y.-H.; Gong, D.-P.; Lv, J.; Liu, G.-S. MapGene2Chrom, a tool to draw gene physical map based on Perl and SVG languages. Hereditas 2015, 37, 91. [Google Scholar]
- Bailey, T.L.; Johnson, J.; Grant, C.E.; Noble, W.S. The MEME Suite. Nucleic Acids Res. 2015, 43, W39–W49. [Google Scholar] [CrossRef]
- Lescot, M.; Déhais, P.; Thijs, G.; Marchal, K.; Moreau, Y.; Van de Peer, Y.; Rouzé, P.; Rombauts, S. PlantCARE, a database of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res. 2002, 30, 325–327. [Google Scholar] [CrossRef] [PubMed]
- Ye, J.; Jin, C.F.; Li, N.; Liu, M.H.; Fei, Z.X.; Dong, L.Z.; Li, L.; Li, Z.Q. Selection of suitable reference genes for qRT-PCR normalisation under different experimental conditions in Eucommia ulmoides Oliv. Sci. Rep. 2018, 8, 15043. [Google Scholar] [CrossRef] [PubMed]
- Ke, Y.J.; Zheng, Q.D.; Yao, Y.H.; Ou, Y.; Chen, J.Y.; Wang, M.J.; Lai, H.P.; Yan, L.; Liu, Z.J.; Ai, Y. Genome-Wide Identification of the MYB Gene Family in Cymbidium ensifolium and Its Expression Analysis in Different Flower Colors. Int. J. Mol. Sci. 2021, 22, 13245. [Google Scholar] [CrossRef] [PubMed]
- Cao, Y.; Han, Y.; Li, D.; Lin, Y.; Cai, Y. MYB Transcription Factors in Chinese Pear (Pyrus bretschneideri Rehd.): Genome-Wide Identification, Classification, and Expression Profiling during Fruit Development. Front. Plant Sci. 2016, 7, 577. [Google Scholar] [CrossRef]
- Zou, Y. Identification of Rice MYB Transcription Factor Family Members and Mechanism of Their Stress-Resistance Regulatory. Master’s Thesis, Fujian Agriculture and Forestry University, Fuzhou, China, 2020. [Google Scholar]
- Du, H.; Yang, S.S.; Liang, Z.; Feng, B.R.; Liu, L.; Huang, Y.B.; Tang, Y.X. Genome-wide analysis of the MYB transcription factor superfamily in soybean. BMC Plant Biol. 2012, 12, 106. [Google Scholar] [CrossRef]
- Chen, X.; Mao, Y.; Chai, W.; Yan, K.; Liang, Z.; Xia, P. Genome-wide identification and expression analysis of MYB gene family under nitrogen stress in Panax notoginseng. Protoplasma 2023, 260, 189–205. [Google Scholar] [CrossRef]
- Wei, Q.; Liu, Y.; Lan, K.; Wei, X.; Hu, T.; Chen, R.; Zhao, S.; Yin, X.; Xie, T. Identification and Analysis of MYB Gene Family for Discovering Potential Regulators Responding to Abiotic Stresses in Curcuma wenyujin. Front. Genet. 2022, 13, 894928. [Google Scholar] [CrossRef]
- Hou, X.J.; Li, S.B.; Liu, S.R.; Hu, C.G.; Zhang, J.Z. Genome-Wide Classification and Evolutionary and Expression Analyses of Citrus MYB Transcription Factor Families in Sweet Orange. PLoS ONE 2014, 9, e112375. [Google Scholar] [CrossRef]
- Arce-Rodríguez, M.L.; Martínez, O.; Ochoa-Alejo, N. Genome-Wide Identification and Analysis of the MYB Transcription Factor Gene Family in Chili Pepper (Capsicum spp.). Int. J. Mol. Sci. 2021, 22, 2229. [Google Scholar] [CrossRef]
- Cannon, S.B.; Mitra, A.; Baumgarten, A.; Young, N.D.; May, G. The roles of segmental and tandem gene duplication in the evolution of large gene families in Arabidopsis thaliana. BMC Plant Biol. 2004, 4, 10. [Google Scholar] [CrossRef]
- Ober, D. Seeing double: Gene duplication and diversification in plant secondary metabolism. Trends Plant Sci. 2005, 10, 444–449. [Google Scholar] [CrossRef]
- Glasauer, S.M.K.; Neuhauss, S.C.F. Whole-genome duplication in teleost fishes and its evolutionary consequences. Mol. Genet. Genom. 2014, 289, 1045–1060. [Google Scholar] [CrossRef] [PubMed]
- Dias, A.P.; Braun, E.L.; McMullen, M.D.; Grotewold, E. Recently Duplicated Maize R2R3 Myb Genes Provide Evidence for Distinct Mechanisms of Evolutionary Divergence after Duplication. Plant Physiol. 2003, 131, 610–620. [Google Scholar] [CrossRef] [PubMed]
- Stracke, R.; Holtgräwe, D.; Schneider, J.; Pucker, B.; Sörensen, T.R.; Weisshaar, B. Genome-wide identification and characterisation of R2R3-MYB genes in sugar beet (Beta vulgaris). BMC Plant Biol. 2014, 14, 249. [Google Scholar] [CrossRef] [PubMed]
- Jeffares, D.C.; Penkett, C.J.; Bähler, J. Rapidly regulated genes are intron poor. Trends Genet. 2008, 24, 375–378. [Google Scholar] [CrossRef] [PubMed]
- Wittkopp, P.J.; Kalay, G. Cis-regulatory elements: Molecular mechanisms and evolutionary processes underlying divergence. Nat. Rev. Genet. 2011, 13, 59–69. [Google Scholar] [CrossRef]
- Hadiarto, T.; Tran, L. Progress studies of drought-responsive genes in rice. Plant Cell Rep. 2011, 30, 297–310. [Google Scholar] [CrossRef]
- Franklin, K.A. Light and temperature signal crosstalk in plant development. Curr. Opin. Plant Biol. 2009, 12, 63–68. [Google Scholar] [CrossRef]
- Phan, H.A.; Li, S.F.; Parish, R.W. MYB80, a regulator of tapetal and pollen development, is functionally conserved in crops. Plant Mol. Biol. 2012, 78, 171–183. [Google Scholar] [CrossRef]
- Bian, S.; Jin, D.; Sun, G.; Shan, B.; Zhou, H.; Wang, J.; Zhai, L.; Li, X. Characterization of the soybean R2R3-MYB transcription factor GmMYB81 and its functional roles under abiotic stresses. Gene 2020, 753, 144803. [Google Scholar] [CrossRef]
- Tusong, K.; Mamat, A.; Xu, J. Genome-Wide Investigation of NAC Family Genes Potentially Related to SCW Biogenesis in Korla Pear Fruit. Plant Mol. Biol. Report. 2022, 40, 674–686. [Google Scholar] [CrossRef]
- Kim, J.H.; Nguyen, N.H.; Jeong, C.Y.; Nguyen, N.T.; Hong, S.W.; Lee, H. Loss of the R2R3 MYB, AtMyb73, causes hyper-induction of the SOS1 and SOS3 genes in response to high salinity in Arabidopsis. J. Plant Physiol. 2013, 170, 1461–1465. [Google Scholar] [CrossRef]
- Wang, J.; Wang, J.; Zhang, H.; Yang, Y.; Davies, K.M. Isolation and Partial Characterization of an R2R3MYB Transcription Factor from the Bamboo Species Fargesia fungosa. Plant Mol. Biol. Report. 2011, 30, 131–138. [Google Scholar] [CrossRef]
- Zhong, R.; Lee, C.; Zhou, J.; McCarthy, R.L.; Ye, Z.H. A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis. Plant Cell 2008, 20, 2763–2782. [Google Scholar] [CrossRef] [PubMed]
- Park, J.S.; Kim, J.B.; Cho, K.J.; Cheon, C.I.; Sung, M.K.; Choung, M.G.; Roh, K.H. Arabidopsis R2R3-MYB transcription factor AtMYB60 functions as a transcriptional repressor of anthocyanin biosynthesis in lettuce (Lactuca sativa). Plant Cell Rep. 2008, 27, 985–994. [Google Scholar] [CrossRef]
- Higginson, T.; Li, S.F.; Parish, R.W. AtMYB103 regulates tapetum and trichome development in Arabidopsis thaliana. Plant J. 2003, 35, 177–192. [Google Scholar] [CrossRef]
- Zhu, J.; Zhang, G.; Chang, Y.; Li, X.; Yang, J.; Huang, X.; Yu, Q.; Chen, H.; Wu, T.; Yang, Z. AtMYB103 is a crucial regulator of several pathways affecting Arabidopsis anther development. Sci. China Life Sci. 2010, 53, 1112–1122. [Google Scholar] [CrossRef]
- Cominelli, E.; Galbiati, M.; Albertini, A.; Fornara, F.; Conti, L.; Coupland, G.; Tonelli, C. DOF-binding sites additively contribute to guard cell-specificity of AtMYB60 promoter. BMC Plant Biol. 2011, 11, 162. [Google Scholar] [CrossRef]
- Takamura, C.; Hirata, T.; Yamaguchi, Y.; Ono, M.; Miyashita, H.; Ikeda, T.; Nohara, T. Studies on the chemical constituents of green leaves of Eucommia ulmoides Oliv. J. Nat. Med. 2007, 61, 220–221. [Google Scholar] [CrossRef]
- Gould, K.S.; Mckelvie, J.; Markham, K.R. Do anthocyanins function as antioxidants in leaves? Imaging of H2O2 in red and green leaves after mechanical injury. Plant 2010, 25, 1261–1269. [Google Scholar]
- Stracke, R.; Ishihara, H.; Huep, G.; Barsch, A.; Mehrtens, F.; Niehaus, K.; Weisshaar, B. Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling. Plant J. 2010, 50, 660–677. [Google Scholar] [CrossRef]
- Wang, P.; Ma, G.; Zhang, L.; Li, Y.; Fu, Z.; Kan, X.; Han, Y.; Wang, H.; Jiang, X.; Liu, Y.; et al. A Sucrose-Induced MYB (SIMYB) Transcription Factor Promoting Proanthocyanidin Accumulation in the Tea Plant (Camellia sinensis). J. Agric. Food Chem. 2019, 67, 1418–1428. [Google Scholar] [CrossRef] [PubMed]
- Legay, S.; Guerriero, G.; Deleruelle, A.; Lateur, M.; Evers, D.; André, C.M.; Hausman, J.F. Apple russeting as seen through the RNA-seq lens: Strong alterations in the exocarp cell wall. Plant Mol. Biol. 2015, 88, 21–40. [Google Scholar] [CrossRef] [PubMed]
- Muñoz-Gómez, S.; Suárez-Baron, H.; Alzate, J.F.; González, F.; Pabón-Mora, N. Evolution of the Subgroup 6 R2R3-MYB Genes and Their Contribution to Floral Color in the Perianth-Bearing Piperales. Front. Plant Sci. 2021, 12, 633227. [Google Scholar] [CrossRef] [PubMed]
- To, A.; Joubès, J.; Thueux, J.; Kazaz, S.; Lepiniec, L.; Baud, S. AtMYB92 enhances fatty acid synthesis and suberin deposition in leaves of Nicotiana benthamiana. Plant J. 2020, 103, 660–676. [Google Scholar] [CrossRef] [PubMed]
- Cao, X.; Yan, J.; Lei, J.; Li, J.; Zhu, J.; Zhang, H. De novo Transcriptome Sequencing of MeJA-Induced Taraxacum koksaghyz Rodin to Identify Genes Related to Rubber Formation. Sci. Rep. 2017, 7, 15697. [Google Scholar] [CrossRef] [PubMed]










| Name | E Value | Sites | Width | Best Match |
|---|---|---|---|---|
| Motif 3 | 2.9 × 10−1218 | 116 | 21 | KKGPWTPEEDQKLLAYIEEHG |
| Motif 5 | 1.1 × 10−237 | 118 | 8 | GCWSSVPK |
| Motif 1 | 2.9 × 10−3712 | 104 | 50 | AGLLRCGKSCRLRWINYLRPDIKRGNFTQEEEDTIIKLHAILGNRWSAIA |
| Motif 2 | 2.2 × 10−1592 | 103 | 21 | HLPGRTDNEIKNYWNTHLRKK |
| Motif 4 | 6.2 × 10−341 | 60 | 11 | MGRSPCCDKVG |
| Motif 6 | 1.5 × 10−201 | 33 | 16 | LTKMGIDPVTHKPKSS |
| Motif 7 | 7.8 × 10−155 | 8 | 50 | NFVITRTPTQVASHAQKYFIRQLSGGKDKRRASIHDITTVNLNDNQTPSP |
| Motif 10 | 5.2 × 10−102 | 8 | 30 | ANLSHMAQWESARLEAEARLVRESKLLSNA |
| Motif 9 | 1.2 × 10−109 | 4 | 50 | QRFINNVSIKAHNYDVENPMQFRDVAYPIDPTLNMEPWKLPNFVEGFTDV |
| Motif 8 | 1.3 × 10−151 | 9 | 50 | WTAEENKLFENALAMIDKDMPDRWQRVAAMVPGKTVMDVIKQYKELEDDV |
| Arabidopsis | E. ulmoides | Regulation Function |
|---|---|---|
| MYB2/7 | MYB7/28 | seed germination, pollen formation, abscisic acid, drought stress [65] |
| MYB4 | MYB7/28/117 | inhibits the production of UV protective shade [66] |
| MYB20/80 | MYB32/39/44/73/109 | regulates drought stress and salt stress [67,68] |
| MYB60 | MYB38/60 | regulates guard cells, stomatal, anthocyanin biosynthesis, ABA [69,70] |
| MYB73/80 | MYB32/73/74 | salt stress, pollen development [71,72,73] |
| MYB85 | MYB56/119 | plant secondary cell wall biosynthesis [74] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Hu, X.; Li, Y.; Xia, Y.; Ma, Y. The MYB Transcription Factor Family in Eucommia ulmoides: Genome-Wide Identification, Characterization, and Network Analysis in Relation to the Rubber Biosynthetic Genes. Forests 2023, 14, 2064. https://doi.org/10.3390/f14102064
Hu X, Li Y, Xia Y, Ma Y. The MYB Transcription Factor Family in Eucommia ulmoides: Genome-Wide Identification, Characterization, and Network Analysis in Relation to the Rubber Biosynthetic Genes. Forests. 2023; 14(10):2064. https://doi.org/10.3390/f14102064
Chicago/Turabian StyleHu, Xiaotong, Yun Li, Yufei Xia, and Yanjun Ma. 2023. "The MYB Transcription Factor Family in Eucommia ulmoides: Genome-Wide Identification, Characterization, and Network Analysis in Relation to the Rubber Biosynthetic Genes" Forests 14, no. 10: 2064. https://doi.org/10.3390/f14102064
APA StyleHu, X., Li, Y., Xia, Y., & Ma, Y. (2023). The MYB Transcription Factor Family in Eucommia ulmoides: Genome-Wide Identification, Characterization, and Network Analysis in Relation to the Rubber Biosynthetic Genes. Forests, 14(10), 2064. https://doi.org/10.3390/f14102064
