You are currently viewing a new version of our website. To view the old version click .
Diversity
  • Article
  • Open Access

6 November 2024

The Mosquitoes (Diptera: Culicidae) of Sonora: Distribution, Ecology, and the First Records of Aedes deserticola Zavortink and Toxorhynchites septentrionalis (Dyar and Knab) in México

,
,
,
,
and
1
Departamento de Parasitología, Universidad Autónoma Agraria Antonio Narro, Unidad Laguna, Torreón 27054, Mexico
2
Laboratorio de Variación Biológica y Evolución, Departamento de Zoología, Escuela Nacional de Ciencias Biológicas, Instituto Politécnico Nacional, Prolongación de Carpio y Plan de Ayala s/n, Mexico City 11340, Mexico
3
Centro de Biotecnología Genómica, Instituto Politécnico Nacional, Blvd. Del Maestro Esquina Elias Piña, Col. Narciso Mendoza, Reynosa 88710, Mexico
4
Vector Borne Diseases Research Group, Virology Department, Animal and Plant Health Agency, Addlestone KT15 3NB, UK
This article belongs to the Special Issue Biodiversity in Arid Ecosystems

Abstract

The diversity and distribution of mosquitoes from Sonora, Mexico, was documented through entomologic surveys conducted in the four physiographic regions and sub-regions of Sonora: the Sonoran Plain, the Sierra Madre Occidental, the Northern Mountains and Plains, and the Pacific Coastal Plain. Immature stages were collected from aquatic habitats, while adult mosquitoes were collected using Shannon traps, resting in vegetation, and by human landing collections. Overall, 11,316 specimens, which comprised 493 larvae, 224 larval exuviae, 400 pupal exuviae, 33 pupae, 4552 females, 5607 males, and seven male genitalia, were identified. Two subfamilies: Anophelinae and Culicinae, seven tribes, 10 genera, 23 subgenera, and 56 species are reported below. Of these, one tribe, one genus, five subgenera, and 15 species were recorded for the first time in Sonora. Two species, Aedes deserticola Zavortink and Toxorhynchites septentrionalis (Dyar and Knab), are the first recordings of their kind nationwide. Toxorhynchites septentrionalis was also barcoded with the cytochrome oxidase subunit 1 (COI) gene. The presence of Psorophora columbiae (Dyar and Knab) is confirmed in Mexico. Taxonomic notes, new geographic distribution limits of mosquitoes in Sonora, and information regarding their importance as disease vectors are provided. By adding Ae. deserticola and Tx. septentrionalis and confirming Ps. columbiae in Mexico, there are currently 251 mosquito species in the Country.

1. Introduction

Mosquitoes (Diptera: Culicidae) are biting insects that are of public and animal health interest as some species serve as disease vectors of pathogens for humans and livestock [1], such as dengue, Chikungunya, Japanese encephalitis, yellow fever, West Nile, Rift Valley fever, and Zika viruses, as well as of nematodes and protozoans, such as Dirofilaria spp. and Plasmodium spp. [1,2]. Hence, mosquitoes are often the focus of surveillance and control programs worldwide [3]. Mosquitoes also serve as ecological indicators of landscape degradation [4,5,6]. Eleven out of thirty-two states in Mexico have been systematically studied in terms of mosquito taxonomy, ecology, and distribution. There are 26 species in Tlaxcala [7], 29 in Mexico City [8,9,10], 50 in Querétaro [11], 51 in Mexico State [12], 57 in Hidalgo [13,14], 58 in Morelos [10], 68 in Nuevo León [15,16,17,18], 76 in Quintana Roo [18,19,20,21,22,23,24], 80 in Tamaulipas [18,25], 105 in Tabasco [18,26,27,28,29], and 139 in Veracruz [18,30,31,32].
Prior to this study, 248 species of Culicidae mosquitoes belonging to twenty-one genera have been reported in Mexico [10,18], of which nine genera and 41 species have been reported in the state of Sonora. However, most records were based on collections made in urban and sub-urban regions. Thus, eastern mountain regions of the Sierra Madre Occidental of Sonora remained an area to be surveyed. Sonora is the twelfth state of Mexico to have the list of mosquito species updated. Most specimens collected and examined were mostly deposited in the Culicidae Collection of the Parasitology Department of the Autonomous Agrarian University Antonio Narro, Laguna unit, Torreón, Coahuila, Mexico, while some other specimens were deposited in local entomological collections of Sonora.

2. Material and Methods

2.1. Study Area

Sonora is located in north-western Mexico (32°29′ and 26°14′ NL; 108°26′ and 205°2′ WL). This state, with an area of 179,355 km2, is the second largest in Mexico after Chihuahua. To the north, Sonora borders Arizona, USA, to the south with Sinaloa and the Gulf of California, to the west with Baja California and the Gulf of California, and to the east with Chihuahua and Sinaloa. Sonora is divided into four physiographical regions and sub-regions indicated in parenthesis: Sonoran Plain (Altar Desert, Pinacate Mountains, Sonoran Mountains and Plains), Sierra Madre Occidental (Sierras and Valleys of the North, Sierras and Glens of the North, Foot of the Sierra, Great Chihuahuan Plateau and Canyons), Northern Mountains and Plains (Northern Dunes and Plains), and Pacific Coastal Plain (Coastal Plain and Deltas of Sonora and Sinaloa) [33] (Figure 1). The regions and sub-regions of Sonora, including the municipalities surveyed, are depicted in Table 1. Here, entomological surveys were conducted in four physiographical regions and sub-regions of Sonora during the dry and rainy seasons (Table 1), and a complete checklist of 56 species of Sonora is reported in Result section table.
Figure 1. Physiography of Sonora state. Red box shows the study area. Map originally created for this article.
Table 1. Description of physiography of Sonora and municipalities surveyed for mosquitoes [33].

2.2. Mosquito Collection and Identification

Immature stages (except eggs) and adult mosquitoes were collected in specific sites in the four physiographic regions of Sonora (Table 1) during the dry and rainy seasons from 2018 through 2022. Immature stages were collected from any available water body found in the collection site, and some environmental parameters were recorded, such as pH, salinity, and temperature, which were measured using a portable Hanna® (mod. HI98129) tester. Immature stages were also collected using plastic ovitraps deployed in the branches of some trees to mimic tree holes containing rainwater. Live larvae and pupae were placed in plastic bags containing water from the original aquatic habitat and transported to the Laboratorio de Biología Molecular of the Parasitology Department of the Autonomous Agrarian University Antonio Narro Laguna unit (LBM-UAAAN-UL). A portion of individual fourth-instar larvae from each collection site was mounted on microscope slides containing Euparal for larval identification. Other individual larvae were placed into emergence tubes to obtain the adult stage and associated larval and pupal exuviae. Male genitalia were dissected solely when taxonomic identification required it. Host-seeking mosquitoes were collected using human landing collections and Shannon traps containing humans deployed between 10:00 and 15:00 h. and between 20:00 and 24:00 h. Resting mosquitoes were aspirated directly from caves and vegetation using mechanical aspirators. Adult mosquitoes were killed with triethylamine vapors, mounted on insect pins, and identified using taxonomic keys through a stereomicroscope Discovery V8 (Zeiss) (Oberkochen, Germany). Immature stages and exuviae were identified using a microscope Primostar (Zeiss). The Harbach and Knight [34] criteria for mosquito anatomy and Wilkerson et al. [35] for Aedini classification were followed in this study. Biological information for each species that are recorded for the first time in the state are noted; the northernmost and southernmost distributions of the species as well as the known medical importance of each species are noted (Table 2).
Table 2. Collection data of first records of Culicidae species in Sonora. Aquatic habitat characteristics and environmental parameters (pH, temperature, and concentrations of dissolved salts), collection site and municipality of Sonora; coordinates and elevation as well as date of collection and associated species are shown.

2.3. Genomic DNA Extraction and COI Amplification

A modified hotshot technique was used for genomic DNA extraction [36,37]. Briefly, two legs from a Tx. septentrionalis (Dyar and Knab) individual (serving as a voucher specimen) were placed into a micro-vial containing 50 µL of alkaline lysis buffer (25 mM NaOH, 0.2 mM Na2EDTA) followed by sonication (Grant Ultrasonic 3L Bath) in a water bath for 20 min. Incubated afterwards in a thermocycler for 30 min at 94 °C and cooled for 5 min at 4 °C. The sample was centrifuged for 3 min at 3000 rpm, and 50 µL of neutralizing buffer (40 mMTri-HCL) were added. PCR amplification for the COI barcode gene [38,39] was performed using Folmer primers (LCO1490 and HCO2198) and the Qiagen PCR system using a reaction mix final volume of 50 μL containing 2 μL DNA template, 25 μL H2O, 5 μL NH4, 5 μL dNTPs (2 mM/μL), 2.5 μL MgCl2 (25 mM/μL), 0.1 μL Bioline taq polymerase (Bioline Reagents Ltd., London, UK), 5 μL each primer at 10 pmol/μL, and 0.38 μL bovine serum albumin (20 mg/mL) [36,37]. PCR conditions included an initial denaturation step at 94 °C for 1 min, 5 pre-amplification cycles of 94 °C for 1 min, 45 °C for 1.5 min, and 72 °C for 1.5 min, followed by 35 amplification cycles of 94 °C for 1 min, 57 °C for 1.5 min, and 72 °C for 1 min. A final elongation step of 72 °C for 5 min was also performed. The PCR products were visualized through a 1.5% agarose gel, and the sample showed bands of the COI size bidirectionally sequenced using the ABI PRISM® BigDye® Terminator v3.1 Cycle Sequencing Kit (Applied Biosystems, Waltham, MA, USA). Toxorhynchites septentrionalis COI sequence and specimen data were uploaded in the Barcode of Life Database (BOLD) system with project named: Vectors of México Initiative.

2.4. Genetic Data Analysis

For molecular species identification using the COI DNA barcoding region, the protocols of Hebert et al. [38,39] and Hernández-Triana et al. [40,41] were followed. Amplicons were obtained using a Qiagen PCR system following the reaction mix of Hernández-Triana et al. [3]. The dataset was analyzed in MEGA v.6 [42]. Two sequences were retrived whose presumptive identity was Tx. Septentrionalis; additional Toxorhynchites spp. sequences were obtained from BOLD and/or GeneBank databases: six sequences of specimens identified as Tx. theobaldi (Dyar and Knab) (GeneBank: KY82650, KY86252–55) from specimens collected in Mexico; five sequences of Tx. moctezuma (Dyar and Knab) (BOLD:ADS6264) from specimens collected in Mexico; and five sequences of Tx. haemorrhoidalis (Fabricius) (BOLD:AXA1098) from specimens collected in Costa Rica were added to the dataset. One sequence of Cx. pipiens L. (Gene Bank:GU908074) was included as an outergroup for the phylogenetic analysis. A Bayesian inference was performed in BEASTv.2.6.7 [43] using the Hasegawa–Kishono–Yano (HKY) substitution model, assuming different nucleotide frequencies and transition/transversion rates, and estimated parameter priors with the Yule model. Three independent Markov chains of 10,000,000 replicates were run with sampling every 10,000. The sample parameters were combined with LogCombiner, and basic parameters were checked in Tracer v.1.7.1 [44]. The sampled trees were combined with LogCombiner and then summarized with TreeAnnotator. The posterior probability was calculated for each node in a maximum clade credibility tree with a burn-in of 10%. For barcode sequences larger than 500 bp, a barcode index number (BIN) was assigned, and each BIN was mapped according to species. The taxonomic discordance in the dataset [3] was analyzed using BOLD as detailed in Ratnasingham and Hebert [45].

2.5. Ethical Consideration

Mosquitoes were collected using human landing collections by co-author AIOM, brigades of the Ministry of Health (public health and vector control programs), and personnel from the Sonora Entomological and Bioassay Research Unit of Sonora (UIEB). The UIEB serves as a reference laboratory for the identification and examination of vectors collected by the State Ministry of Health. This study was approved by the Ethics Committee of the Antonio Narro Autonomous Agrarian University (UAAAN), the National Center of Preventive Programs and Disease Control (CENAPRECE), and the Sonora University (UNISON).

3. Results

3.1. Mosquitoes and New Records

A total of 11,316 specimens from 139 collection samples were studied. Of these, specimens were 493 fourth-instar larvae, 224 larval exuviae, 400 pupal exuviae, 33 pupae, 4552 adult females, and 5607 adult males. Seven genitalia of males were dissected. The mosquito fauna of Sonora consists of two subfamilies, seven tribes, 10 genera, 23 subgenera, and 56 species. Of these, one tribe (Uranotaeniini), one genus (Uranotaenia), five subgenera (Lewnielsenius, Janthinosoma, Anoedioporpa, Phenacomyia, and Uranotaenia), and 15 species: Anopheles franciscanus McCraken, Ae. deserticola Zavortink, Ae. muelleri Dyar, Ae. trivittatus (Coquillett), Haemagogus equinus Theobald, Psorophora longipalpus Randolph and O’Neill, Culex restrictor Dyar and Knab, Cx. erythrothorax Dyar, Cx. apicalis Adams, Cx. arizonensis Bohart, Cx. lactator Dyar and Knab, Toxorhynchites septentrionalis (Dyar and Knab), Uranotaenia geometrica Theobald, Ur. lowii Theobald, and Ur. sapphirina (Osten Sacken) are recorded for the first time in Sonora. Aedes deserticola and Tx. septentrionalis were first reported in Mexico (Table 3). Thus, the species accumulation curve of a total of 43 mosquito species collected is shown in Figure 2. In addition, medical importance of mosquitoes with known status as disease vectors in Sonora is provided in Table 4.
Table 3. Checklist of mosquito species of Sonora. Ho: [46]. Ma1: [47]. Va1: [48]. Va2: [49]. Ma2: [50]. Va3: [51]. DV: [52]. Za: [53]. HB: [54]. Ma3: [55]. F.R.: first record. FSR: first state record. FNR: first nationwide record. First records in Sonora are indicated in bold letters. a Reported as Anopheles barberi Coquillett. b Reported as Psorophora confinnis (Lynch Arribálzaga). c Reported as Ps. virescens Dyar and Knab. d Reported as Culex virgultus Theobald. e Reported as Cx. peus Speiser. Species were identified using identification keys (Carpenter and LaCasse [56], Zavortink [57], Zavortink [53], Arnell and Nielsen [58], and Darsie and Ward [59].
Figure 2. Species accumulation curve for 45 mosquito species collected at 139 site collections in Sonora from 2021 through 2022.

3.2. Biological and Ecological Notes for the New State Records

The collection sites, date of collection, larval habitat characteristics, aquatic parameters, and associated species are shown in Table 2.

3.2.1. Genus Anopheles

In Sonora, two subgenera and six species of Anopheles occurred; one species was recorded for the first time. Namely, immature stages of An. franciscanus were collected in northern Sonora, bordering with Arizona, USA; the aquatic habitats were stream margins and ground level ponds, always with abundant aquatic vegetation surrounding the habitats during the dry and rainy seasons. The municipalities where An. franciscanus was found were: Cumpas, Agua Prieta, and Imuris.

3.2.2. Genus Aedes

Three out of the eleven species of Aedes found in Sonora were recorded for the first time: Ae. deserticola, Ae. muelleri, and Ae. trivittatus; one subgenus Lewnielsenius was also recorded for the first time. One single Ae. deserticola and Ae. muelleri adult females were obtained from immature stages collected from a discarded tire with colored water and abundant leaves at the bottom in a mountain site of the Cananea municipality, near Arizona, USA; Ae. muelleri was collected using human landing collections in a forested site with partial shade of the Cananea municipality; and Ae. trivittatus adult females were usually collected when Shannon traps containing humans were deployed at day in several collection sites during the rainy season. All collection sites where these Aedes species were collected belong to the Sierra Madre Occidental region.

3.2.3. Genus Haemagogus

One of the two Haemagogus species in Sonora was recorded for the first time in the area, Hg. equinus adult females were collected during daylight hours in a sub-tropical site of southern Sonora, near Sinaloa. This collection site belongs to the Sierra Madre Occidental region. Another species of this genus reported in Sonora is Hg. Mesodentatus, which is potentially sympatric with Hg. equinus in southern Sonora.

3.2.4. Genus Psorophora

The subgenus Janthinosoma of Psorophora was recorded for the first time in the area. Psorophora longipalpus adult females were collected using human landing collection while intending to bite at day light hours in a site with partial shade in coastal Navojoa municipality. Specimens were deposited in the state public health mosquito collection, in Hermosillo municipality.

3.2.5. Genus Culex

Culex is the most diverse group in Sonora. Five out of twenty species were recorded for the first time, which also included the subgenera Anoedioporpa and Phenacomyia. Culex restrictor adults were collected resting in caves at ground level with total shade in a mountain collection site in the Sierra Madre Occidental; while Cx. erythrothorax females were caught using Shannon traps containing humans at night in another mountain collection site near Arizona, USA border; immature stages of Cx. apicalis were collected from discarded tires in a forested site in the Sierra Madre Occidental region; at this same collection site, immature stages of Cx. arizonensis where also found. In Sonora, species belonging to the subgenus Neoculex such as Cx. apicalis, Cx. arizonensis and Cx. territans are sympatric, thus, all those species were found at the same collection sites near the Yécora municipality in the Sierra Madre Occidental region. Finally, immature stages of Cx. lactator were usually found from temporal ground pools, at ground level, in different collection sites, while adult stages were collected resting in vegetation. This is a common species in Sonora.

3.2.6. Genus Toxorhynchites

Toxorhynchites septentrionalis is was recorded for the first time in Sonora and nationwide. Immature stages were collected from one discarded tire with colored water in one forest site of Álamos municipality in southern Sonora, a humid and sub-tropical area of the Sierra Madre Occidental region. Specimens were deposited at the UIEB mosquito collection in Navojoa municipalty. The other species previously reported in Sonora is Tx. moctezuma; as distribution limits of Tx. moctezuma remain unknown, thus, both species are sympatric and considered valid records.

3.2.7. Genus Uranotaenia

The tribe Uranotaeniini, genus Uranotaenia, subgenus Uranotaenia, and the species Ur. geometrica, Ur. lowii, and Ur. sapphirina were recorded for the first time in Sonora. Uranotaenia geometrica adults were collecting resting inside a discarded tire in Yécora municipality. These mosquitoes were observed before being caught using a mouth aspirator. Females were actively walking on the inner side of the tire; some refused to fly even if disturbed with the tip of the aspirator. A single female seemed to protect their freshly laid eggs, laid on the water surface using her mid legs. The eggs were collected, but did not hatch under the laboratory conditions. Ur. lowii is perhaps the most common species of the genus Uranotaenia in Mexico. Adults were found resting in vegetation in one collection site near Sinaloa, while immature stages were collected from small aquatic habitats in two collection sites near the coast area; finally, Ur. sapphirina immature stages were collected from natural and artificial breeding sites in a forested collection site in the Sierra Madre Occidental region of Yécora municipality. As Ur. sapphirina feeds on leenches [60], we pernocted overnight at the collection site where this species was found, but we did not observe leenches or other helminthes around, only earthworms. All Uranotaenia species were collected during the rainy season.
Table 4. Medical and veterinary importance as disease vectors of pathogens of Sonora. Pla: Plasmodium (Malaria). DI: Dirofilaria immitis. DENV: dengue virus. ZIKV: Zika virus. CHIKV: Chikungunya virus. YF: yellow fever virus. SLE: St. Louis encephalitis virus. WNV: West Nile virus. VEEV: Venezuelan equine encephalitis virus. EEEV: Eastern equine encephalitis virus. WEEV: Western equine encephalitis virus. LCV: La Crosse virus [61]. * Host-seeking mosquitoes caught using human landing collections at day light hours. ** Host-seeking mosquitoes caught using human landing collections at night hours.
Table 4. Medical and veterinary importance as disease vectors of pathogens of Sonora. Pla: Plasmodium (Malaria). DI: Dirofilaria immitis. DENV: dengue virus. ZIKV: Zika virus. CHIKV: Chikungunya virus. YF: yellow fever virus. SLE: St. Louis encephalitis virus. WNV: West Nile virus. VEEV: Venezuelan equine encephalitis virus. EEEV: Eastern equine encephalitis virus. WEEV: Western equine encephalitis virus. LCV: La Crosse virus [61]. * Host-seeking mosquitoes caught using human landing collections at day light hours. ** Host-seeking mosquitoes caught using human landing collections at night hours.
TaxaPlaDIDENVZIKVCHKVYFSLEWNVVEEVEEEVWEEVLCV
Anopheles freeborni
An. pseudopunctipennis
An. punctipennis
An. albimanus
Aedes vexans
Ae. ramirezi *
Ae. epactius *
Ae. muelleri *
Ae. taeniorhynchus
Ae. trivittatus
Ae. podographicus *
Ae. aegypti
Haemagogus equinus *
Hg. mesodentatus
Psorophora columbiae
Ps. ciliata
Ps. howardii *
Culex erythrothorax **
Cx. interrogator *
Cx. nigripalpus
Cx. quinquefasciatus
Cx. restuans
Cx. salinarius
Cx. stigmatosoma **
Cx. tarsalis
Cx. erraticus
Culiseta inornata
Coquillettidia perturbans

3.3. Molecular Analysis, COI-Barcoding Identification, and Cryptic Diversity

Two DNA barcode sequences from Tx. septentrionalis were examined. One was from a single adult female (accession number No. 08210922-MN), and the other one was downloaded from the BOLD system associated with one specimen originally identified as Tx. rutilus (Coquillett) collected by UIEB-Sonora personnel (BOLD:AAK1973); both specimens were collected at the same collection site near the Álamos municipality. As a result of the phylogenetic analysis, both sequences were grouped together within the sequences NEONU980-12 and NEONU981-12, forming a clade for the Tx. septentrionalis species with a strong support value (0.998). In addition, the rest of the sequences analyzed clustered in well-defined clades for the Toxorhynchites species: Tx. theobaldi (0.9198), Tx. moctezuma (1), and Tx. haemorrhoidalis (1), also with strong support values. In contrast, Tx. rutilus sequences did not show a consistent pattern; however, ACMC010-04 diverged from Tx. theobaldi/Tx. moctezuma clade (0.5192), while GMCGG105-14 grouped with the Tx. theobaldi sequences (Figure 3).
Figure 3. Bayesian phylogenetic tree of COI DNA barcoding for Toxorhynchites spp. Red box shows Tx. septentrionalis of this study.

3.4. Medical Importance of the Mosquitoes of Sonora

Some Culicidae species reported in Sonora are of medical and veterinary importance as disease vectors of pathogens (Table 4). Although the animal or human importance of some Culicidae species is still unknown, host-seeking species caught using human landing collection methods were noted.

4. Discussion and Conclusions

4.1. Mosquito Species-Groups Reaching Their Distributional Limits in Sonora

Based on collection records and the known distribution of mosquito species in Sonora, four groups of species can be recognized. Some species in each group have similar geographic distribution reaching either the northern or southern limits in Sonora, also sharing same or similar aquatic habitat characteristics and environmental parameters.

4.1.1. Group 1

Species occurring in the Nearctic region and extending into northern Mexico were reaching their southern limit in Sonora. The immature stages of these species develop in artificial or natural aquatic sites such as trees or rockholes containing rainwater. Species of Aedes subgenera: Kompia and Jarnellius. Aedes species within this group are desert-like mosquitoes distributed from the southwest of Arizona to northern Baja California and Sonora. In this group, Ae. purpureipes, Ae. deserticola, and Ae. monticola are included. Aedes purpureipes was originally described by Aitken [62] from specimens collected in Distrito del Sur, Baja California, and was designated as type material of the monobasic subgenus Kompia. More specimens were collected in Santa Cruz municipality of Arizona [58]; the larvae were collected and described from specimens collected from one tree hole in San Blas municipality of Sinaloa by Vargas [63]; some collection records in Sonora were prvodied by Henimann and Belkin [54]. Aedes purpureipes is known only in the southwestern United States, in California and Arizona [56,64], and in Baja California, Nayarit, Oaxaca, Sinaloa, and Sonora of Mexico [52]. Although records indicate the southernmost limit of Ae. purpureipes as southern Mexico (Oaxaca), this is doubtful, but this record remains valid until additional specimens for this species can be collected and examined from this region. Aedes deserticola was described by Zavortink [57] from specimens collected in Los Angeles municipality, California, United States. Here, immature stages were collected from a discarded tire in Cananea municipality, northern Sonora, near the Mexico–Arizona border. Thus, it is the first record of Ae. deserticola in Mexico and an outer record from the United States. This species occurs in southwestern and western Arizona [53,65,66] where it can be sympatric with local populations of Ae. monticola. Aedes deserticola adult females are distinguished from other species of Jarnellius subgenus by the following characters [58]: Postcoxal area without scales; subspiracular area without setae; base of hindtarsal segment IV without one broad ring of white scales, which is very narrow if is present; metameron without scales; and postpronotum without dark scales (Figure 4). Aedes monticola was described by Belkin and McDonald [67] from specimens collected in Santa Cruz county, Arizona, United States. This species is found in the southwestern United States, in Arizona and New Mexico [67,68], and northwestern Mexico in Sonora [52]. Toxorhynchites septentrionalis (Figure 5) is included in this group because it reaches the southernmost distributional limit in Sonora. This species was originally described as Megarhinus septentrionalis by Dyar and Knab [69] from specimens collected in the District of Columbia, United States. Afterwards, this taxon was reduced to sub-specific status of Tx. rutilus by Jenkins and Carpenter [70]. Further, Tx. septentrionalis returned to valid species status [71]. Toxorhynchites septentrionalis has been found in the North Atlantic and southeastern United States [59]. In Mexico, specimens of this species were collected from one discarded tire in Álamos municipality. Adults are also deposited in the UIEB of Sonora collection in the Navojoa municipality, where there is a common species (Med. entomol. of Sonora, pers. com.). Toxorhynchites septentrionalis is distributed from the North Atlantic of the United States, throughout the Mid-Atlantic and southeastern Atlantic, reaching its southernmost distribution limit in the Sierra Madre Occidental of Sonora. Our hypothesis is that this species is also present in New Mexico and Arizona, USA, and Chihuahua, Mexico, but this needs to be further investigated.
Figure 4. Aedes deserticola. female. PSc: postcoxal area. SA: subspiracular area. Mem: metameron. Ppn: postpronotum.
Figure 5. Toxorhynchites septentrionalis, male.

4.1.2. Group 2

Species occurring in the Nearctic region and extending into northern Mexico were reaching their southern limit in Sonora. Immature stages are in swamps and ponds at ground level; they include the species Anopheles freeborni, which was originally described by Aitken [72] as a sub-species of An. maculipennis Meigen from specimens collected in Davis, California, EUA, and further designated as valid species by King and Bradley [73]. Anopheles freeborni is found in southern Canada, the western arid and semi-arid regions of the United States, and northwestern Mexico in Baja California and Sonora. Although, in this study, we were not able to find this species, we reviewed the Collection of Insects and Mites of Medical Importance deposited at the Institute of Diagnosis and Epidemiological Reference (CAIM-INDRE) in Mexico City and observed large numbers of An. freeborni mounted on insect pins previously collected in Sonora.

4.1.3. Group 3

Species occurring in the neotropical region extend into northern Mexico were reaching their northern limit in Sonora. Immature stages are in artificial or natural aquatic sites such as trees or rockholes containing rainwater. Include Aedes ramirezi, Ae. podographicus, Haemagogus mesodentatus, and Culex restrictor. Although Ae. ramirezi is placed in this group, this Mexican endemic species is distributed mainly in sites related to the Nearctic region. Aedes ramirezi was originally described by Vargas and Downs [74] from specimens collected in Cuernavaca, Morelos; this species has also been found in Jalisco, Morelos, Sinaloa, Sonora, and Veracruz [52]. Adult females can bite humans during the day and dusk; however, the medical importance is still unknown. Aedes podographicus was originally described by Dyar and Knab [75] from specimens collected in Sonsonate, El Salvador. This species has also been found in Belize, Costa Rica, Ecuador, El Salvador, Guatemala, Honduras, Mexico, Nicaragua, and Panama [76]; in Mexico, Ae. podographicus is common within the Terrens group in the coastal and tropical regions of the south-east, being a frequent human-biting species during the day, but the medical importance of this species is still unknown. Haemagogus mesodentatus was originally described by Komp and Kumm [77] from specimens collected in San Jose, Costa Rica; this species occurs in Belize, Costa Rica, El Salvador, Guatemala, Mexico, and Panama [76]. In Mexico, this species has also been recorded in Campeche, Chiapas, Guerrero, Morelos, Nayarit, Oaxaca, Puebla, Sinaloa, Sonora, Tabasco, Veracruz, and Yucatán [52,78], being Sonora’s northernmost distribution limit, which apparently is restricted to the tropical, sub-tropical areas of the Pacific Coastal Plain and the Sierra Madre Occidental regions. Culex restrictor was originally described by Dyar and Knab [79] from specimens collected in Almoloya, Oaxaca, Mexico; this species has also been found in Belize, Brazil, Colombia, Costa Rica, El Salvador, Guatemala, Honduras, Mexico, Nicaragua, Panama, and Venezuela [76]; in Mexico, this species has been collected in tree holes in several states of the neotropical region but have also been found in temperate and conserved areas of Mexico [12,15]; in Sonora, Cx. restrictor is a rare species, and its distribution is restricted to the forested region of the Sierra Madre Occidental. Our hypothesis is that all species included in this group could extend their distribution range further north than they were found, through the Sierra Madre Occidental region and they could reach and inhabit the forested area of northern Sonora, in the Northern Mountains and Plains region (Figure 1) where there is no physiographic disruption between both physiographic regions, but rather the ecotone between them allows woody trees to grow in whose tree holes these species could develop. If this were the case, species of this group could inhabit the isolated mountain ranges of southern Arizona.

4.1.4. Group 4

Species occurring in neotropical region extending into northern Mexico, where they reaching their northern distribution limit in Sonora. Immature stages are in swamps and ponds at ground level; include the species Culex bidens and Uranotaenia geometrica. Culex bidens was originally described by Dyar [80] from specimens collected in Rosario, Bolivia; this species occurs in Argentina, Bolivia, Brazil, Colombia, Costa Rica, Mexico, Nicaragua, Paraguay, Uruguay, and Venezuela [81]. Although this species was not found in this study, the occurence records of Cx. bidens are relatively common in Mexico, and the species is well known [82]. Uranotaenia geometrica was originally described by Theobald [83] from sepecimens collected in São Paulo, Brazil; this species occurs in the neotropical region from Brazil to Mexico, where it reaches its northernmost distribution limit. The previous group, Cx. bidens and Ur. geometrica could be present in northern Sonora, as well as southern Arizona.

4.2. Confirmation of Psorophora columbiae in Mexico

In the latest inventory of mosquito species in Mexico [18], Ps. confinnis (Arribálzaga) was removed from the species list because this taxon had historically been confused and misidentified with another species in the Confinnis group. Psorophora columbiae was not included in the Mexican species list until additional material of species within the Confinnis group could be further studied. In Sonora, immature stages of Ps. columbiae were collected from a temporal pond with partial shade and abundant aquatic vegetation in a sub-arid area of the Fronteras municipality; from a temporal pound with total shade in the Moctezuma municipality; and from a temporal pond in a site near the coast with partial shade and abundant aquatic vegetation in the Navojoa municipality. Adult Ps. columbiae mounted on insect pins and deposited in the UIEB mosquito collection were also examined. The presence of Ps. columbiae is confirmed in Mexico and this species occurs in Baja California, Baja California Sur, Campeche, Chiapas, Coahuila, Colima, Durango, Guerrero, Jalisco, Michoacán, Morelos, Nuevo León, Oaxaca, Puebla, Quintana Roo, San Luis Potosí, Sinaloa, Sonora, Tabasco, Tamaulipas, Veracruz, and Yucatán.

4.3. Species Not Collected in This Study

Nine species of this group were not found in this study, but records were obtained from the literature reports, including those from Vargas [48]: Anopheles freeborni and An. judithae. In Mexico, those Anopheles species have been reported previously in northwestern Mexico; An. freeborni was not found in this study, although data from labels of specimens mounted on insect pins from CAIM collection (see Group 2 of previous section) shows this species is common during the rainy season in the border municipalities of Agua Prieta and Nogales. Anopheles judithae is one of the rarest mosquito species in Mexico; this tree-hole Anopheles has been found from southern Arizona, New Mexico, and Texas [84,85] up to the Sierra Madre Occidental in Zacatecas [54]. Although surveys were conducted in the Imuris municipality, where An. judithae was previously reported [85], deploying ovitraps in tree trunks to mimic the aquatic habitat of the immature stages, this species was absent in our survey.
Martínez-Palacios [50]: Culex bidens. This tropical species has been previously reported from Argentina to Mexico. In Mexico, this species has been reported in different states, where apparently it seems a common mosquito in tropical regions of Mexico. However, it was not found in our study.
Zavortink [53]: Aedes burgeri. In Mexico, this species has been reported in Jalisco, Sinaloa, and Sonora [54]; immature stages of this species develop in tree holes containing rainwater, but as this habitat was not observed during our study, Ae. burgeri and other tree-hole species such as An. judithae, Ae. Monticola, and Hg. mesodentatus were not found.
Díaz-Nájera and Vargas [52]: Aedes monticola, Culiseta impatiens, Cs. incidens, and Cs. inornata. In Mexico, Ae. monticola is known only in Sonora; this may have been absent in our study due to the above reasons. Distribution in Mexico of Cs. impatiens was recently reviewed, and its presence was confirmed for Sonora and Nuevo León [18]. Cs. incidens has been reported in Baja California, Baja California Sur, Coahuila, Mexico State, Sonora, and Tlaxcala, while Cs. inornata has been reported in all previous states as well as in Aguascalientes, Durango, Hidalgo, Mexico City, Nuevo León, and Tamaulipas [10]. All these species of Culiseta are common during the winter and can be found in temporal ground ponds with cold water even when the surface of the water is frozen; our surveys were conducted only during the dry and rainy seasons, with no surveys conducted during the winter season.
Heinemann and Belkin [54]: Haemagogus mesodentatus. In Mexico, this tropical species has been reported in Chiapas, Colima, Guerrero, Mexico State, Morelos, Nayarit, Oaxaca, Puebla, Sinaloa, Tabasco, Veracruz, and Yucatán [12,52,78,86]. In Sonora, within the genus Haemagogus, only Hg. equnius was found.

4.4. Species from Adjacent Regions That May Occur in Sonora

Numerous species of mosquitoes that have not yet been reported from Sonora but occur in the adjacent states of Arizona and/or Chihuahua can logically be expected to occur within Sonora. Included among these 10 species in Arizona are Aedes papago Zavortink*, Ae. varipalpus (Coquillett)*, Aedes cataphylla Dyar*, Ae. fitchii (Felt and Young)*, Ae. implicates Vockeroth*, Ae. nigromaculis (Ludlow), Ae. ventrovittis Dyar*, Psorophora discolor (Coquillett), Orthopodomyia signifera (Coquillett), and Uranotaenia anhydor Dyar (*Species not reported in Mexico); three species in Chihuahua: Ae. canadensis (Theobald), Ae. mitchellae (Dyar), and Ae. thelcter Dyar; and three species reported in Arizona and Chihuahua: Ae. dorsalis (Meigen), Ae. melanimon Dyar, and Ae. sollicitans (Walker) [70,87,88].

4.5. Mosquito Diversity in Sonora and Mexico

With the addition of the two new mosquito records for Mexico (Ae. deserticola and Tx. septentrionalis) and the confirmation of the presence of Ps. columbiae in the country, there are currently 251 species known in Mexico. With 56 species, Sonora ranks eighth place with the greatest diversity of species out of the 12 Mexican states that have been systematically inventoried for mosquito species.

4.6. DNA Barcoding

The DNA barcodes sequences of the four species of Toxorhynchites: Tx. haemorrhoidalis, Tx. moctezuma, Tx. septenrtionalis, and Tx. theobaldi of specimens grouped in well-defined and clades. The specimens B12 and MEXAO072-14 were identified as Tx. septentrionalis based on the diversification pattern observed in the phylogenetic analysis. Toxorhynchites septentrionalis and Tx. moctezuma showed diversification patterns with a strong support value, suggesting a sympatric speciation. Phylogenetic evidence and morphological traits found in the adult female general coloration in external vestitrue and scales coloration support the specimens correspond to different species. Mexican specimens identified as Tx. Theobaldi, collected in the southern part of the country, including the Yucatán Peninsula, belong to an undescribed species, which presumably corresponds to a new species, and might be indicative of cryptic diversity within the genus Toxorhynchites in Mexico.

Author Contributions

A.I.O.-M. and F.W.-C.—study conceptualization; A.I.O.-M. and F.W.-C.—methodology; A.I.O.-M.—sampling; A.I.O.-M., J.M.Q.-B. and M.A.R.-P.—data curation; A.I.O.-M.—mosquito identification; L.M.H.-T., J.M.Q.-B. and M.A.R.-P.—molecular analysis; A.I.O.-M.—writing and original draft preparation; L.M.H.-T. and M.A.R.-P.—review and editing; A.I.O.-M., L.M.H.-T., M.A.R.-P. and F.C.-M.—project administration and funding acquisition. All authors have read and agreed to the published version of the manuscript.

Funding

Funding was provided by the National Center of Preventive Programs and Disease Control (CENAPRECE), through the Entomological and Bioassay Research Units (UIEBS) (Mexico); support and logistics by the Universidad de Sonora.

Institutional Review Board Statement

Not applicable.

Data Availability Statement

All mosquitoes (mounted on insect pins and/or microscope slides) collected in Sonora State were deposited in the Culicidae Collection (CC-UL), Parasitology Department, Universidad Autónoma Agraria Antonio Narro unidad laguna (Autonomous Agrarian University Antonio Narro laguna unit), Torreón, Coahuila, Mexico. Some specimens of seven species (An. franciscanus, Ae. ramirezi, Hg. equinus, Ps. longipalpus, Ps. howardii, Cs. particeps, and Tx. moctezuma) were deposited in the Medical Entomology collection of Sonora state in Hermosillo municipality and the UIEB of Sonora in Navojoa municipality.

Acknowledgments

We thank Alejandro Samaniego-Pesqueira, Antonio A. Sánchez-García, Carla P. Alvarez-Echeverría, Diego A. Barrales-Alcalá, Elia S. Castro-Lomeli, Fabiola J. Gandarilla-Aizpuro, Germán Quiros-Chavez, Gladis Moreno-Bello, Guillermo Morillón-Borjón, Isis J. Morales-Avitia, Juan B. Contreras-Reza, Juan P. Castillo-Munguía, Orlando Tomas-Cruz, Quetzaly K. Siller-Rodríguez, Rodrigo Cedillo-Osornio, Salvador Morales-Avitia, and Ximena Santana-Garduño for their valuable collaboration during our collection trips; and to Herón Huerta for letting us review the CAIM-INDRE collection.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Becker, N.; Petrić, D.; Zgomba, M.; Boase, C.; Madon, M.; Dahl, C.; Kaiser, A. Mosquitoes and Their Control, 2nd ed.; Springer: Berlin/Heidelberg, Germany, 2010. [Google Scholar]
  2. Medlock, J.K.; Snow, K.R.; Leach, S.A. Possible ecology and epidemiology of medically important mosquito-borne arboviruses in Great Britain. Epidemiol. Infect. 2007, 135, 466–482. [Google Scholar] [CrossRef] [PubMed]
  3. Hernández-Triana, L.M.; Brugman, V.A.; Prosser, S.W.J.; Weland, C.; Nikilova, N.; Thorne, L.; de Marco, M.F.; Fooks, A.R.; Johnson, N. Molecular approaches for blood meal analysis and species identification of mosquitoes (Insecta: Diptera: Culicidae) in rural locations in southern England, United Kingdom. Zootaxa 2017, 4250, 67–76. [Google Scholar] [CrossRef] [PubMed]
  4. Dorvillé, L.F.M. Mosquitoes as bioindicators of forest degradation in southern Brazil, a statical evaluation of published data in the literature. Stud. Neotrop. Fauna Environ. 1996, 31, 68–78. [Google Scholar] [CrossRef]
  5. Guedes, M.L.P.; Navarro-Silva, M.A. Mosquito community composition in dynamic landscapes from the Atlantic forest biome (Diptera, Culicidae). Rev. Bras. Entomol. 2014, 58, 88–94. [Google Scholar] [CrossRef]
  6. Montagner, F.R.G.; Silva, O.S.; Jahnke, S.M. Mosquito species occurrence in association with landscape composition in green urban areas. Braz. J. Biol. 2018, 78, 233–239. [Google Scholar] [CrossRef]
  7. Muñoz-Cabrera, L.O.; Ibáñez-Bernal, S.; Corona-Vargas, M.C. Los mosquitos (Diptera: Culicidae) de Tlaxcala, México. I: Lista comentada de especies. Folia Entomol. Mex. 2006, 45, 223–271. [Google Scholar]
  8. Dampf, A. Distribución y ciclo annual de Uranotaenia syntheta Dyar & Shannon en México y descripción del hipopigio masculine (Insecta, Diptera). Rev. Soc. Mex. Hist. Nat. 1943, 4, 147–170. [Google Scholar]
  9. Dávalos-Becerril, E.; Correa-Morales, F.; González-Acosta, C.; Santos-Luna, R.; Peralta-Rodríguez, J.; Pérez-Rentería, C.; Ordóñez-Álvarez, R.; Huerta, H.; Carmona-Perez, M.; Díaz-Quiñonez, J.A.; et al. Urban and semi-urban mosquitoes of Mexico City: A risk for endemic mosquito borne-disease transmission. PLoS ONE 2019, 14, e0212987. [Google Scholar] [CrossRef]
  10. Ortega-Morales, A.I.; Hernández Triana, L.M.; Garza-Hernández, J.A.; Ramírez-Huicochea, C.M.; Martínez-Gaona, A.J.; Quijano-Barraza, J.M.; González-Acosta, C.; Correa-Morales, F. The mosquitoes of Morelos, Mexico: DNA Barcodes, Distribution, Ecology and the Resurrection of the name Culiseta dugesi Dyar and Knab (Diptera: Culicidae). Diversity 2024, 16, 261. [Google Scholar] [CrossRef]
  11. Ortega-Morales, A.I.; Hernández-Triana, L.M.; Siller-Rodríguez, Q.K. The mosquitoes of Querétaro, Mexico: Distribution, ecology, and the discovery of Shannoniana huasteca n. sp. (Diptera: Culicidae). Diversity 2023, 15, 697. [Google Scholar] [CrossRef]
  12. Adeniran, A.A.; Hernández-Triana, L.M.; Ortega-Morales, A.I.; Garza-Hernández, J.A.; de la Cruz-Ramos, J.; Chan-Chablé, R.J.; Vázquez-Marroquín, R.; Huerta-Jiménez, H.; Nikolova, N.I.; Fooks, A.R.; et al. Identification of mosquitoes (Diptera: Culicidae) from Mexico State, Mexico using morphology and COI DNA barcoding. Acta Trop. 2021, 213, 105730. [Google Scholar] [CrossRef] [PubMed]
  13. Ortega-Morales, A.I.; Zavortink, T.J.; Huerta-Jiménez, H.; Ibáñez-Bernal, S.; Siller-Rodríguez, Q.K. The mosquitoes (Diptera: Culicidae) of Hidalgo state, Mexico. Acta Trop. 2019, 189, 94–103. [Google Scholar] [CrossRef] [PubMed]
  14. Ortega-Morales, A.I.; Pérez-Paredes, M.G.; Siller-Rodríguez, Q.K.; Moreno-García, M.; González-Acosta, C.; Correa-Morales, F. First record of Aedes gabriel in Hidalgo state, Mexico. J. Am. Mosq Control Assoc. 2019, 35, 51–54. [Google Scholar] [CrossRef] [PubMed]
  15. Ortega-Morales, A.I.; Zavortink, T.J.; Garza-Hernández, J.A.; Siller-Rodríguez, Q.K.; Fernández-Salas, I. The mosquitoes (Diptera: Culicidae) of Nuevo León, Mexico, with descriptions of two new species. PLoS ONE 2019, 14, e0217694. [Google Scholar] [CrossRef] [PubMed]
  16. Villegas-Ramírez, H.M.; Ortega-Morales, A.I.; Flores-Suárez, A.; Fernández-Salas, I.; Ponce-García, G. First record of Aedes podographicus in Nuevo León state, Mexico. J. Am. Mosq Control Assoc. 2021, 37, 87–89. [Google Scholar] [CrossRef] [PubMed]
  17. Ortega-Morales, A.I.; Morillón-Borjón, G.; Morales-Avitia, I.J.; Sánchez-García, A.A.; Ayala-Sulca, Y.O.; Sánchez-Rámos, F.J. First record of Wyeomyia mitchellii in Nuevo León, Mexico. J. Am. Mosq Control Assoc. 2022, 38, 216–218. [Google Scholar] [CrossRef]
  18. Ortega-Morales, A.I.; León-Espinosa, G.A.; Rodríguez-Rojas, J.J. Updated checklist of the mosquitoes (Diptera: Culicidae) of Mexico. J. Vector Ecol. 2023, 49, 28–43. [Google Scholar] [CrossRef]
  19. Ortega-Morales, A.I.; Mis-Ávila, P.C.; Elizondo-Quiroga, A.; Harbach, R.E.; Siller-Rodríguez, Q.K.; Fernández-Salas, I. The mosquitoes of Quintana Roo state, Mexico (Diptera: Culicidae). Acta Zool. Mex. 2010, 26, 33–46. [Google Scholar]
  20. Chan-Chablé, R.J.; Ortega-Morales, A.I.; Martínez-Arce, A. First record of Psorophora albipes in Quintana Roo, Mexico. J. Am. Mosq. Control Assoc. 2016, 32, 237–239. [Google Scholar] [CrossRef]
  21. Ortega-Morales, A.I.; Casas-Martínez, M.; Bond, G.; Harbach, R.E. First records of Psorophora cilipes and Culex theobaldi in Quintana Roo, Mexico. J. Am. Mosq Control Assoc. 2018, 34, 124–127. [Google Scholar] [CrossRef]
  22. Chan-Chablé, R.J.; Martínez-Arce, A.; Mis-Ávila, P.C.; Ortega-Morales, A.I. DNA barcodes and evidence of cryptic diversity of anthropophagous mosquitoes in Quintana Roo, Mexico. Ecol. Evol. 2019, 9, 4692–4705. [Google Scholar] [CrossRef] [PubMed]
  23. Chan-Chablé, R.J.; Martínez-Arce, A.; Ortega-Morales, A.I.; Mis-Ávila, P.C. New records and updated checklist of mosquito species in Quintana Roo, Mexico, using DNA-Barcoding. J. Am. Mosq Control Assoc. 2020, 36, 264–268. [Google Scholar] [CrossRef] [PubMed]
  24. Talaga, S.; le Goff, G.; Arana-Guardia, R.; Baak-Baak, C.M.; García-Rejón, J.E.; García-Suárez, O.; Rodríguez-Valencia, V.M.; Tolsá-García, M.J.; Suzán, G.; Rioz, D. The mosquitoes (Diptera: Culicidae) of the Mexican Yucatan Peninsula: A comprehensive review on the use of taxonomic names. J. Med. Entomol. 2023, 61, 274–308. [Google Scholar] [CrossRef] [PubMed]
  25. Ortega-Morales, A.I.; Zavortink, T.J.; Huerta-Jiménez, H.; Sánchez-Rámos, F.J.; Valdés-Perezgasga, M.T.; Reyes-Villanueva, F.; Siller-Rodríguez, Q.; Fernández-Salas, I. Mosquito records from Mexico: The mosquitoes (Diptera: Culicidae) of Tamaulipas state. J. Med. Entomol. 2015, 52, 171–184. [Google Scholar] [CrossRef]
  26. Torres-Chable, O.M.; Baak-Baak, C.M.; Cigarroa-Toledo, N.; Zaragoza-Vera, C.V.; Arjona-Jiménez, G.; Moreno-Perez, L.G.; Machain-Williams, C.; García-Rejon, J. Mosquito fauna un home environments of Tabasco, Mexico. Southwest. Entomol. 2017, 42, 969–982. [Google Scholar] [CrossRef]
  27. Ortega-Morales, A.I.; Méndez-López, R.; Garza-Hernández, J.A.; González-Álvarez, V.H.; Ruiz-Arrondo, I.; Huerta-Jiménez, H.; Rodríguez-Martínez, L.M.; Rodríguez-Pérez, M.A. The mosquitoes (Diptera: Culicidae) of Tabasco, Mexico. J. Vector Ecol. 2019, 44, 57–67. [Google Scholar] [CrossRef]
  28. Rodríguez-Martínez, L.M.; Yzquierdo-Gómez, P.; González-Acosta, C.; Correa-Morales, F. First record of Aedes (Ochlerotatus) fulvus in Tabasco and distribution notes of other Aedes in Mexico. Southwest. Entomol. 2020, 45, 263–268. [Google Scholar] [CrossRef]
  29. Ortega-Morales, A.I.; Rodríguez-Martínez, L.M.; Méndez-Alvarado, W.; Garza-Hernández, J.A.; López-Hernández, I.; Medrano-Santillana, M.; González-Acosta, C.; Correa-Morales, F. The distribution of Uranotaenia sapphirina and Ur. socialis in Tabasco, southern Mexico. J. Am. Mosq. Control Assoc. 2022, 38, 141–147. [Google Scholar] [CrossRef]
  30. Ibáñez-Bernal, S.; Mendoza-Palmero, F.S.; Hernández-Xoliot, R.A. Mosquitos (Insecta: Diptera: Culicidae). In La Biodiversidad de Veracruz Estudio de Estado, Volume II; Cruz-Angón, A., Lorca-Hernández, F.G., Hernández-Ortiz, V., Morales-Mavil., J.E., Eds.; Comisión Nacional para el Conocimiento y Uso de la Biodiversidad CONABIO: Mexico City, Mexico, 2011; pp. 399–403. [Google Scholar]
  31. Mendez-Andrade, A.; Rivera-García, K.D.; Ibáñez-Bernal, S. Notes on the Toxorhynchites of Mexico: Redescription of Tx. moctezuma (Dyar & Knab) and new record for Tx. grandiosus (Williston) in Veracruz (Diptera: Culicidae). Zootaxa 2019, 4576, 140–150. [Google Scholar]
  32. Rivera-García, K.D.; Méndez-Andrade, A.; Ibáñez-Bernal, S. Trichoprosopon mixtli sp. nov., a new sabethini species (Diptera: Culicidae) from a Mexican cloud forest, with an assessment of the genus and keys for the identification pk known species. Zootaxa 2023, 5254, 94–116. [Google Scholar] [CrossRef]
  33. INEGI. Instituto Nacional de Estadística y Geografía. 2018. Available online: https://cuentame.inegi.org.mx/monografias/informacion/mor/territorio/relieve.aspx?tema=me&e=17 (accessed on 15 April 2024).
  34. Harbach, R.E.; Knight, K.L. Taxonomist’s Glossary of Mosquito Anatomy; Plexus Publishing, Inc.: Marlton, NJ, USA, 1980; ISBN 9780937548004. [Google Scholar]
  35. Wilkerson, R.C.; Linton, Y.M.; Fonseca, D.M.; Schultz, T.R.; Price, D.C.; Strickman, D.A. Making mosquito taxonomy useful: A stable classification of tribe Aedini that balances utility with current knowledge of evolutionary relationships. PLoS ONE 2015, 7, e0133602. [Google Scholar] [CrossRef] [PubMed]
  36. Folmer, O.; Black, M.; Hoeh, W.; Lutz, T.; Vrijenhoek, R. DNA Primers for amplification of mitochondrial Cytochrome c Oxidase Subunit I from diverse Metazoan Invertebrtes. Mol. Mar. Biol. Biotechnol. 1994, 3, 294–299. [Google Scholar] [PubMed]
  37. Prosser, S.W.; deWaard, J.R.; Miller, S.E.; Hebert, P.D. DNA barcodes from century-old type specimens using next-generation sequencing. Mol. Ecol. Resor. 2016, 15, 487–497. [Google Scholar] [CrossRef]
  38. Hebert, P.N.D.; Cywinska, A.; Ball, S.L.; deWaard, J.R. Biological identification through DNA barcodes. Proc. R. Soc. Biolog. Sci. 2003, 270, 213–321. [Google Scholar] [CrossRef]
  39. Hebert, P.N.D.; Ratnasingham, S.; deWaard, J.R. Barcoding animal life: Cytochrome c oxidase subunit 1 divergences among closely related species. Proc. R. Soc. Biol. Sci. 2003, 270, 596–599. [Google Scholar] [CrossRef] [PubMed]
  40. Hernández-Triana, L.M.; Crainey, J.L.; Hall, A.; Faith, F.; Mackenzie-Dodds, J.; Shelley, A.J.; Zhou, X.; Post, R.G.; Gregory, R.T.; Hebert, P.N.D. The utility of DNA barcoding for species identification within the blackfly subgenus Trichodagmia Enderlein (Diptera: Simuliidae: Simulium) and related taxa in the New World. Zootaxa 2012, 3154, 43–69. [Google Scholar]
  41. Hernández-Triana, L.M.; Prosser, S.W.; Rodríguez-Pérez, M.A.; Chaverri, L.G.; Hebert, P.N.D.; Gregory, T.R. Recovery of DNA barcodes from blackfly museum specimens (Diptera: Simuliidae) using primer sets that target a variety of sequence lengths. Mol. Ecol. Resour. 2014, 4, 508–518. [Google Scholar] [CrossRef]
  42. Tamura, K.; Peterson, D.; Peterson, N.; Stoecher, G.; Nei, M.; Kumar, S. MEGA 5. 2007. Available online: http://www.megasoftware.net (accessed on 15 April 2022).
  43. Bouckaert, R.; Vaughan, T.G.; Barido-Sottani, J.; Duchêne, S.; Fourment, M.; Gavryushkina, A.; Heled, J.; Jones, G.; Kuhnet, D.; De Maio, N.; et al. BEAST 2.5: An advanced softwere platform for Bayesian evolutionary analysis. PLoS Comput. Biol. 2019, 15, e1006650. [Google Scholar] [CrossRef]
  44. Rambaut, A.; Drummond, A.J.; Xie, D.; Baele, G.; Suchard, M.A. Posterior summarization in Bayesian phylogenetics using Tracer 1.7. Syst. Biol. 2018, 67, 901–904. [Google Scholar] [CrossRef]
  45. Ratnasingham, S.; Hebert, P.N.D. A DNA-Based registry for all animal species: The barcode index number (BIN) system. PLoS ONE 2013, 8, e66213. [Google Scholar] [CrossRef] [PubMed]
  46. Hoffmann, C.C. Anopheles pseudopunctipennis y su relación con el paludismo en la República Mexicana. Salud Publ. Mex. 1932, 31, 824–832. [Google Scholar]
  47. Martini, E.W. Los Mosquitos de México; Boletín Técnico, Departamento de Salubridad: Mexico City, Mexico, 1935. [Google Scholar]
  48. Vargas, L. Anopheles (Anopheles) barberi en México. Rev. Inst. Salubr. Enf. Trop. 1940, 1, 319–322. [Google Scholar]
  49. Vargas, L. El problema de las variedades de A. punctipennis. Rev. Soc. Mex. Hist. Nat. 1941, 2, 175–186. [Google Scholar]
  50. Martínez-Palacios, A. Nota sobre la distribución de los mosquitos Culex en México (Diptera: Culicidae). Rev. Soc. Mex. Hist. Nat. 1952, 13, 75–87. [Google Scholar]
  51. Vargas, L. Especies y distribución de mosquitos mexicanos no Anofelinos (Insecta, Diptera). Rev. Inst. Salubr. Enf. Trop. 1956, 1, 19–36. [Google Scholar]
  52. Díaz-Nájera, A.; Vargas, L. Mosquitos mexicanos: Distribución geográfica actualizada. Rev. Inv. Salud Pública 1973, 33, 111–125. [Google Scholar]
  53. Zavortink, T.J. Mosquito studies (Diptera, Culicidae) XXVIII. The New World species formerly placed in Aedes (Finlaya). Contrib. Am. Entomol. Inst. 1972, 8, 1–206. [Google Scholar]
  54. Heinemann, S.J.; Belkin, J.N. Collection records of the project “Mosquitoes of Middle America” 9. Mexico (MEX, MF, MT, MX). Mosq. Syst. 1977, 9, 483–535. [Google Scholar]
  55. Macias-Duarte, A.; Alvarado-Castro, J.A.; Dórme-Navarro, M.E.; Félix-Torres, A.A. Dispersal and oviposition of laboratory-reared gravid females of Toxorhynchites moctezuma in an arid urban area of Sonora, Mexico. J. Am. Mosq Control Assoc. 2009, 25, 417–424. [Google Scholar] [CrossRef]
  56. Carpenter, S.J.; LaCasse, W.J. Mosquitoes of North America (North of Mexico); University of California Press: Berkeley, CA, USA, 1956. [Google Scholar]
  57. Zavortink, T.J. Mosquito studies (Diptera, Culicidae) XVI. A new species of treehole breeding Aedes (Ochlerotatus) from southern California. Contrib. Am. Entomol. Inst. 1969, 5, 1–7. [Google Scholar]
  58. Arnell, J.H.; Nielsen, L.T. Mosquito studies (Diptera, Culicidae) XXVII. The varipalpus group of Aedes (Ochlerotatus). Contrib. Am. Entomol. Inst. 1972, 8, 1–48. [Google Scholar]
  59. Darsie, R.F.; Ward, R.A. Identification and Geographical Distribution of the Mosquitoes of North America, North of Mexico; University Press of Florida: Gainesville, FL, USA, 2005. [Google Scholar]
  60. Reeves, L.E.; Holderman, C.J.; Blosser, E.M.; Gillett-Kaufman, J.L.; Kawahara, A.Y.; Kaufman, P.E.; Burkett-Cadena, N. Identification of Uranotaenia sapphirina as a specialist of annelids broadens known mosquito host use patterns. Commun. Biol. 2018, 1, 92. [Google Scholar] [CrossRef] [PubMed]
  61. Wilkerson, R.C.; Linton, T.-M.; Strickman, D. Mosquitoes of the World. Vol. 1; Johns Hopkins University Press: Baltimore, MD, USA, 2021. [Google Scholar]
  62. Aitken, T.H.G. A new American subgenus and species of Aedes. Pan-Pacific Entomol. 1941, XVII, 81–84. [Google Scholar]
  63. Vargas, L. Nueva larva que corresponde probablemente a Aedes purpureipes Aitken, 1941. Rev. Inst. Salubr. Enf. Trop. 1949, 3, 261–265. [Google Scholar]
  64. Meyer, R.P.; Durso, S.L. Identification of the Mosquitoes of Californi; Calif. Mosq. and Vector Control Association: Sacramento, CA, USA, 1993. [Google Scholar]
  65. McDonald, J.L.; Sluss, T.P.; Land, J.D.; Roan, C.C. Mosquitoes of Arizona; University of Arizona: Tucson, AZ, USA, 1973. [Google Scholar]
  66. Jackob, W.L.; Maloney, F.A.; Harrison, F.J. Aedes purpureipes in Western Arizona. J. Am. Mosq Control Assoc. 1985, 3, 388. [Google Scholar]
  67. Belkin, J.N.; McDonald, W.A. Aedes sierrensis (Ludlow, 1905), a change in name for the western tree-hole mosquito of the Pacific slope. Proc. Entomol. Soc. Wash. 1956, 58, 344. [Google Scholar]
  68. Nielsen, L.T.; Arnell, J.H.; Linam, J.H. A report on the distribution and biology of tree hole mosquitoes in the western United States. Proc. Calif. Mosq. Cont. Assoc. 1967, 35, 72–76. [Google Scholar]
  69. Dyar, H.G.; Knab, F. The species of mosquitoes in the genus Megarhinus. Smithson. Misc. Collect. 1906, 48, 241–258. [Google Scholar]
  70. Jenkins, D.W.; Carpenter, S.J. Ecology of the tree hole breeding mosquitoes of Neartic North America. Ecol. Monogr. 1946, 16, 33–47. [Google Scholar] [CrossRef]
  71. Harbach, R.E.; Wilkerson, R.C. The insupportable validity of mosquito subspecies (Diptera: Culicidae) and their exclusion from culicid classification. Zootaxa 2023, 5303, 1–184. [Google Scholar] [CrossRef]
  72. Aitken, T.H.G. The Anopheles maculipennis complex of western America (Diptera, Culicidae). Pan-Pac. Entomol. 1939, 15, 191–192. [Google Scholar]
  73. King, W.V.; Bradley, G.H. General morphology of Anopheles and classification of the Nearctic species. Sci. Adv. 1941, 15, 63–70. [Google Scholar]
  74. Vargas, L.; Downs, W.G. Tres especies nuevas de Aedes (Diptera, Culicidae). Rev. Soc. Mex. Hist. Nat. 1950, 11, 160–177. [Google Scholar]
  75. Dyar, H.G.; Knab, F. Notes on some American mosquitoes with descriptions of new species. Proc. Entomol. Soc. Wash. 1906, 19, 159–172. [Google Scholar]
  76. Wilkerson, R.C.; Linton, T.-M.; Strickman, D. Mosquitoes of the World. Vol. 2; Johns Hopkins University Press: Baltimore, MD, USA, 2021. [Google Scholar]
  77. Komp, W.H.W.; Kumm, H.W. A new species of Haemagogus mesodentatus, from Costa Rica, and a description of the larva of Haemagogus anastasionis Dyar (Diptera, Culicidae). Proc. Entomol. Soc. Wash. 1938, 40, 253–259. [Google Scholar]
  78. Ibáñez-Bernal, S.; Martínez-Campos, C. Clave para la identificación de larvas de mosquitos comunes en las áreas urbanas y suburbanas de la República Mexicana (Diptera: Culicidae). Folia Entomol. Mex. 1994, 92, 43–73. [Google Scholar]
  79. Dyar, H.G.; Knab, F. The larvae of Culicidae classified as independent organisms. J.N.Y. Entomol. Soc. 1906, 14, 169–230. [Google Scholar]
  80. Dyar, H.G. Notes on tropical American mosquitoes (Diptera, Culicidae). Insect. Insc. Mens. 1922, 10, 188–196. [Google Scholar]
  81. Laurito, M.; Hoyos-López, R. First record of Culex (Culex) bidens (Diptera: Culicidae) in Colombia: Taxonomic and epidemiological implications. Acta Trop. 2018, 188, 251–257. [Google Scholar] [CrossRef]
  82. Rivera-García, K.D.; Ibáñez-Bernal, S. Description of the pupa of Culex (Culex) bidens Dyar (Diptera: Culicidae). Zootaxa 2018, 4521, 275–280. [Google Scholar] [CrossRef]
  83. Theobald, F.V. A Monograph of the Culicidae or Mosquitoes (Vol. 2); British Museum (Natural History): London, UK, 1901. [Google Scholar]
  84. Zavortink, T.J. Mosquito studies (Diptera, Culicidae) XV. A new species of treehole breeding Anopheles from the southwestern United States. Contrib. Am. Entomol. Inst. 1969, 4, 27–38. [Google Scholar]
  85. Zavortink, T.J. Mosquito studies (Diptera, Culicidae) XIX. The treehole Anopheles of the New World. Contrib. Am. Entomol. Inst. 1970, 5, 1–35. [Google Scholar]
  86. Espinoza-Gómez, F.; Arredondo-Jiménez, J.I.; Maldonoado-Rodríguez, A.; Pérez-Rentería, C.; Newton-Sánchez, O.A.; Chávez-Flores, E.; Gómez-Ibarra, E. Distribución geográfica de los mosquitos adultos (Diptera: Culicidae) en áreas selváticas de Colima, México. Rev. Mex. Biodiv. 2013, 84, 685–689. [Google Scholar] [CrossRef]
  87. Ortega-Morales, A.I.; Reyna-Nava, M. Mosquito species of neighboring states of Mexic. In Mosquitoes, Communities, and Public Health in Texas; Mustapha, D., Reyna-Nava, M., Rueda, L.M., Eds.; Academic Press: Cambridge, MA, USA; Elsevier: Amsterdam, The Netherlands, 2020. [Google Scholar]
  88. Mejía-Zúñiga, M.D.; Reyes-Moya, A.G.; Tapia-Bueno, J.A.; Moncada-Hernandez, L.J.; Ortega-Morales, A.I.; Moreno-Garcia, M.; González-Acosta, C.; Correa-Morales, F. First national record of Aedes melanimon (Diptera: Culicidae) in Mexico. J. Vector Borne Dis. 2022, 59, 102–104. [Google Scholar] [CrossRef] [PubMed]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Article Metrics

Citations

Article Access Statistics

Multiple requests from the same IP address are counted as one view.