Ribosomes: The New Role of Ribosomal Proteins as Natural Antimicrobials
Abstract
1. Introduction
2. Ribosome
2.1. Composition
2.2. Nomenclature
| Ribosomes Proteins of the Small Subunit | ||||||||
| Family Name | Alt. Name 1 | Taxonomic Range | Univ. Cons. 2 | Deleted Mutant | Ribosomal Function/Comment | |||
| A | B | E | O | |||||
| bS1 | ○ | ● | ○ | C | X | Brings with mRNA into the proximity of the ribosome during initiation; involvement in translational regulation [16,17,18] | ||
| uS2 | S0Ae | ● | ● | ● | C, M | 1 | Involvement in translational regulation [17] | |
| uS3 | S3e | ● | ● | ● | C, M | 1 | Forms the mRNA entry pore and may exhibit helicase activity to unwind mRNA secondary structures encountered during translation [18] | |
| uS4 | S9e | ● | ● | ● | C | Mutations (ram) increase the error during the decoding process; with uS7 as one of the two assembly initiator proteins; involvement in translational regulation [16,17,18] | ||
| uS5 | S2e | ● | ● | ● | C, M, T | 1 | Probably facilitates changes in rRNA conformation that alter the selection mode of the ribosome from accurate to error-prone and vice versa [16,17,18] | |
| bS6 | ○ | ● | ○ | C, M, T | X | Form a tight complex that assembles as a heterodimer on the outer edge of the platform of the subunits [16] | ||
| uS7 | S5e | ● | ● | ● | C, M | 1 | mRNA and tRNA binding at the E site; involvement in translational regulation [16,17,19] | |
| uS8 | S22e | ● | ● | ● | C, T | 1 | Involvement in translational regulation [17] | |
| uS9 | S16e | ● | ● | ● | C, M, T | 1 | X | Interaction with P site [19] |
| uS10 | S20e | ● | ● | ● | C, M | 1 | uS3, uS10, and uS14 form a tight protein cluster at the back of the 30S head [16] | |
| uS11 | S14e | ● | ● | ● | C, M, T | 1 | X | Forms part of the binding site of the anticodon loop of E-tRNA [19] |
| uS12 | S23e | ● | ● | ● | C, M | 1 | Involved in decoding of the coding of the second and third codon positions at the A site [16,17,18,19] | |
| uS13 | S18e | ● | ● | ● | C | X | Interaction with P site tRNA [19] | |
| uS14 | S29e | ● | ● | ● | C, M | 1 | uS3, uS10, and uS14 form a tight protein cluster at the back of the 30S head [16] | |
| uS15 | S13e | ● | ● | ● | C, M, T | 1 | Involvement in translational regulation [17] | |
| bS16 | ○ | ● | ○ | C, M, T | Improve the stability of ribosome [16] | |||
| uS17 | S11e | ● | ● | ● | C, M, T | 1 | X | Ribosome assembly [20] |
| bS18 | ○ | ● | ○ | C, M, T | Form a tight complex that assembles as heterodimer on the outer edge of the platform [16] | |||
| uS19 | S15e | ● | ● | ● | C | Inter-subunit bridges; related to the changes in the information between LSU and SSU [20] | ||
| bS20 | ○ | ● | ○ | C | X | Involvement in translational regulation [17] | ||
| bS21 | ○ | ● | ○ | M | Required for the recognition of native templates; stabilize the ribosome [21] | |||
| bS22 | ○ | ● | ○ | ○ | Accumulates in ribosomes of the stationary phase, so is a factor rather than an RP [17] | |||
| bTHX | ○ | ● | ○ | ○ | Found in thermophilic bacteria and stabilizes the organization of RNA elements at the 30S subunit [21] | |||
| eS1 | ● | ○ | ● | ○ | Initiation of translation by catching the mRNA and directing it to the ribosome; involvement in translational regulation [17,18] | |||
| eS4 | ● | ○ | ● | ○ | Assembly initiator protein; involvement in translational regulation [16,17] | |||
| eS6 | ● | ○ | ● | ○ | Form a tight complex that assembles as heterodimer on the outer edge of the platform [16] | |||
| eS7 | ○ | ○ | ● | ○ | mRNA and tRNA binding at the E site; involvement in translational regulation [16,19] | |||
| eS8 | ● | ○ | ● | ○ | Involvement in translational regulation [17] | |||
| eS10 | ○ | ○ | ● | ○ | Associated ribosome quality control; stall translation on poly(A) sequences [22] | |||
| eS12 | ○ | ○ | ● | ○ | tRNA decoding at the A site [19] | |||
| eS17 | ● | ○ | ● | ○ | Ribosome assembly [20] | |||
| eS19 | ● | ○ | ● | ○ | Inter-subunit bridges [20] | |||
| eS21 | ○ | ○ | ● | ○ | Required for the recognition of native templates and its function resembles the function of bS1 [21] | |||
| eS24 | ● | ○ | ● | ○ | Required for processing of pre-RNA and maturation of SSU [23] | |||
| eS25 | ● | ○ | ● | ○ | Translation of mRNAs from specific cellular pathways [24] | |||
| eS26 | ○ | ○ | ● | ○ | Involved in the formation of the mRNA binding channel in the region of the exit site [25] | |||
| eS27 | ● | ○ | ● | ○ | Fused to C-terminus of ubiquitin; zinc finger [4] | |||
| eS28 | ● | ○ | ● | ○ | mRNA interactions [4] | |||
| eS30 | ● | ○ | ● | ○ | Replaces part of bS4 [4] | |||
| eS31 | ● | ○ | ● | ○ | Ribosome assembly [26] | |||
| RACK1 | ○ | ○ | ● | ○ | Interacts with signaling molecules; through this interaction, the regulation of translation is mediated [18,19] | |||
| Ribosomal Proteins of the Large Subunit | ||||||||
| Family Name | Alt. Name 1 | Taxonomic Range | Univ. Cons. 2 | Deleted Mutant | Ribosomal Function/Comment | |||
| A | B | E | O | |||||
| uL1 | L10a | ● | ● | ● | C, M | 1 | X | Possibly involved in the disposal of deacylated tRNA that has been release from the E site; translational feedback regulation of L11 operon; involvement in translational regulation [16,17,18] |
| uL2 | L2e | ● | ● | ● | C, M, T | 1 | Residue histidine 229 is possibly involved in the peptidyltransferase reaction [17,19] | |
| uL3 | L3e | ● | ● | ● | C, M, T | 1 | Assembly initiation: forms an assembly starting point at the 3’region of 23S rRNA of the LSU; plays a role in the allosteric coordination of the peptidyl transferase center (PTC) [16,17,19] | |
| uL4 | L4e | ● | ● | ● | C, M, T | 1 | Role in rRNA transcription antitermination; involvement in translational regulation [16,17,18] | |
| uL5 | L11e | ● | ● | ● | C | With uS13, forms different contacts in the rotational states of ribosome; interaction with P site tRNA [19] | ||
| uL6 | L9e | ● | ● | ● | C | Forms the factor-binding site at the edge of the inter-subunit cleft of the ribosome [19] | ||
| bL9 | ○ | ● | ○ | C, M, T | Mutations might affect the precise arrangement of a tRNA in the P site [17,18] | |||
| uL10 | P0 | ● | ● | ● | M | Involvement in translational regulation [17,19] | ||
| uL11 | L12e | ● | ● | ● | C, M, T | 1 | X | During the stringent response, L11 senses the presence of a deacylated tRNA in the A site [16,17,18] |
| bL12 | ○ | ● | ○ | C, M | Involved in elongation-factor binding, possibly in GTPase activation and in translational regulation [16,17,18] | |||
| uL13 | L16e | ● | ● | ● | C, M, T | 1 | Can repress rRNA transcription termination [27] | |
| uL14 | L23e | ● | ● | ● | C, M, T | 1 | Forms the factor-binding site at the edge of the inter-subunit cleft of the ribosome [19] | |
| uL15 | L28e | ● | ● | ● | M, T | X | Essential late assembly step that is important for an active ribosomal conformation; improve the stability of ribosomes [16,17] | |
| uL16 | L10e | ● | ● | ● | C, M, T | 1 | Essential late assembly step. May be involved in correct positioning of the acceptor stem of A and P site tRNA as well as ribosome recycling factor (RRF) on the ribosome; acts in information transmission of the eukaryotic ribosome [16,17,18,26] | |
| bL17 | ○ | ● | ○ | M, T | Forms a ring around the tunnel exit site [18] | |||
| uL18 | L5e | ● | ● | ● | C, M | 1 | With L5 and L25, forms a complex with 5S rRNA which constitutes the central protuberance of the SSU [17] | |
| bL19 | ○ | ● | ○ | C, M | X | Inter-subunit bridge in the ribosome [20] | ||
| bL20 | ○ | ● | ○ | C, M, T | Involvement in translational regulation; improve the stability of ribosomes [17] | |||
| bL21 | ○ | ● | ○ | C, M, T | Direct contact with the 23S rRNA [26,28] | |||
| uL22 | L17e | ● | ● | ● | C, M, T | 1 | May interact with specific nascent chains to regulate translation [16,17,18] | |
| uL23 | L25e | ● | ● | ● | C, M, T | 1 | Present at the tunnel exit site and has been shown to be a component of the chaperone trigger factor binding site on the ribosome [16,18] | |
| uL24 | L26e | ● | ● | ● | C, M, T | 1 | X | Important for assembly initiation; improve the stability of ribosomes [16,17] |
| bL25 | ○ | ● | ○ | ○ | With L5 and L18 forms a complex with 5S rRNA, that constitutes the central protuberance of the SSU [17] | |||
| bL27 | ○ | ● | ○ | C, M, T | X | Implicated in the placement of the acceptor stem of P site binding of the ribosome recycling factor on the 50S subunit [16,18] | ||
| bL28 | ○ | ● | ○ | C, M, T | X | Assembly protein [20] | ||
| uL29 | L35e | ● | ● | ● | C, M, T | 1 | X | Located close to the tunnel exit site and may constitute part of the binding site for the signal recognition particle [16,18,26] |
| uL30 | L7e | ● | ● | ● | M, T | X | Assembly of the bacterial SSU or the eukaryotic LSU [26] | |
| bL31 | ○ | ● | ○ | C | Contributes to ribosome subunit association [20,28,29] | |||
| bL32 | ○ | ● | ○ | C, M | Forms part of the tunnel near to the peptidyl transferase center [18] | |||
| bL33 | ○ | ● | ○ | C, M, T | X | Assembly protein [20] | ||
| bL34 | ○ | ● | ○ | ○ | Ribosome-constituting protein [30] | |||
| bL35 | ○ | ● | ○ | C, M | Assembly protein [20] | |||
| bL36 | ○ | ● | ○ | C, M | Assembly protein [20] | |||
| P1/P2 | ● | ○ | ● | ○ | Mediate elongation factor GTPase activity [16] | |||
| eL6 | ○ | ○ | ● | ○ | Part of the peptidyl transferase center [20] | |||
| eL8 | L7a | ● | ○ | ● | ○ | Assembly of the bacterial SSU or the eukaryotic LSU [26] | ||
| eL13 | ● | ○ | ● | ○ | Can repress rRNA transcription termination; forms bridges between LSU and SSU [15] | |||
| eL14 | ● | ○ | ● | ○ | Role in GAC; forms part from the elongation factors to the mRNA exit tunnel [20] | |||
| eL15 | ● | ○ | ● | ○ | Improves the stability of ribosomes [16,17] | |||
| eL18 | ● | ○ | ● | ○ | Forms tetrameric complex with 5S rRNA [17] | |||
| eL19 | ● | ○ | ● | ○ | Peptide exit tunnel; participates in inter-subunit bridges [20,26], | |||
| eL20 | ○ | ○ | ● | ○ | Improves the stability of ribosomes [16] | |||
| eL21 | ● | ○ | ● | ○ | Bridges functional sites: peptidyl transferase center, the tunnel, and a tRNA binding site [26] | |||
| eL22 | ○ | ○ | ● | ○ | Ribosome assembly and protein translation [16,19] | |||
| eL24 | L10a | ● | ○ | ● | ○ | Improves the stability of ribosomes [17] | ||
| eL27 | ○ | ○ | ● | ○ | Binding of tRNA to the ribosome [16] | |||
| eL28 | ○ | ○ | ● | ○ | Assembly protein [20] | |||
| eL29 | ○ | ○ | ● | ○ | Assembly of the SSU [26] | |||
| eL30 | ● | ○ | ● | ○ | Assembly of the SSU [26] | |||
| eL31 | ● | ○ | ● | ○ | Contributes to ribosome subunit association [29] | |||
| eL32 | ● | ○ | ● | ○ | Forms part of the tunnel exit site [18] | |||
| eL33 | ● | ○ | ● | ○ | Assembly protein; interacts directly with E site tRNA [20,28] | |||
| eL34 | ● | ○ | ● | ○ | Ribosome-constituting protein [30] | |||
| eL36 | ○ | ○ | ● | ○ | Assembly protein [20] | |||
| eL37 | ● | ○ | ● | ○ | Structural constituent of ribosome; binds to the 23S rRNA [28] | |||
| eL38 | ● | ○ | ● | ○ | Subunit of the cytosolic LSU; involved in translation [31] | |||
| eL39 | ● | ○ | ● | ○ | Lines the tunnel and gives it its own “Teflon-like” properties [19] | |||
| eL40 | ● | ○ | ● | ○ | Enables protein binding and ubiquitin protein ligase binding [32] | |||
| eL41 | ● | ○ | ● | ○ | Interacts with beta subunit of protein kinase CKII and stimulates phosphorylation of DNA topoisomerase [33] | |||
| eL42 | L44a | ● | ○ | ● | ○ | Enables RNA binding and structural constituent of ribosome [34] | ||
| eL43 | L37Ae | ● | ○ | ● | ○ | Enables RNA binding and structural constituent of ribosome [35] | ||
2.3. Structure
2.4. Role of Ribosomes in the Cell Translation Process
3. Moonlighting Proteins
Ribosomal Proteins as Moonlighting Proteins
| Ribosomal Protein as AMP | Peptide Sequence | Isolated From | Against Microorganism | Physiochemical Properties | ||
|---|---|---|---|---|---|---|
| Hydrophobic | Iso-Electric Point (pH) | Net Charge at pH 7 | ||||
| RP eS30 6.6 kDa [54] | KVHGSLARAGK | Oncorhynchus mykiss | P. citreus and Bacillus subtilis | 36.36% | 11.57 | 3.1 |
| RP bS21 6.7 kDa [57] | GKTVVRSNESLDDALRRFKRSVSKAGTIQEYRKR | L. sakei | Enterococcus faecalis, L. sakei, L. innocua, L. monocytogenes, Listeria seeligeri, and Staphylococcus epidermidis | 29.41% | 11.31 | 6 |
| RP uL1 24.6 kDa [65] | ---- | Lactobacillus Hma2N | Melissococcus plutonius | ---- | ---- | ---- |
| RP eL29 6.4 kDa [66] | AKSKNHTSHNQNRKQHRNGIHRPKTYRYPSMKGVDPKFLKNLKFSKKHNKNTKK | Crassostrea gigas | B. subtilis, E. coli and Vibrio parahaemolyticus | 18.52% | 11.71 | 16.5 |
| RP bL27 9.9 kDa [58] | ---- | L. salivarius | S. pyogenes, S. uberis, and E. faecium | ---- | ---- | ---- |
| RP bL36 4.4 kDa [60] | MKVRPSVKPMCEHCKIIKRKGRVMVICSANPKHKQRQGK | P. acidilactici OSU-PECh-3A | E. coli | 35.9% | 11.3 | 11 |
| RP eL27 4.1 kDa [67] | PALKRKARREAKVKFEXRYXTGXNXXFFQ | Silurus asotus | B. subtilis, S. aureus, Micrococcus luteus, and Streptococcus iniae | 37.5% | 11.3 | 11 |
| RP uL1 15 kDa [61] | ---- | B. tequilensis | S. aureus | ---- | ---- | ---- |
| Peptide | Peptide Sequence 1 | Reference Organism | Against Microorganism | Physiochemical Properties | ||
|---|---|---|---|---|---|---|
| Hydrophobic | Iso-Electric Point (pH) | Net Charge at pH 7 | ||||
| RP uL1 (2–20) [53] | ---- | H. pylori | E. coli | ---- | ---- | ---- |
| RP uL1 HP-A3 (A3-NT) [72] | FKRLEKLFSKIWNWK-NH2 | H. pylori | C. albicans, Trichosporn beigelii, and Saccharomyces cerevisiae | 46.67% | 11.3 | 11 |
| RP uL1 (F1A) [73] | AKRLKKLFKKIWNWK-NH2 | H. pylori | E. coli, Pseudomonas aeruginosa, Proteus vulgaris, Salmonella typhimurium, S. aureus, L. monocytogenes, S. epidermidis, C. albicans, T. beigelii, Aspergillus awamori, Aspergillus flavus, Aspergillus fumigatus, and Aspergillus parasiticus | 46.67% | 11.86 | 7 |
| RP uL1 (F8A) [73] | FKRLKKLAKKIWNWK-NH2 | 46.67% | 11.86 | 7 | ||
| RP uL1 (F1AF8A) [73] | AKRLKKLAKKIWNWK-NH2 | 46.67% | 11.86 | 7 | ||
| RP uL1 (A2) [73] | AKRLKKLAKKIWKWK-NH2 | 46.67% | 11.91 | 8 | ||
| RP eL39 (PaDBS1R1) 2.1 kDa [74] | PKILNKILGKILRLAAAFK | Pyrobaculum aerophilum | Klebsiella pneumoniae and S. aureus | 57.89% | 11.79 | 5 |
| RP S23 (BjRPS23 67–84) 15.8 kDa [75] | MGKPRGLRSARKLKDHRRQQRWHDKSFKKAHLGTAVKASPFGGASHAKGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNYIEENDEVLVSGFGRKGRAVGDIPGVRFKVVKVANVSLLALFKEKKERPRS | B. japonicum | E. coli, A. hydrophila, S. aureus, and M. luteus | 37.76% | 11.22 | 21.3 |
| RP S23 (BjRPS23 17–38) 2.6 kDa [75] | RRQQRWHDKSFKKAHLGTAVKA | S. aureus | 31.82% | 11.93 | 6.2 | |
| RP S23 (BjRPS23 67–84) 2.1 kDa [75] | RKCVRVQLIKNGKKITAF | E. coli, A. hydrophila, S. aureus, and M. luteus | 44.44% | 11.57 | 5.9 | |
| RP uS15 16.9 kDa [1] | MADEQAALKKKRTFRKYTYRGVDLDQLLDMSSEQLMEMMKARPRRRFSRGLKRKHLALIKKLRKAKKECPALEKPEVVKTHLRNTVIVPEMIGSIVAVYNGKTFNQVEVKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK | B. japonicum | A. hydrophila, E. coli, S. aureus, and B. subtilis | 39.46% | 10.82 | 18.4 |
| RP uS15 (45–67) [1] | RRFSRGLKRKHLALIKKLRKAKK | 34.78% | 12.73 | 12.1 | ||
| RP eL30 12.7 kDa [2] | ---- | B. japonicum | A. hydrophila and S. aureus | ---- | ---- | ---- |
| RP eL30 (2–27) [2] | KQKRKTMESINSRLQLVMKSGKYVLG | 34.62% | 11.2 | 6 | ||
| RP eL30 (23–46) [2] | KYVLGLKETLKVLRQGKAKLIIIA | 54.17% | 10.88 | 5 | ||
| RP bS1 (V10I) 1.1 kDa [76] | VTDFGVFVEI | Thermus thermophilus | T. thermophilus | 60% | 0.66 | −2 |
| RP bS1 (R23I) 2.6 kDa [76] | RKKRRQRRRGGSar#(A)GVTDFGVFVEI | 30.77% | 12.24 | 7 | ||
| RP bS1 (R23T) 2.5 kDa [76] | RKKRRQRRRGGSar#(A)GVVEGTVVEVT | 26.92% | 12.24 | 7 | ||
| RP bS1 [77] | ---- | T. thermophilus | P. aeruginosa | ---- | ---- | ---- |
| RP bS1 (R23R) 2.8 kDa [78] | RKKRRQRRRGGGGLHITDMAWKR | P. aeruginosa | P. aeruginosa | 21.74% | 12.51 | 9.1 |
| RP bS1 (R23L) 2.6 kDa [78] | RKKRRQRRRGGGGITDFGIFIGL | 26.09% | 12.41 | 7 | ||
| RP bS1 (R23F) [79] | RKKRRQRRRGGSarGVVVHI-Asi-GGKF-NH2 | S. aureus | S. aureus, P. aeruginosa, E. coli, and Bacillus cereus | 29.63% | 12.89 | 10.1 |
| RP bS1 (R2DI) [79] | RKKRRQRRRGGSarGLTQFGAFIDI-NH2 | 28% | 12.51 | 8 | ||
| RP bS1 (R23EI) [79] | RKKRRQRRRGGSarGVQGLVHISEI-NH2 | 24% | 12.51 | 8.1 | ||
4. Applications of AMPs
5. Possible RP Mechanism of Action as AMPs
6. Future Developments and Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Qu, B.; Ma, Z.; Yao, L.; Gao, Z.; Zhang, S. Preserved antibacterial activity of ribosomal protein S15 during evolution. Mol. Immunol. 2020, 127, 57–66. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Chen, Y.; Yao, L.; Wang, Y.; Ji, X.; Gao, Z.; Zhang, S.; Ji, G. Identification of ribosomal protein L30 as an uncharacterized antimicrobial protein. Dev. Comp. Immunol. 2021, 120, 104067. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Boparai, J.K.; Sharma, P.K. Mini review on antimicrobial peptides, sources, mechanism and recent applications. Protein Pept. Lett. 2020, 27, 4–16. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liljas, A. Ribosomes. In Brenner’s Encyclopedia of Genetics, 2nd ed.; Maloy, S., Hughes, K., Eds.; Academic Press: San Diego, CA, USA, 2013; pp. 248–253. [Google Scholar] [CrossRef] [Scilit]
- Yusupova, G.; Yusupov, M. Ribosome biochemistry in crystal structure determination. RNA 2015, 21, 771–773. [Google Scholar] [CrossRef] [Scilit]
- Greiner, J.V.; Glonek, T. Intracellular ATP Concentration and Implication for Cellular Evolution. Biology 2021, 10, 1166. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Melnikov, S.; Ben-Shem, A.; De Loubresse, N.G.; Jenner, L.; Yusupova, G.; Yusupov, M. One core, two shells: Bacterial and eukaryotic ribosomes. Nat. Struct. Mol. Biol. 2012, 19, 560–567. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bieri, P.; Greber, B.J.; Ban, N. High-resolution structures of mitochondrial ribosomes and their functional implications. Curr. Opin. Struct. Biol. 2018, 49, 44–53. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liljas, A. Ribosomes. In Encyclopedia of Genetics; Brenner, S., Miller, J.H., Eds.; Academic Press: New York, NY, USA, 2001; pp. 1723–1730. [Google Scholar] [CrossRef] [Scilit]
- Londei, P.; Ferreira-Cerca, S. Ribosome biogenesis in archaea. Front Microbiol. 2021, 12, 1476. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Melnikov, S.; Manakongtreecheep, K.; Söll, D. Revising the structural diversity of ribosomal proteins across the three domains of life. Mol. Biol. Evol. 2018, 35, 1588–1598. [Google Scholar] [CrossRef] [Scilit]
- Rédei, G.P. Ribosomal proteins. In Encyclopedia of Genetics, Genomics, Proteomics and Informatics; Spinger: Dordrecht, The Netherlands, 2008; Volume 2, p. 1708. [Google Scholar] [CrossRef] [Scilit]
- Ban, N.; Beckmann, R.; Cate, J.H.; Dinman, J.D.; Dragon, F.; Ellis, S.R.; Lafontaine, D.L.J.; Lindahl, L.; Liljas, A.; Lipton, J.M.; et al. A new system for naming ribosomal proteins. Curr. Opin. Struct. Biol. 2014, 24, 165–169. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mitroshin, I.V.; Garber, M.B.; Gabdulkhakov, A.G. Investigation of structure of the ribosomal L12/P stalk. Biochemistry 2016, 81, 1589–1601. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- McIntosh, K.B.; Bonham-Smith, P.C. Ribosomal protein gene regulation: What about plants? Can. J. Bot. 2006, 84, 342–362. [Google Scholar] [CrossRef] [Scilit]
- Nikolay, R.; van den Bruck, D.; Achenbach, J.; Nierhaus, K.H. Ribosomal proteins: Role in ribosomal functions. In eLS; John Wiley Sons, Ltd.: Chichester, UK, 2015. [Google Scholar] [CrossRef] [Scilit]
- Stelzl, U.; Connell, S.; Nierhaus, K.H.; Wittmann-Liebold, B. Ribosomal. Proteins: Role in Ribosomal Functions. In Encyclopedia of Life Sciences; Nature Publishing Company, John Wiley and Sons, Eds.; Nature Pub.: New York, NY, USA, 2001; pp. 1–12. [Google Scholar] [CrossRef] [Scilit]
- Wilson, D.N.; Nierhaus, K.H. Ribosomal proteins in the spotlight. Crit. Rev. Biochem. Mol. Biol. 2005, 40, 243–267. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Brodersen, D.E.; Nissen, P. The social life of ribosomal proteins. FEBS J. 2005, 272, 2098–2108. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Calvet, L.E.; Matviienko, S.; Ducluzaux, P. Network theory of the bacterial ribosome. PLoS ONE 2020, 15, e0239700. [Google Scholar] [CrossRef] [Scilit]
- Nikolaeva, D.D.; Gelfand, M.S.; Garushyants, S.K. Simplification of ribosomes in bacteria with tiny genomes. bioRxiv 2019, 755876. [Google Scholar] [CrossRef] [Scilit]
- Juszkiewicz, S.; Hegde, R.S. Initiation of Quality Control during Poly(A) Translation Requires Site-Specific Ribosome Ubiquitination. Mol. Cell 2017, 743–750.e4. [Google Scholar] [CrossRef] [Scilit]
- Choesmel, V.; Fribourg, S.; Aguissa-Toure, A.H.; Pinaud, N.; Legrand, P.; Gazda, H.T.; Gleizes, P.E. Mutation of ribosomal protein RPS24 in Diamond-Blackfan anemia results in a ribosome biogenesis disorder. Hum. Mol. Genet. 2008, 17, 1253–1263. [Google Scholar] [CrossRef] [Scilit]
- Genuth, N.R.; Barna, M. Heterogeneity and specialized functions of translation machinery: From genes to organisms. Nat. Rev. Genet. 2018, 19, 431–452. [Google Scholar] [CrossRef] [Scilit]
- Bulygin, K.N.; Malygin, A.A.; Graifer, D.M.; Karpova, G.G. The functional role of the eukaryote-specific motif YxxPKxYxK of the human ribosomal protein eS26 in translation. Biochim Biophys Acta Gene Regul Mech. 2022, 1865, 194842. [Google Scholar] [CrossRef] [Scilit]
- Timsit, Y.; Sergeant-Perthuis, G.; Bennequin, D. Evolution of Ribosomal Protein Network Architectures. Sci. Rep. 2021, 11, 625. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bhavsar, R.B.; Makley, L.N.; Tsonis, P.A. The other lives of ribosomal proteins. Hum. Genom. 2010, 4, 327–344. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Klein, D.J.; Moore, P.B.; Steitz, T.A. The roles of ribosomal proteins in the structure assembly, and evolution of the large ribosomal subunit. J. Mol. Biol. 2004, 340, 141–177. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ueta, M.; Wada, C.; Bessho, Y.; Maeda, M.; Wada, A. Ribosomal protein L31 in Escherichia coli contributes to ribosome subunit association and translation, whereas short L31 cleaved by protease 7 reduces both activities. Genes Cells 2017, 22, 452–471. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yang, S.X.; Cui, J.; Yang, Y.S.; Liu, Z.P.; Yan, H.Y.; Tang, C.H.; Wang, H.; Qin, H.F.; Li, X.; Li, J.; et al. Over-expressed RPL34 promotes malignant proliferation of non-small cell lung cancer cells. Gene 2016, 576, 421–428. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lecompte, O.; Ripp, R.; Thierry, J.C.; Moras, D.; Poch, O. Comparative analysis of ribosomal proteins in complete genomes: An example of reductive evolution at the domain scale. Nucleic Acids Res. 2002, 30, 5382–5390. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Westhoff, B.; Chapple, J.P.; van der Spuy, J.; Höhfeld, J.; Cheetham, M.E. Hsj1 is a neuronal shuttling factor for the sorting of chaperone clients to the proteasome. Curr. Biol. 2005, 15, 1058–1064. [Google Scholar] [CrossRef] [Scilit]
- Lee, J.H.; Kim, J.M.; Kim, M.S.; Lee, Y.T.; Marshak, D.R.; Bae, Y.S. The highly basic ribosomal protein L41 interacts with the beta subunit of protein kinase CKII and stimulates phosphorylation of DNA topoisomerase IIalpha by CKII. Biochem. Biophys. Res. Commun. 1997, 238, 462–467. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hao, C.; Duan, H.; Li, H.; Wang, H.; Liu, Y.; Fan, Y.; Zhang, C. Knockdown of MRPL42 suppresses glioma cell proliferation by inducing cell cycle arrest and apoptosis. Biosci. Rep. 2018, 38, BSR20171456. [Google Scholar] [CrossRef] [Scilit]
- Han, J.; Lee, C. Antagonistic regulatory effects of a single cis-acting expression quantitative trait locus between transcription and translation of the MRPL43 gene. BMC Genom Data. 2022, 23, 42. [Google Scholar] [CrossRef] [Scilit]
- Schmeing, T.M. Ribosome Structure. In Encyclopedia of Biological Chemistry, 2nd ed.; Lennarz, W.J., Lane, M.D., Eds.; Academic Press: Waltham, MA, USA, 2013; Volume 4, pp. 128–135. [Google Scholar] [CrossRef] [Scilit]
- Clancy, S.; Brown, W. Translation: DNA to mRNA to Protein. Nat. Educ. 2008, 1, 101. [Google Scholar]
- Rodnina, M.V. The ribosome as a versatile catalyst: Reactions at the peptidyl transferase center. Curr. Opin. Struct. Biol. 2013, 23, 595–602. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Goss, D.J.; Domashevskiy, A.V. Messenger RNA (mRNA): The link between DNA and protein. In Encyclopedia of Cell Biology; Bradshaw, R.A., Stahl, P.D., Eds.; Academic Press: Oxford, UK, 2016; pp. 341–345. [Google Scholar] [CrossRef] [Scilit]
- Hecht, A.; Glasgow, J.; Jaschke, P.R.; Bawazer, L.A.; Munson, M.S.; Cochran, J.R.; Endy, D.; Salit, M. Measurements of translation initiation from all 64 codons in E. coli. Nucleic Acids Res. 2017, 45, 3615–3626. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rodnina, M.V. Translation in Prokaryotes. Cold Spring Harb. Perspect. Biol. 2018, 10, a032664. [Google Scholar] [CrossRef] [Scilit]
- Saito, K.; Ito, K. Translation Termination. In Encyclopedia of Systems Biology; Dubitzky, W., Wolkenhauer, O., Cho, K.H., Yokota, H., Eds.; Springer: New York, NY, USA, 2013; pp. 2234–2266. [Google Scholar] [CrossRef] [Scilit]
- Singh, N.; Bhalla, N. Moonlighting proteins. Annu. Rev. Genet. 2020, 54, 265–285. [Google Scholar] [CrossRef] [Scilit]
- Yadav, P.; Singh, R.; Sur, S.; Bansal, S.; Chaudhry, U.; Tandon, V. Moonlighting proteins: Beacon of hope in era of drug resistance in bacteria. Crit. Rev. Microbiol. 2022, 1–25. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Chen, C.; Liu, H.; Zabad, S.; Rivera, N.; Rowin, E.; Hassan, M.; Gomez De Jesus, S.M.; Llinas Santos, P.S.; Kravchenko, K.; Mikhova, M.; et al. MoonProt 3.0: An update of the moonlighting proteins database. Nucleic Acids Res. 2021, 49, D368–D372. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Jeffrey, C.J. Protein moonlighting: What is it, and why is it important? Philos. Trans. R. Soc. B Biol. Sci. 2018, 373. [Google Scholar] [CrossRef] [Scilit]
- Jeffery, C.J. Moonlighting proteins—Nature’s Swiss army knives. Sci. Prog. 2017, 100, 363–373. [Google Scholar] [CrossRef] [Scilit]
- Copley, S.D. An evolutionary perspective on protein moonlighting. Biochem. Soc. Trans. 2014, 42, 1684–1691. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, G.; Xia, Y.; Cui, J.; Gu, Z.; Song, Y.; Chen, Y.Q.; Chen, H.; Zhang, H.; Chen, W. The roles of moonlighting proteins in bacteria. Curr. Issues Mol. Biol. 2014, 16, 15–22. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wool, I.G. Extraribosomal functions of ribosomal proteins. TrendsBiochem. 1996, 21, 164–165. [Google Scholar] [CrossRef]
- Deng, T.; Ge, H.; He, H.; Liu, Y.; Zhai, C.; Feng, L.; Yi, L. The heterologous expression strategies of antimicrobial peptides in microbial systems. Protein Expr. Purif. 2017, 140, 52–59. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Büyükkiraz, M.E.; Kesmen, Z. Antimicrobial peptides (AMPs): A promising class of antimicrobial compounds. J. Appl. Microbio. 2021, 132, 1573–1596. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pütsep, K.; Brändén, C.I.; Boman, H.G.; Normark, S. Antibacterial peptide from H. pylori. Nature 1999, 398, 671–672. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Fernandes, J.M.; Smith, V.J. A novel antimicrobial function for a ribosomal peptide from rainbow trout skin. Biochem. Biophys. Res. Commun. 2002, 296, 167–171. [Google Scholar] [CrossRef] [Scilit]
- Lee, D.G.; Park, Y.; Kim, H.N.; Kim, H.K.; Kim, P.; Choi, B.H.; Hahm, K.-S. Antifungal mechanism of an antimicrobial peptide, HP (2–20), derived from N-terminus of Helicobacter pylori ribosomal protein L1 against Candida albicans. Biochem. Biophys. Res. Commun. 2002, 291, 1006–1013. [Google Scholar] [CrossRef] [Scilit]
- Deng, Z.; Hou, K.; Zhao, J.; Wang, H. The Probiotic Properties of Lactic Acid Bacteria and Their Applications in Animal Husbandry. Curr. Microbiol. 2022, 79, 1–11. [Google Scholar] [CrossRef] [Scilit]
- de Carvalho, K.G.; Bambirra, F.H.; Kruger, M.F.; Barbosa, M.S.; Oliveira, J.S.; Santos, A.M.; Nicoli, J.R.; Bemquerer, M.P.; de Miranda, A.; Salvucci, E.J.; et al. Antimicrobial compounds produced by Lactobacillus sakei subsp. sakei 2a, a bacteriocinogenic strain isolated from a Brazilian meat product. J. Ind. Microbiol. Biotechnol. 2010, 37, 381–390. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pidutti, P.; Federici, F.; Brandi, J.; Manna, L.; Rizzi, E.; Marini, U.; Cecconi, D. Purification and characterization of ribosomal proteins L27 and L30 having antimicrobial activity produced by the Lactobacillus salivarius SGL 03. J. Appl. Microbiol. 2018, 124, 398–407. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rigvava, S.; Kusradze, I.; Tchgkonia, I.; Karumidze, N.; Dvalidze, T.; Goderdzishvili, M. Novel lytic bacteriophage vB_GEC_EfS_9 against Enterococcus faecium. Virus Res. 2022, 307, 198599. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- García-Cano, I.; Rocha-Mendoza, D.; Ortega-Anaya, J.; Wang, K.; Kosmerl, E.; Jiménez-Flores, R. Lactic acid bacteria isolated from dairy products as potential producers of lipolytic, proteolytic and antibacterial proteins. Appl. Microbiol. Biotechnol. 2019, 103, 5243–5257. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ghoreishi, F.S.; Roghanian, R.; Emtiazi, G. Simultaneous Production of Antibacterial Protein and Lipopeptides in Bacillus tequilensis, Detected by MALDI-TOF and GC Mass Analyses. Probiotics Antimicrob. Proteins. 2022, 1–12. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ashburner, M.; Ball, C.A.; Blake, J.A.; Botstein, D.; Butler, H.; Cherry, J.M.; Davis, A.P.; Dolinski, K.; Dwight, S.S.; Eppig, J.T.; et al. Gene ontology: Tool for the unification of biology. Nat. Genet. 2000, 25, 25–29. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Milano, M. Gene Prioritization Tools. In Encyclopedia of Bioinformatics and Computational Biology: ABC of Bioinformatics; Ranganathan, S., Nakai, K., Schonbach, C., Eds.; Elsevier: Amsterdam, The Netherlands, 2018; p. 1708. [Google Scholar] [CrossRef] [Scilit]
- Thomas, P.D. The Gene Ontology and the Meaning of Biological Function. In Handbook of The Gene Ontology; Dessimoz, C., Škunc, N., Eds.; Humana Press: New York, NY, USA, 2017; Part, I. [Google Scholar]
- Butler, È.; Alsterfjord, M.; Olofsson, T.C.; Karlsson, C.; Malmström, J.; Vásquez, A. Proteins of novel lactic acid bacteria from Apis mellifera mellifera: An insight into the production of known extra-cellular proteins during microbial stress. BMC microbiol. 2013, 13, 1–12. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Seo, J.-K.; Kim, D.-G.; Oh, R.; Park, K.-S.; Lee, I.-A.; Cho, S.-M.; Lee, K.-Y.; Nam, B.-H. Antimicrobial effect of the 60S ribosomal protein L29 (cgRPL29), purified from the gill of pacific oyster, Crassostrea gigas. Fish Shellfish Immunol. 2017, 67, 675–683. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Oh, H.Y.; Go, H.J.; Park, N.G. Identification and characterization of SaRpAMP, a 60S ribosomal protein L27-derived antimicrobial peptide from amur catfish, Silurus asotus. Fish Shellfish Immunol. 2020, 106, 480–490. [Google Scholar] [CrossRef] [Scilit]
- Thorpe, C.M.; Pulsifer, A.R.; Osburne, M.S.; Vanaja, S.K.; Leong, J.M. Citrobacter rodentium (ϕStx2dact), a murine infection model for enterohemorrhagic Escherichia coli. Curr. Opin. Microbiol. 2022, 65, 183–190. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Khairulina, J.; Graifer, D.; Bulygin, K.; Ven’yaminova, A.; Frolova, L.; Karpova, G. Eukaryote-specific motif of ribosomal protein S15 neighbors A site codon during elongation and termination of translation. Biochimie 2010, 92, 820–825. [Google Scholar] [CrossRef] [Scilit]
- Ali, R.A.; Khan, M.A.; Anjum, A.A.; Muhammad, M.; Sattar, K.; Sarwar, A.; Ali, T.; Tariq, M.; Iqbal, A. Molecular markers for the detection of pathogenic and food poisoning potential of methicillin resistant Staphylococcus aureus isolated from wounds of hospitalized patients. Pak. J. Pharm. Sci. 2022, 35, 305–311. [Google Scholar] [CrossRef] [Scilit]
- Vignesh, S.; Krishnaveni, G.; Walter Devaa, J.C.; Muthukumar, S.; Uthandakalaipandian, R. Experimental challenge of the freshwater fish pathogen Aeromonas hydrophila Ah17 and its effect on snakehead murrel Channa striata. Aquac. Int. 2022, 1–18. [Google Scholar] [CrossRef] [Scilit]
- Park, Y.; Park, S.C.; Park, H.K.; Shin, S.Y.; Kim, Y.; Hahm, K.S. Structure-activity relationship of HP (2–20) analog peptide: Enhanced antimicrobial activity by N-terminal random coil region deletion. Biopolym. (Peptide Sci.) 2007, 88, 199–207. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lee, J.K.; Park, S.C.; Hahm, K.S.; Park, Y. Antimicrobial HPA3NT3 peptide analogs: Placement of aromatic rings and positive charges are key determinants for cell selectivity and mechanism of action. Biochim. Biophys. Acta–Biomembr. 2013, 1828, 443–454. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Irazazabal, L.N.; Porto, W.F.; Fensterseifer, I.C.; Alves, E.S.; Matos, C.O.; Menezes, A.C.; Felícioe, M.R.; Gonçalvese, S.; Santose, N.C.; Ribeiro, S.M.; et al. Fast and potent bactericidal membrane lytic activity of PaDBS1R1, a novel cationic antimicrobial peptide. Biochim. Biophys. Acta Biomembr. 2019, 1861, 178–190. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Ma, Z.; Qu, B.; Yao, L.; Gao, Z.; Zhang, S. Identification and functional characterization of ribosomal protein S23 as a new member of antimicrobial protein. Dev. Comp. Immunol. 2020, 110, 103730. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Kurpe, S.R.; Grishin, S.Y.; Surin, A.K.; Selivanova, O.M.; Fadeev, R.S.; Dzhus, U.F.; Gorbunova, E.Y.; Mustaeva, L.G.; Azev, V.N.; Galzitskaya, O.V. Antimicrobial and amyloidogenic activity of peptides synthesized on the basis of the ribosomal S1 protein from Thermus thermophilus. Int. J. Mol. Sci. 2020, 21, 6382. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Galzitskaya, O.V. Exploring Amyloidogenicity of Peptides From Ribosomal S1 Protein to Develop Novel AMPs. Front. Mol. Biosci. 2021, 8, 1–5. [Google Scholar] [CrossRef] [Scilit]
- Grishin, S.Y.; Domnin, P.A.; Kravchenko, S.V.; Azev, V.N.; Mustaeva, L.G.; Gorbunova, E.Y.; Kobyakova, M.I.; Surin, A.K.; Makarova, M.A.; Kurpe, S.R.; et al. Is It Possible to Create Antimicrobial Peptides Based on the Amyloidogenic Sequence of Ribosomal S1 Protein of P. aeruginosa? Int. J. Mol. Sci. 2021, 22, 9776. [Google Scholar] [CrossRef] [Scilit]
- Kravchenko, S.V.; Domnin, P.A.; Grishin, S.Y.; Panfilov, A.V.; Azev, V.N.; Mustaeva, L.G.; Gorbunova, E.Y.; Kobyakova, M.I.; Surin, A.K.; Glyakina, A.V.; et al. Multiple Antimicrobial Effects of Hybrid Peptides Synthesized Based on the Sequence of Ribosomal S1 Protein from Staphylococcus aureus. Int. J. Mol. Sci. 2022, 23, 524. [Google Scholar] [CrossRef] [Scilit]
- Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial peptides: Classification, design, application and research progress in multiple fields. Front Microbiol. 2020, 11, 1–16. [Google Scholar] [CrossRef] [Scilit]
- Costa, F.; Teixeira, C.; Gomes, P.; Martins, M.C.L. Clinical Application of AMPs. Adv. Exp. Med. Biol. 2019, 1117, 281–298. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Usmani, S.S.; Bedi, G.; Samuel, J.S.; Singh, S.; Kalra, S.; Kumar, P.; Ahuja, A.A.; Sharma, M.; Gautam, A.; Raghava, G.P.S. THPdb: Database of FDA-approved peptide and protein therapeutics. PLoS ONE. 2017, 12, e0181748. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rai, M.; Pandit, R.; Gaikwad, S.; Kövics, G. Antimicrobial peptides as natural bio-preservative to enhance the shelf-life of food. J. Food Sci. Technol. 2016, 53, 3381–3394. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Yaghoubi, A.; Khazaei, M.; Ghazvini, K.; Movaqar, A.; Avan, A.; Hasanian, S.M.; Soleimanpour, S. Peptides with dual antimicrobial-anticancer activity derived from the N-terminal region of H. pylori Ribosomal Protein L1 (RpL1). Int. J. Pept. Res. Ther. 2021, 27, 1057–1067. [Google Scholar] [CrossRef] [Scilit]
- Li, J.; Koh, J.-J.; Liu, S.; Lakshminarayanan, R.; Verma, C.S.; Beuerman, R.W. Membrane active antimicrobial peptides: Translating mechanistic Insights to design. Front. Neurosci. 2017, 11, 1–12. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mbye, M.; Baig, M.A.; AbuQamar, S.F.; El-Tarabily, K.A.; Obaid, R.S.; Osaili, T.M.; Al-Nabulsi, A.A.; Turner, M.S.; Shah, N.P.; Ayyash, M.M. Updates on understanding of probiotic lactic acid bacteria responses to environmental stresses and highlights on proteomic analyses. Compr. Rev. Food Sci. Food Saf. 2020, 19, 1110–1124. [Google Scholar] [CrossRef] [Scilit] [PubMed]





| DOMAIN | |||
|---|---|---|---|
| Bacteria | Eukarya | Archaea | |
| Ribosome | 70S | 80S | 70S |
| Molecular mass | 2.3 MDa | ~4.5 MDa | ~4.5 MDa |
| Large subunit (LSU) | 50S | 60S | 50S |
| rRNA | 23S, 5S | 5.8S, 25–28S, 5S | 23S, 5S |
| Number of proteins | 33 | 46 | 40 |
| Small subunit (SSU) | 30S | 40S | 30S |
| rRNA | 16S | 18S | 16S |
| Number of proteins | 21 | 32 | 28 |
| Database | Website |
|---|---|
| MoonProt | http://www.moonlightingproteins.org |
| Multitasking Proteins DataBase | http://wallace.uab.es/multitaskII |
| MultitaskProtDB-II | http://moondb.hb.univ-amu.fr |
| PlantMP | https://www.plantmp.com |
| AMP | Application | Route of Administration |
|---|---|---|
| Dalbavancin, oritavancin, and telavancin | Complicated skin infections | Intravenous infusion |
| Vancomycin | Against Gram-positive bacteria Treats diarrhea associated with Clostridium difficile, pseudomembranous colitis, and infection | Intravenous infusion |
| Bacitracin | Skin and eye infections | Intramuscular |
| Polymyxin E (colistins) | Gastrointestinal tract infections caused by E. coli and Salmonella spp. | Intramuscular or intravenous |
| Polymyxin B | Last-line treatment alternative for resistant Gram-negative bacterial infections | Intramuscular, intravenous, intrathecal ophthalmic |
| Tyrothricin | Treatment of infected skin and oropharyngeal mucous membranes Effective against Gram-positive bacteria | Topical application only |
| Gramicidin D (or just gramicidin) | Skin lesions, surface wounds, and eye infections | External use only |
| Gramicidin S | Against Gram-negative and Gram-positive bacteria and fungi Used to treat genital ulcers caused by sexually transmitted diseases | Topical application only |
| Daptomycin | Skin infections caused by Gram-positive bacteria | Intravenous injection |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Hurtado-Rios, J.J.; Carrasco-Navarro, U.; Almanza-Pérez, J.C.; Ponce-Alquicira, E. Ribosomes: The New Role of Ribosomal Proteins as Natural Antimicrobials. Int. J. Mol. Sci. 2022, 23, 9123. https://doi.org/10.3390/ijms23169123
Hurtado-Rios JJ, Carrasco-Navarro U, Almanza-Pérez JC, Ponce-Alquicira E. Ribosomes: The New Role of Ribosomal Proteins as Natural Antimicrobials. International Journal of Molecular Sciences. 2022; 23(16):9123. https://doi.org/10.3390/ijms23169123
Chicago/Turabian StyleHurtado-Rios, Jessica J., Ulises Carrasco-Navarro, Julio Cesar Almanza-Pérez, and Edith Ponce-Alquicira. 2022. "Ribosomes: The New Role of Ribosomal Proteins as Natural Antimicrobials" International Journal of Molecular Sciences 23, no. 16: 9123. https://doi.org/10.3390/ijms23169123
APA StyleHurtado-Rios, J. J., Carrasco-Navarro, U., Almanza-Pérez, J. C., & Ponce-Alquicira, E. (2022). Ribosomes: The New Role of Ribosomal Proteins as Natural Antimicrobials. International Journal of Molecular Sciences, 23(16), 9123. https://doi.org/10.3390/ijms23169123

