Abstract
Skin wound healing is coordinated by a delicate balance between proinflammatory and anti-inflammatory responses, which can be affected by opportunistic pathogens and metabolic or vascular diseases. Several antimicrobial peptides (AMPs) possess immunomodulatory properties, suggesting their potential to support skin wound healing. Here, we evaluated the proregenerative activity of three recently described AMPs (Clavanin A, Clavanin-MO, and Mastoparan-MO). Human primary dermal fibroblasts (hFibs) were used to determine peptide toxicity and their capacity to induce cell proliferation and migration. Furthermore, mRNA analysis was used to investigate the modulation of genes associated with skin regeneration. Subsequently, the regenerative potential of the peptides was further confirmed using an ex vivo organotypic model of human skin (hOSEC)-based lesion. Our results indicate that the three molecules evaluated in this study have regenerative potential at nontoxic doses (i.e., 200 μM for Clavanin-A and Clavanin-MO, and 6.25 μM for Mastoparan-MO). At these concentrations, all peptides promoted the proliferation and migration of hFibs during in vitro assays. Such processes were accompanied by gene expression signatures related to skin regenerative processes, including significantly higher KI67, HAS2 and CXCR4 mRNA levels induced by Clavanin A and Mastoparan-MO. Such findings translated into significantly accelerated wound healing promoted by both Clavanin A and Mastoparan-MO in hOSEC-based lesions. Overall, the data demonstrate the proregenerative properties of these peptides using human experimental skin models, with Mastoparan-MO and Clavanin A showing much greater potential for inducing wound healing compared to Clavanin-MO.
1. Introduction
Normal wound healing involves coordination between the immune response and the processes of cellular migration, proliferation, matrix deposition, and tissue remodeling [1]. During skin wound healing, an excessive inflammatory response induced by opportunistic pathogens, and metabolic, or chronic diseases can lead to nonhealing wounds [2,3]. For instance, an increase in the proinflammatory response, resulting from the deregulation of several key proinflammatory cytokines, such as IL-1β and tumor necrosis factor–α (TNFα), prolongs the inflammatory phase, and has been related to elevated activity of metalloproteinases that impair cell migration and proliferation process, thus delaying the wound repair [3,4]. This deterioration in healing conditions and the presence of nonhealing wounds increases treatment costs, causes aesthetic damage, or even puts the lives of patients at risk, which makes it necessary to search for new therapeutic options that favor skin tissue regeneration [1,4].
In the search for new proregenerative treatments, antimicrobial peptides (AMPs) arise as a group of molecules that present a broad spectrum of antimicrobial activity, accompanied by immunomodulatory and regenerative properties that promote cell proliferation, and angiogenesis, which favors the wound healing process [5,6]. The AMPs Clavanin A (VFQFLGKIIHHVGNFVHGFSHVF-NH2) and its synthetic derivative Clavanin-MO (FLPIIVFQFLGKIIHHVGNFVHGFSHVF-NH2) present strong activity against both Gram-negative and Gram-positive bacteria and can modify the expression of immune system components that regulate the inflammatory response [7,8,9]. Clavanin-MO can modulate innate immunity by stimulating leukocyte recruitment and the production of immune mediators such as GM-CSF, IFN-γ, and MCP-1, favoring an increase in the levels of anti-inflammatory cytokines (IL-10) and repressing the expression of proinflammatory cytokines (IL-12 and TNF-α), which suppresses the damage caused by an excessive inflammatory response [9]. Likewise, the peptide Mastoparan-MO (FLPIIINLKALAAALAKKIL), a less toxic synthetic variant of the natural AMP Mastoparan-L, can increase leukocyte migration while suppressing the expression of proinflammatory factors such as TNF-α, and IL-6. These immunomodulatory properties enhance the immune responses required to eliminate infections and reduce the damage caused by an excessive inflammatory response [10,11].
In the present study, we examined the ability of three antimicrobial peptides (Clavanin A, Clavanin-MO, and Mastoparan-MO,) to stimulate cell proliferation, and migration, as well as encourage the activation of genes associated with tissue regeneration in a model of primary human dermal fibroblasts (hFibs). Likewise, using an organotypic human ex vivo skin model (hOSEC), we analyzed the possible induction of wound healing generated by these antimicrobial peptides.
Our results indicate that treatment with Clavanin A, Clavanin-MO, or Mastoparan-MO peptides did not generate changes in the cellular viability of primary skin cells, suggesting low cytotoxicity of these molecules. Likewise, treatment with these AMPs can increase cell proliferation, migratory capabilities, and the induction of gene expression related to tissue repair processes in hFibs. Finally, using an ex vivo human skin culture system, we determined that Clavanin-MO and Mastoparan-MO can potentially facilitate wound healing. These results suggest that these antimicrobial and immunomodulatory peptides have skin-regenerative potential, constituting an exciting alternative for the development of further treatments for skin injuries.
2. Results
2.1. Cytotoxicity Screening of AMPs
We analyzed the cytotoxic potential on skin cells of three well-characterized antimicrobial peptides (Table 1). At 24 h of exposure, the peptides Clavanin A and Clavanin-MO did not produce any significant change in cell viability compared to control when the cells were exposed to doses as high as 200 μM (Figure 1A,B). However, Mastoparan-MO induced a significant and progressive reduction in cell viability, observed starting from 25 μM (p < 0.001), and reaching more than 50% at 100 μM (p < 0.001) (Figure 1C).
Table 1.
List of antimicrobial peptides used during this study and their immunomodulatory properties.
Figure 1.
Cytotoxicity screening of AMPs. Cytotoxic potential of Clavanin A and Clavanin-MO at 200, 100, 50, and 25 μM ((A,B) respectively), and Mastoparan-MO at 100, 50, 25, 6.25, 3.12, and 1.56 μM (C), was tested in human primary dermal fibroblasts (hFibs). The mean ± SD of three independent experiments is presented. Effects on cell proliferation of Clavanin A and Clavanin-MO at 200 or 100 μM ((D,E), respectively) and Mastoparan-MO at 6.25 or 3.12 μM (F), were determined at 1, 4, and 7 days by MTT assay. The mean, along with the standard deviation, is shown for three independent experiments. In both cases, the statistical analysis was carried out through one-way ANOVA and Tukey post hoc tests. Asterisks indicate significant differences (** p < 0.01; *** p < 0.001) relative to the control.
This peptide, however, did not generate a significant change in cell viability when the cells were exposed to concentrations below 25 μM. As cytotoxicity controls, we evaluated the peptides Polybia-MPII and EcDBS1R6, which induced a significant reduction in cell viability (p < 0.05) at all concentrations tested (Figure S1). Based on these results, for further experiments, we used Clavanin A and Clavanin-MO at 100 and 200 μM, while Mastoparan-MO was used at 6.25 and 3.12 μM.
2.2. Proliferative Potential
At 7 days of treatment, both Clavanin A (100 μM and 200 μM) and Clavanin-MO (100 μM) were able to induce a significant increase in cell proliferation compared to the control of the solvent vehicle (p < 0.01 compared to the untreated control; Figure 1D,E). This trend can also be observed on days 1 and 4 of the treatment with Clavanin-MO at 200 μM. Likewise, the treatment with Mastoparan-MO at 3.12 and 6.25 μM induces a significant increase in cell proliferation (compared to the control of the solvent vehicle) at 4 and 7 days of treatment (p < 0.001; Figure 1F). After seven days of treatment, it is possible to observe that the Mastoparan-MO treatment at 6.25 μM can induce a significant increase in cell proliferation compared to the positive control (supplemented with 10% FBS) (p < 0.001; Figure 1F). The analysis of the proliferation kinetics (Figure 2A–C) reveals that at 4 days, the treatment with Clavanin A or with Mastoparan-MO at any of the tested concentrations produces a significant increase in cell replication rate compared with the control of the solvent vehicle (Clavanin A at 100 μM or 200 μM, p <0.05; Mastoparan-MO at 3.12, p < 0.05 and at 6.25 μM, p < 0.01). In the same way, the analysis of the proliferative potential (Figure 2D–F) that was carried out by calculating the population doubling time (PDT) shows that except for cells treated with Clavanin-MO at 100 μM, all treatments generated a significant reduction in the population doubling time compared to the vehicle control (Clavanin A at 100, 200 μM, and Clavanin-MO at 200 μM, p < 0.05; Mastoparan-MO at 3.12 μM, p < 0.01, and Mastoparan-MO at 6.25 μM, p < 0.05).
Figure 2.
Analysis of proliferation kinetics. Human primary dermal fibroblast (hFibs) were incubated with Clavanin A ((A,D); 200 or 100 μM), Clavanin-MO ((B,E); 200 or 100 μM), or Mastoparan-MO ((C,F); 6.25 or 3.12 µM). Proliferation kinetics (A–C) were determined at 1, 4, and 7 days by counting the total number of cells. To determine the proliferative potential of the cells, the population doubling time (PDT) was calculated at 4 days (D–F) of peptide treatment. The statistical analysis was carried out by means of a one-way ANOVA and Tukey post hoc tests. Significant differences regarding the control are marked with asterisks (* p < 0.05; ** p < 0.01).
2.3. Gene Expression Profile
Using qRT-PCR, we analyzed potential changes in gene expression of proregenerative factors in cells treated with the peptides (Figure 3). This analysis was conducted with cells treated with the peptides at concentrations of 200 μM for Clavanin A and Clavanin-MO, and 6.25 μM for Mastoparan-MO, as at these concentrations, the peptides showed a significant increase in cell proliferation and a significant reduction in population doubling time (PDT), which suggests a possible proregenerative effect of these molecules. The obtained results revealed that the treatment with Mastoparan-MO generated significant upregulation in expression levels of FGF2, KI67, ELN, HAS2, and CXCR4 transcripts compared to the vehicle control (p < 0.01; Figure 3A–C,E,F). Likewise, treatment with Clavanin A can induce a significant upregulation in the expression levels of KI67, HAS2, CXCR4, CXCR7, and BCL2 (p < 0.01; Figure 3B,E–H). In contrast, treatment with Clavanin A also generated a trend towards downregulation of FGF2 and MMP1 expression (Figure 3A,D). Clavanin-MO treatment promoted a significant upregulation in the expression of FGF2 (p < 0.05 compared to the vehicle control), ELN, MMP1, HAS2, and CXCR7 (p < 0.01 compared to the vehicle control; Figure 3A,C–E,G).
Figure 3.
Changes in the expression of proregenerative genes. Relative mRNA expression profile of Human primary dermal fibroblasts (hFibs), that were treated with Clavanin A (200 μM), Clavanin-MO (200 μM), or Mastoparan-MO (6.25 μM), was analyzed. The mRNAs assessed correspond to (A) fibroblast growth factor 2 (FGF2), (B) marker of proliferation Ki-67 (KI67), (C) elastin (ELN), (D) matrix metalloproteinase 1 (MMP1), (E) hyaluronic acid synthase 2 (HAS2), (F) C-X-C chemokine receptor type 4 (CXCR4), (G) C-X-C chemokine receptor type 7 (CXCR7), and (H) B-cell lymphoma 2 protein (BCL2). Glyceraldehyde 3-phosphate dehydrogenase (GAPDH) was used as a ubiquitous control. Analysis of the mean ± SD of three independent experiments is presented. Statistical analysis was carried out by means of a one-way ANOVA and Tukey post hoc tests. Significant differences regarding the control are marked with asterisks (* p < 0.05; ** p < 0.01).
2.4. Cellular Migration
The treatment with both Clavanin A and Clavanin-MO at 200 μM for 24 and 48 h can induce a significant increase in the percentage of cell migration compared to the control of the solvent vehicle without FBS (p < 0.01 compared to the untreated control) (Figure 4A,B,D). Likewise, Mastoparan-MO treatment at 6.25 μM (Figure 4C,D) induced a significant increase in cell migration regarding the solvent vehicle control at both 24 and 48 h. At 48 h of treatment, the cells treated with Mastoparan-MO at 6.25 μM show an increase in cell migration that is greater than that observed in the positive control supplemented with FBS (p < 0.01; Figure 4C,D).
Figure 4.
Analysis of fibroblast migration and wound healing in an ex vivo skin model. Human primary dermal fibroblasts (hFibs) were incubated with (A) Clavanin A at 200 μM, (B) Clavanin-MO at 200 μM, or (C) Mastoparan-MO at 6.25 μM, and the cell migration percentage was determined by image analysis. As controls, basal medium supplemented with FBS (positive control, black bars), and basal medium without FSB (negative control, light gray bars). In (A–C), the dark gray bars correspond to the cells exposed to each of the corresponding peptides. The mean ± SD of the percentage of cells that migrated in three independent experiments at 0, 24, and 48 h is presented. The statistical analysis was carried out by means of one-way ANOVA and Tukey post hoc tests. Significant differences regarding the control are marked with asterisks (** p < 0.01). In (D), it is possible to observe representative images of hFib migration at 24 and 48 h of peptide treatment (Clavanin A and Clavanin-MO at 200 μM, Mastoparan-MO at 6.25 μM), yellow dots represent the cells that invaded the scratched area. Wound healing assay in human skin explants exposed to: Clavanin A (200 μM), Clavanin-MO (200 μM), or Mastoparan-MO (6.25 μM) (E,F). Quantification of the area of re-epithelialization and lesion closure in the skin explants at 7 days of treatment was quantified using the ImageJ software (version 1.53 i). The analysis of the mean ± SD of the wound area of three independent experiments is represented (E). The statistical analysis was carried out through one-way ANOVA and Tukey post hoc tests. Significant differences regarding the control are marked with asterisks (** p < 0.01). In (F), it is possible to observe representative images of the closure of the wounds in the human skin explants at 7 days of treatment.
2.5. Wound Healing in hOSEC
The effect of the three AMPs on the wound healing process was analyzed using an ex vivo organotypic model of human skin (hOSEC) (Figure 4E,F). The results indicate that treatment with Clavanin A and Mastoparan-MO at 200 and 6.25 μM, respectively, could induce a significant reduction in the lesion area relative to the negative control of minimal regeneration, treated with the medium supplemented only with FBS (Figure 4E,F) (p < 0.01). In contrast, skin explants treated with Clavanin-MO at 200 μM did not show a significant reduction in the lesion area compared to either of the two controls in this experiment.
3. Discussion
Growing evidence indicates that several AMPs can generate an immunomodulatory effect that promotes cell attachment, proliferation, and infiltration, thereby facilitating tissue regeneration and wound healing. This suggests that these types of antimicrobial molecules may have the potential to develop proregenerative treatments [12,13,14]. In this work, using both a culture system of primary human fibroblasts (hFibs) and an ex vivo organotypic model of human skin (hOSEC), we analyzed the proregenerative potential of three antimicrobial peptides (Clavanin A, Clavanin-MO, and Mastoparan-MO).
Although Clavanin A and Clavanin-MO have been previously reported to exhibit moderate cytotoxicity against monocyte/macrophage-like cells (EC50 < 50 μM) [15], our results indicate that in hFibs, the treatment with these two calvanins did not generate any significant cytotoxic effect, even at the 200 μM dose. Likewise, even though in RAW 264.7 cells, Mastoparan-MO does not present cytotoxicity at doses of up to 200 μM [10], the absence of cytotoxicity in hFibs could only be observed when the cells were treated with this peptide at concentrations below 25 μM, suggesting that cytotoxicity may depend on the cell type tested [16].
Other peptides that present immunomodulatory properties, such as human beta-defensins 2 and 3 (hBD-2 and hBD-3), can stimulate skin cell proliferation, possibly through the expression of fibroblast growth factor receptor 1 (FGFR1), and the enhancement in the phosphorylation of FGFR1, JAK2, and STAT3, which are proregenerative factors that promote wound healing, angiogenesis, and fibroblast activation [12,17,18,19]. Our results indicate that the three AMPs (Clavanin A, Clavanin-MO, and Mastoparan-MO) can induce an increase in the cell proliferation rate of hFibs, which indicates that these peptides, especially Mastoparan-MO, may have properties that facilitate tissue repair through the induction of key genes for cell proliferation such as FGF2 and KI67 [20,21].
In this sense, it has also been observed that some antimicrobial peptides, such as the synthetic A-hBD-2 or the LL-37 peptide (the only member of the human cathelicidin family), have the ability to facilitate the wound healing process by stimulating cell migration in both skin cells and mesenchymal stem cells [14,22]. Likewise, Synoeca-MP, an AMP with a broad antimicrobial spectrum, has also been shown to be useful in skin repair when combined with host-defense peptides IDR-1018 [23].
Although the three antimicrobial peptides tested in this study have the potential to induce an increase in cell migration, treatment with Mastoparan-MO can induce a greater increase in the cell migration rate of hFibs. Likewise, upregulation of the CXCR4 chemokine receptor suggests that the peptides tested can accelerate the migration of epidermal cells through signaling mediated by CXCL12, a signaling pathway that has been implicated in the process of wound repair and regeneration [24,25,26].
Other bioactive peptides, such as Crotalus adamanteus toxin-II (CaTx-II) and the PR-39 peptide, can induce cell proliferation, which is accompanied by the synthesis of key constituents of the extracellular matrix such as collagen and proteoglycans [27,28]. In this study, we showed that the three peptides tested during this study can generate upregulation of HAS2, while Clavanin-MO and Mastoparan-MO induce an increase in the expression of the ELN gene, suggesting that these AMPs can facilitate the remodeling of the extracellular matrix (ECM), which is a crucial step in regeneration and wound repair [29,30].
The hOSEC model stands out as an ex vivo system that closely mimics the physiological conditions of human skin. Currently, this alternative model for analyzing the safety and efficacy of various compounds for wound treatment, avoiding the use of animals, is a valuable tool in the validation of compounds for topical and transdermal applications [31]. Ex vivo models that use human skin explants from elective plastic surgery provide a valuable tool to analyze the effect of various molecules in the early stages of the healing process. These models consistently allow for the maintenance of the cell populations present in native skin for at least 7 days of culture. Furthermore, hOSEC models preserve the structure of the extracellular matrix, which contains collagen, elastin, glycosaminoglycans, and other molecules. This enables the results to be more easily extrapolated to the effects of substances on in vivo human skin [32]. hOSEC models have been used to show that specific collagen peptides of fish and porcine origin have the potential to increase collagen and glycosaminoglycan content in the skin, which favors tissue regeneration processes [33]. Similarly, several ex vivo skin models have been used to evaluate the antimicrobial activity and potential skin irritation effects of the AMPs PXL150 and DPK-060. In these models, these AMPs have shown the potential to reduce the colonization of S. aureus, highlighting the value of ex vivo models for assessing the effects of peptides on tissue regeneration and skin repair [34,35].
Here, we used lesioned hOSEC models to determine the wound healing potential of Clavanin A, Clavanin-MO, and Mastoparan-MO. Our results showed that Clavanin A and Mastoparan-MO have significantly accelerated wound closure, compared to the non-treated control. Such results are partly explained by the direct effects of both peptides on fibroblasts, which presented higher proliferation and migration upon Clavanin A and Mastoparan-MO treatments. The modulation of genes related to regenerative processes, such as KI67, HAS2 and CXCR4 might also be involved, since such genes were significantly increased by both peptides. For Clavanin A, the modulation of CXCR7 and BCL2 might complement the underlying mechanism of action, while the mechanism of action of Mastoparan-MO involves FGF2 and ELN modulation. Despite promoting fibroblast migration and reducing fibroblast doubling time, Clavanin-MO only promoted a trend towards wound closure acceleration in lesioned hOSEC samples.
The proregenerative potential of various AMPs is associated with their ability to modulate the inflammation process, which is key in the restoration of normal tissue architecture during wound repair [36]. Peptides such as IDR-1018, which exert their action through regulation of the inflammatory response, can induce the repair of skin wounds [13,23,37]. It has been observed that both Clavanin A and Mastoparan-MO are capable of modulating innate immunity by stimulating leukocyte recruitment to the site of infection and production of immune mediators GM-CSF, IFN-γ, and MCP-1 while suppressing excessive inflammatory response by increasing the synthesis of anti-inflammatory cytokines such as IL-10 and repressing the levels of proinflammatory cytokines IL-6, IL-12, and TNF-α. This suggests that the ability of Clavanin A and Mastoparan-MO to modulate inflammation can be related to the proregenerative properties observed during the ex vivo assay [7,8,9,10,11,38].
It has been observed that combining antimicrobial peptides with immunomodulatory peptides can stimulate proregenerative processes in both monolayer models of human skin cells and 3D culture models of skin equivalents, through the modulation of the inflammatory process [23]. Additionally, it has been observed that the combination of various collagen peptides isolated from Salmo salar and Tilapia nilotica skin, which have an immunomodulatory effect on the innate immune response, has the potential to accelerate wound healing [39]. Clavanin A and Mastoparan-MO share similar properties of promoting fibroblast migration and proliferation, in addition to modulating common transcripts, such as KI67 and HAS2. Nevertheless, the peptides also presented complementary properties, such as the modulation of CXCR7 and BCL2 by Clavanin A, and FGF2 and ELN by Mastoparan-MO. It is possible that such peptides, when combined, could have a dual antibacterial, regenerative, and immunomodulatory effect, like that observed in analyses conducted with the combination of platelet-rich plasma with β-lactams, which simultaneously reduce MRSA infection in skin wounds while facilitating the regeneration process in the skin [40].
Another interesting perspective for Clavanin A and Mastoparan-MO peptides as potential molecules that promote tissue regeneration in skin wounds is their incorporation into nanomaterials. This can enhance their stability and activity by protecting them against degradation and controlling their release [41]. Nanoparticles or nanofiber membranes can also improve the solubility of the peptides and provide targeted delivery specificity. In this context, the use of biomaterials based on natural polymers such as collagen, chitosan, and hyaluronic acid offers controlled release aligned with the wound healing process. The effective development of new biomaterials containing these AMPs must consider solubility, stability, and controlled release, as well as the development of biodegradable formulations to promote immunomodulation, reduce toxicity, and improve re-epithelialization, which is crucial for optimal wound healing outcomes [41,42].
4. Materials and Methods
4.1. Peptide Obtention and Quantification
Synthetic peptides used in this work were provided by Peptide 2.0 Inc. (Chantilly, VA, USA). The molecular mass and purity of all peptides were analyzed by matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-ToF MS) on an AutoFlex Speed instrument (BrukerDaltonics, Billerica, MA, USA). Briefly, each peptide was diluted in deionized water, and 1 μL of each solution was mixed with 10 mg/mL α-cyano-4-hydroxycinnamicacid saturated matrix solution, prepared in H2O:ACN:TFA (50:50:0.3, v:v:v). Peptides were plated and dried on a MALDI target plate, and their monoisotopic masses were determined using the reflector mode with external calibration, using the Protein Calibration Standard II for mass spectrometry (Bruker Daltonics, Billerica, MA, USA).
4.2. Cell Culture
Human primary dermal fibroblasts (hFibs) were obtained from healthy donors, and provided by CellSeq Solutions (Belo Horizonte, MG, Brazil). The cells were cultured in a controlled environment (5% CO2, 37 °C, and 95% humidity). The growth medium employed was DMEM (Gibco, USA), supplemented with 10% v/v. fetal bovine serum (FBS) (Gibco, Waltham, MA, USA) and 1% v/v. penicillin/streptomycin solution (1000 U/mL) (Invitrogen, Grand Island, NY, USA).
4.3. Peptide Treatments
Cytotoxicity was evaluated in hFibs that were treated with 200, 100, 50, and 25 μM Clavanin A or Clavanin-MO for 48 h. In the case of Mastoparan-MO treatment, the cells were treated at 100, 50, 25, 6.25, 3.12, and 1.56 μM. In all experiments, fresh aliquots of the peptides were prepared in deionized water immediately before use. As cytotoxicity controls, the cells were treated under the same conditions using the peptides Polybia-MPII (INWLKLGKMVIDAL-NH2) and EcDBS1R6 (PMKKLFKLLARIAVKIPVW) at concentrations of 100, 50, 25, and 12.5 μM. Regarding the assessment of cell proliferation, population doubling time, and cell motility, the experimental design includes a positive control group (DMEM plus 10% FBS) and control of the utilized solvent vehicle (basal media without FBS). The treatment with the peptides was carried out in the solvent vehicle. All assays were conducted independently in triplicate.
4.4. Cell Viability and Cell Proliferation
Cell viability and proliferation were assessed using an MTT assay kit (Sigma Chemicals Co., St. Louis, MO, USA). Briefly, 1 × 104 cells were seeded in 96-well plates and incubated for 24 h for cell attachment, presenting approximately 30% of cell confluence. This guaranteed that cells would not reach 100% confluency until 7 days, which was the longest period of observation. Cell viability was determined at 48 h of peptide treatment, while cell proliferation was indirectly assessed at 1, 4, and 7 days of treatment. For this, 10 µL per well of MTT solution (5 mg/mL) was added to the cultures, and the plates were incubated for 4 h in the dark. Subsequently, DMSO (200 µL per well) was added and incubated for 30 min. A microplate reader (Bio-Tec PowerWave, Santa Clara, CA, USA) was used to determine the optical density at 595 nm. Reference wavelength was taken at 630 nm.
4.5. Proliferation Kinetics and Population Doubling Time
Monitoring of cell proliferation rate was performed in a 6-well plate with a density of 1 × 104 per well. The culture medium was changed every 2 days. The growth curve of cells was obtained by harvesting and counting the number of cells per well at 1, 4, and 7 days of treatment. The population doubling time (PDT) during the logarithmic growth phase was calculated according to Díez et al. (2015), using the following formula [43]:
where N is the number of harvested cells at the end of the growth period, and No is the number of seeded cells.
PDT = Culture Time (in hours)/Population doubling number (PDN)
PDN = Log N/No × 3.31
4.6. Cell Migration Assay
The effect of peptides on the migratory capability of hFibs was determined by the wound scratch assay according to Liang et al. (2007) [44]. Briefly, cells were seeded in 6-well plates and cultured until confluence. Scratches were made with 200 μL tips, and cell debris was removed by PBS washing before peptide treatments. Wound closure was photo-documented at time 0 and every 24 h using a Zeiss Primo Vert microscope (Carl Zeiss, Heidelberg, Germany), until the scratch was visually closed by any experimental group. The cells that invaded the scratched area were counted using the ImageJ software (National Institutes of Health, Bethesda, MD, USA). Positive migration control at 48 h was used for data normalization. Samples were analyzed as independent triplicates.
4.7. Gene Expression Analysis
Gene expression profiles of peptide-treated cells and controls were evaluated by qRT-PCR after 4 days of treatment. Target gene sequences were obtained from Genbank (https://www.ncbi.nlm.nih.gov/genbank/ (accessed on 15 January 2022)), and the primer sets and probes were designed following the standard criteria defined by the SYBRTM using Primer Express® Software v3.0.1 (Thermo Fisher Scientific, Waltham, MA, USA). Information about the primers used for qRT-PCR analysis is shown in Table S1. Genes assessed were BCL2, CXCR4, CXCR7, Elastin (EL), βFGF, Ki67, MMP1, and VEGF. The GAPDH gene was used as a control. Total RNA isolation was performed using TRIzolTM Reagent (Thermofisher, USA) following the manufacturer’s instructions, and the amount and quality of RNA were determined using a NanoDrop 1000 spectrophotometer (NanoDrop, Wilmington, DE, USA). Reverse transcription was performed using a High-Capacity cDNA Reverse Transcription Kit (Thermofisher, USA). Amplification reactions were performed on StepOne Plus equipment (Applied Biosystems, Waltham, MA, USA) using standardized reagents for real-time PCR (SYBR™ Green Master Mix, Thermofisher, USA) added from primer sets specific to each gene, or using Taqman probes (TaqMan™ Universal PCR Master Mix, Thermofisher, USA). StepOne Software v2.3 was used to determine the Ct values, and the results were analyzed by the 2-ΔΔCT analysis method.
4.8. Ex vivo Organotypic Model of Human Skin (hOSEC) Culture and Wound Healing Assay
Skin explants were obtained during routine elective cosmetic surgery performed on healthy patients. Ethical approval of this research was granted by the University of Brasília Research Ethics Committee (protocol number 30175020.0.0000.5558). Tissue samples were collected following informed consent. Explants were washed in phosphate buffer solution (PBS, Thermo Fisher Scientific, USA), supplemented with 1% v/v. of 10,000 U/mL of penicillin/streptomycin solution (Invitrogen, Grand Island, NY, USA), and the hypodermis was removed. Skin explants were cut with a 6 mm full-thickness punch biopsy, and kept in air–liquid interface at 37 °C, 5% CO2, and 95% humidity in DMEM supplemented with 10% v/v. fetal bovine serum (FBS) (Gibco, USA), and 1% v/v. of 10,000 U/mL of penicillin/streptomycin solution. The wounds were then created within the punch biopsy (2 mm circular biopsy punch). The lesioned skin fragments were placed in metallic support systems and treated with basal medium supplemented with 10% FBS. Control samples were treated with either PBS (negative control), or fibrin gel (positive control for regeneration), prepared by mixing 2.5 μL of fibrinogen at 40 μg/mL, 7.5 μL of water, and 10 μL of thrombin at 25 U/mL. The experimental group samples were treated with the peptides dissolved in the tissue culture medium. Wound healing was observed for 7 days using a Zeiss Primo Vert microscope (Carl Zeiss, Heidelberg, Germany). The change in the lesion area was determined using the ImageJ software (National Institutes of Health, USA).
4.9. Statistical Analysis
The experiments were conducted across a minimum of three separate biological replicates and at least two technical replicates. Data analysis was performed with GraphPad Prism® Software, version 7.02 (San Diego, CA, USA, 2017). A p-value of less than 0.05 was considered significant.
5. Conclusions
In the present study, we analyzed the proregenerative potential of three antimicrobial peptides (Clavanin A, Clavanin-MO, and Mastoparan-MO). The three peptides analyzed showed relatively low toxicity for hFibs and demonstrated the ability to induce cell proliferation and migration in this kind of cell. Interestingly, the Mastoparan-MO peptide exhibited the greatest proregenerative potential among the three molecules analyzed, inducing cell proliferation and migration events that exceeded those observed in the positive control used in this study. Additionally, our molecular analysis revealed a proreparative gene expression profile induced by treatment with these peptides. The use of an hOSEC model of lesioned skin demonstrated that both Clavanin A and Mastoparan-MO could induce a significant reduction in the lesion area compared to the minimal regeneration control. Taken together, the obtained results suggest that the AMPs used in this study have the potential to facilitate skin regeneration. Thanks to their antibacterial and immunomodulatory properties, these molecules could serve as the basis for developing new pharmacological approaches for treating difficult-to-manage wounds.
Supplementary Materials
The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms25136851/s1, Figure S1: Cytotoxicity controls.; Table S1: Primer sequences used for gene expression analyses by quantitative real-time PCR.
Author Contributions
Conceptualization, S.C.D. and J.L.C.; data curation, R.D.D.-M., R.P., R.A., F.F.C., N.B., S.C.D. and J.L.C.; formal analysis, T.A.-S., R.D.D.-M., M.S.d.S., R.V.P.S., M.L.L., M.T.d.O.R., R.P., R.A., F.F.C. and N.B.; funding acquisition, J.L.C. and S.C.D.; investigation, T.A.-S., R.D.D.-M., M.S.d.S., R.V.P.S., M.L.L., M.T.d.O.R., R.P., R.A., F.F.C. and N.B.; methodology, T.A.-S. and R.D.D.-M.; project administration, J.L.C.; resources, S.C.D. and J.L.C.; supervision, J.L.C.; writing—original draft, R.D.D.-M. and J.L.C.; writing—review and editing, R.D.D.-M., S.C.D. and J.L.C. All authors have read and agreed to the published version of the manuscript.
Funding
This work was supported by grants from Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES); Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq); Fundação de Apoio à Pesquisa do Distrito Federal (FAPDF); Universidade Católica de Brasília, and Universidade de Brasília.
Institutional Review Board Statement
The study was conducted following the Declaration of Helsinki, and ethical approval of this research was granted by the University of Brasília Research Ethics Committee (protocol number 30175020.0.0000.5558).
Informed Consent Statement
To develop the ex vivo Organotypic Model of Human Skin (hOSEC) experiments, informed consent was obtained from all donors involved in the study.
Data Availability Statement
The original contributions presented in the study are included in the article/supplementary material, further inquiries can be directed to the corresponding author/s.
Conflicts of Interest
The authors declare no conflicts of interest.
References
- Sorg, H.; Tilkorn, D.J.; Hager, S.; Hauser, J.; Mirastschijski, U. Skin Wound Healing: An Update on the Current Knowledge and Concepts. Eur. Surg. Res. 2017, 58, 81–94. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hojo, M.; Inokuchi, S.; Kidokoro, M.; Fukuyama, N.; Tanaka, E.; Tsuji, C.; Miyasaka, M.; Tanino, R.; Nakazawa, H. Induction of vascular endothelial growth factor by fibrin as a dermal substrate for cultured skin substitute. Plast. Reconstr. Surg. 2003, 111, 1638–1645. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Eisenstein, B.I. Treatment challenges in the management of complicated skin and soft-tissue infections. Clin. Microbiol. Infect. 2008, 14 (Suppl. S2), 17–25. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Eming, S.A.; Martin, P.; Tomic-Canic, M. Wound repair and regeneration: Mechanisms, signaling, and translation. Sci. Transl. Med. 2014, 6, 265sr6. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pfalzgraff, A.; Brandenburg, K.; Weindl, G. Antimicrobial Peptides and Their Therapeutic Potential for Bacterial Skin Infections and Wounds. Front. Pharmacol. 2018, 9, 281. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mangoni, M.L.; McDermott, A.M.; Zasloff, M. Antimicrobial peptides and wound healing: Biological and therapeutic considerations. Exp. Dermatol. 2016, 25, 167–173. [Google Scholar] [CrossRef] [Scilit]
- Kang, H.K.; Lee, H.H.; Seo, C.H.; Park, Y. Antimicrobial and Immunomodulatory Properties and Applications of Marine-Derived Proteins and Peptides. Mar. Drugs 2019, 17, 350. [Google Scholar] [CrossRef] [Scilit]
- Lee, I.H.; Zhao, C.; Cho, Y.; Harwig, S.S.; Cooper, E.L.; Lehrer, R.I. Clavanins, alpha-helical antimicrobial peptides from tunicate hemocytes. FEBS Lett. 1997, 400, 158–162. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Silva, O.N.; de la Fuente-Núñez, C.; Haney, E.F.; Fensterseifer, I.C.; Ribeiro, S.M.; Porto, W.F.; Brown, P.; Faria-Junior, C.; Rezende, T.M.; Moreno, S.E.; et al. An anti-infective synthetic peptide with dual antimicrobial and immunomodulatory activities. Sci. Rep. 2016, 6, 35465. [Google Scholar] [CrossRef] [Scilit]
- Silva, O.N.; Torres, M.D.T.; Cao, J.; Alves, E.S.F.; Rodrigues, L.V.; Resende, J.M.; Lião, L.M.; Porto, W.F.; Fensterseifer, I.C.M.; Lu, T.K.; et al. Repurposing a peptide toxin from wasp venom into antiinfectives with dual antimicrobial and immunomodulatory properties. Proc. Natl. Acad. Sci. USA 2020, 117, 26936–26945. [Google Scholar] [CrossRef] [Scilit]
- Duque, H.M.; Dos Santos, C.; Brango-Vanegas, J.; Díaz-Martín, R.D.; Dias, S.C.; Franco, O.L. Unwrapping the structural and functional features of antimicrobial peptides from wasp venoms. Pharmacol. Res. 2024, 200, 107069. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Niyonsaba, F.; Ushio, H.; Nakano, N.; Ng, W.; Sayama, K.; Hashimoto, K.; Nagaoka, I.; Okumura, K.; Ogawa, H. Antimicrobial peptides human beta-defensins stimulate epidermal keratinocyte migration, proliferation and production of proinflammatory cytokines and chemokines. J. Investg. Dermatol. 2007, 127, 594–604. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Alencar-Silva, T.; Zonari, A.; Foyt, D.; Gang, M.; Pogue, R.; Saldanha-Araujo, F.; Dias, S.C.; Franco, O.L.; Carvalho, J.L. IDR-1018 induces cell proliferation, migration, and reparative gene expression in 2D culture and 3D human skin equivalents. J. Tissue Eng. Regen. Med. 2019, 13, 2018–2030. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Cheng, Q.; Zeng, K.; Kang, Q.; Qian, W.; Zhang, W.; Gan, Q.; Xia, W. The Antimicrobial Peptide LL-37 Promotes Migration and Odonto/Osteogenic Differentiation of Stem Cells from the Apical Papilla through the Akt/Wnt/β-catenin Signaling Pathway. J. Endod. 2020, 46, 964–972. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lima, S.M.F.; Freire, M.S.; Gomes, A.L.O.; Cantuária, A.P.C.; Dutra, F.R.P.; Magalhães, B.S.; Sousa, M.G.C.; Migliolo, L.; Almeida, J.A.; Franco, O.L.; et al. Antimicrobial and immunomodulatory activity of host defense peptides, clavanins and LL-37, in vitro: An endodontic perspective. Peptides 2017, 95, 16–24. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Xia, Q.; Huang, J.; Feng, Q.; Chen, X.; Liu, X.; Li, X.; Zhang, T.; Xiao, S.; Li, H.; Zhong, Z.; et al. Size- and cell type-dependent cellular uptake, cytotoxicity and in vivo distribution of gold nanoparticles. Int. J. Nanomed. 2019, 14, 6957–6970. [Google Scholar] [CrossRef] [Scilit]
- van Kilsdonk, J.W.J.; Jansen, P.A.M.; van den Bogaard, E.H.; Bos, C.; Bergers, M.; Zeeuwen, P.L.J.M.; Schalkwijk, J. The Effects of Human Beta-Defensins on Skin Cells in In vitro. Dermatology 2017, 233, 155–163. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Koeninger, L.; Armbruster, N.S.; Brinch, K.S.; Kjaerulf, S.; Andersen, B.; Langnau, C.; Autenrieth, S.E.; Schneidawind, D.; Stange, E.F.; Malek, N.P.; et al. Human β-Defensin 2 Mediated Immune Modulation as Treatment for Experimental Colitis. Front Immunol. 2020, 31, 93. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Takahashi, M.; Umehara, Y.; Yue, H.; Trujillo-Paez, J.V.; Peng, G.; Nguyen, H.L.T.; Ikutama, R.; Okumura, K.; Ogawa, H.; Ikeda, S.; et al. The Antimicrobial Peptide Human β-Defensin-3 Accelerates Wound Healing by Promoting Angiogenesis, Cell Migration, and Proliferation Through the FGFR/JAK2/STAT3 Signaling Pathway. Front. Immunol. 2021, 12, 712781. [Google Scholar] [CrossRef] [Scilit]
- Mossahebi-Mohammadi, M.; Quan, M.; Zhang, J.S.; Li, X. FGF Signaling Pathway: A Key Regulator of Stem Cell Pluripotency. Front. Cell Dev. Biol. 2020, 8, 79. [Google Scholar] [CrossRef] [Scilit]
- Prabhu, V.; Rao, B.S.S.; Rao, A.C.K.; Prasad, K.; Mahato, K.K. Photobiomodulation invigorating collagen deposition, proliferating cell nuclear antigen and Ki67 expression during dermal wound repair in mice. Lasers Med. Sci. 2022, 37, 171–180. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mi, B.; Liu, J.; Liu, Y.; Hu, L.; Liu, Y.; Panayi, A.C.; Zhou, W.; Liu, G. The Designer Antimicrobial Peptide A-hBD-2 Facilitates Skin Wound Healing by Stimulating Keratinocyte Migration and Proliferation. Cell. Physiol. Biochem. 2018, 51, 647–663. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Alencar-Silva, T.; Díaz-Martín, R.D.; Zonari, A.; Foyt, D.; Guiang, M.; Pogue, R.; Saldanha-Araujo, F.; Dias, S.C.; Franco, O.L.; Carvalho, J.L. The Combination of Synoeca-MP Antimicrobial Peptide with IDR-1018 Stimulates Proliferation, Migration, and the Expression of Pro-Regenerative Genes in Both Human Skin Cell Cultures and 3D Skin Equivalents. Biomolecules 2023, 13, 804. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Qu, Y.; Mao, M.; Li, X.; Zhang, L.; Huang, X.; Yang, C.; Zhao, F.; Xiong, Y.; Mu, D. Enhanced migration and CXCR4 over-expression in fibroblasts with telomerase reconstitution. Mol. Cell. Biochem. 2008, 313, 45–52. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Guo, R.; Chai, L.; Chen, L.; Chen, W.; Ge, L.; Li, X.; Li, H.; Li, S.; Cao, C. Stromal cell-derived factor 1 (SDF-1) accelerated skin wound healing by promoting the migration and proliferation of epidermal stem cells. Vitr. Cell. Dev. Biol. Anim. 2015, 51, 578–585. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Chen, H.; Li, G.; Liu, Y.; Ji, S.; Li, Y.; Xiang, J.; Zhou, L.; Gao, H.; Zhang, W.; Sun, X.; et al. Pleiotropic Roles of CXCR4 in Wound Repair and Regeneration. Front. Immunol. 2021, 12, 668758. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Samy, R.P.; Kandasamy, M.; Gopalakrishnakone, P.; Stiles, B.G.; Rowan, E.G.; Becker, D.; Shanmugam, M.K.; Sethi, G.; Chow, V.T. Wound healing activity and mechanisms of action of an antibacterial protein from the venom of the eastern diamondback rattlesnake (Crotalus adamanteus). PLoS ONE 2014, 9, e80199. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gallo, R.L.; Ono, M.; Povsic, T.; Page, C.; Eriksson, E.; Klagsbrun, M.; Bernfield, M. Syndecans, cell surface heparan sulfate proteoglycans, are induced by a proline-rich antimicrobial peptide from wounds. Proc. Natl. Acad. Sci. USA 1994, 91, 11035–11039. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mu, X.; Bellayr, I.; Pan, H.; Choi, Y.; Li, Y. Regeneration of soft tissues is promoted by MMP1 treatment after digit amputation in mice. PLoS ONE 2013, 8, e59105. [Google Scholar] [CrossRef] [Scilit]
- David-Raoudi, M.; Tranchepain, F.; Deschrevel, B.; Vincent, J.C.; Bogdanowicz, P.; Boumediene, K.; Pujol, J.P. Differential effects of hyaluronan and its fragments on fibroblasts: Relation to wound healing. Wound Repair Regen. 2008, 16, 274–287. [Google Scholar] [CrossRef] [Scilit]
- Wang, E.H.C.; Barresi-Thornton, R.; Chen, L.C.; Senna, M.M.; Liao, I.C.; Chen, Y.; Zheng, Q.; Bouez, C. The Development of Human Ex Vivo Models of Inflammatory Skin Conditions. Int. J. Mol. Sci. 2023, 24, 17255. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Labouchère, A.; Haselbach, D.; Michetti, M.; Pythoud, C.; Raffoul, W.; Applegate, L.A.; Hirt-Burri, N.; de Buys Roessingh, A. A New Ex Vivo Human Skin Burn Model. J. Burn Care Res. 2024, 45, 308–317. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Asserin, J.; Lati, E.; Shioya, T.; Prawitt, J. The effect of oral collagen peptide supplementation on skin moisture and the dermal collagen network: Evidence from an ex vivo model and randomized, placebo-controlled clinical trials. J. Cosmet. Dermatol. 2015, 14, 291–301. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Håkansson, J.; Ringstad, L.; Umerska, A.; Johansson, J.; Andersson, T.; Boge, L.; Rozenbaum, R.T.; Sharma, P.K.; Tollbäck, P.; Björn, C.; et al. Characterization of the in vitro, ex vivo, and in vivo Efficacy of the Antimicrobial Peptide DPK-060 Used for Topical Treatment. Front. Cell. Infect. Microbiol. 2019, 9, 174. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Myhrman, E.; Håkansson, J.; Lindgren, K.; Björn, C.; Sjöstrand, V.; Mahlapuu, M. The novel antimicrobial peptide PXL150 in the local treatment of skin and soft tissue infections. Appl. Microbiol. Biotechnol. 2013, 97, 3085–3096. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Eming, S.A.; Wynn, T.A.; Martin, P. Inflammation and metabolism in tissue repair and regeneration. Science 2017, 356, 1026–1030. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Steinstraesser, L.; Hirsch, T.; Schulte, M.; Kueckelhaus, M.; Jacobsen, F.; Mersch, E.A.; Stricker, I.; Afacan, N.; Jenssen, H.; Hancock, R.E.; et al. Innate defense regulator peptide 1018 in wound healing and wound infection. PLoS ONE 2012, 7, e39373. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Dos Santos, A.T.; Cruz, G.S.; Baptista, G.R. Anti-inflammatory activities of arthropod peptides: A systematic review. J. Venom. Anim. Toxins Incl. Trop. Dis. 2021, 27, e20200152. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mei, F.; Liu, J.; Wu, J.; Duan, Z.; Chen, M.; Meng, K.; Chen, S.; Shen, X.; Xia, G.; Zhao, M. Collagen Peptides Isolated from Salmo salar and Tilapia nilotica Skin Accelerate Wound Healing by Altering Cutaneous Microbiome Colonization via Upregulated NOD2 and BD14. J. Agric. Food Chem. 2020, 68, 1621–1633. [Google Scholar] [CrossRef] [Scilit]
- Yang, S.C.; Lin, C.F.; Alshetaili, A.; Aljuffali, I.A.; Chien, M.Y.; Fang, J.Y. Combining the dual antibacterial and regenerative activities of platelet-rich plasma with β-lactams to mitigate MRSA-infected skin wounds. Biomed. Pharmacother. 2023, 165, 115017. [Google Scholar] [CrossRef] [Scilit]
- Thapa, R.K.; Diep, D.B.; Tønnesen, H.H. Topical antimicrobial peptide formulations for wound healing: Current developments and future prospects. Acta Biomater. 2020, 103, 52–67. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sousa, M.G.C.; Rezende, T.M.B.; Franco, O.L. Nanofibers as drug-delivery systems for antimicrobial peptides. Drug Discov. Today 2021, 26, 2064–2074. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Díez, J.M.; Bauman, E.; Gajardo, R.; Jorquera, J.I. Culture of human mesenchymal stem cells using a candidate pharmaceutical grade xeno-free cell culture supplement derived from industrial human plasma pools. Stem Cell Res. Ther. 2015, 6, 28. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Liang, C.C.; Park, A.Y.; Guan, J.L. In vitro scratch assay: A convenient and inexpensive method for analysis of cell migration in vitro. Nat. Protoc. 2007, 2, 329–333. [Google Scholar] [CrossRef] [Scilit] [PubMed]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).



