ijms-logo

Journal Browser

Journal Browser

Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0

A special issue of International Journal of Molecular Sciences (ISSN 1422-0067). This special issue belongs to the section "Molecular Toxicology".

Deadline for manuscript submissions: closed (20 February 2025) | Viewed by 25242

Special Issue Editors


E-Mail Website
Guest Editor
Department of Biological Sciences, National University of Singapore, Singapore 117558, Singapore
Interests: protein chemistry; structure-function relationships; protein–protein interaction; protein design and engineering
Special Issues, Collections and Topics in MDPI journals

Special Issue Information

Dear Colleagues,

In some animals, venoms have appeared as a means of defense and/or as a means of attack/hunting. Venoms may contain components of various chemical nature, commonly referred to as toxins. In the course of evolution, toxins have acquired the ability to selectively and effectively affect certain systems in the organism of the victim or predator. The development of methods for the identification and analysis of the chemical structure of organic compounds leads to the discovery of new toxins, for which it is necessary to establish the mechanisms of action. Moreover, new species of venomous animals are being discovered, for which it is also necessary to establish the molecular mechanisms of venom action. This understanding is very important for the effective treatment of intoxications, which still remain a serious problem in a number of regions of the planet. Currently, the most effective way to treat bites of venomous animals is the use of antisera obtained by immunizing large mammals (mainly horses) with small doses of venom. Although very effective, this method has a number of disadvantages, which requires the development of new treatments based on other molecular mechanisms. Since toxins are highly efficacious and selective for certain biological targets, they can serve as templates for drug development. Thus, the study of the molecular mechanisms of action of animal venoms, their toxins and new antitoxins is a very important task. The purpose of this Special Issue is to present the state of the art in the study of the molecular mechanisms underlying the action of animal venoms, their components and antitoxins.

Research articles, review articles as well as short communications are invited.

Please note that, for IJMS papers, theoretical studies should offer new insights into the understanding of experimental results or suggest new experimentally testable hypotheses.

Prof. Dr. Yuri N. Utkin
Prof. Dr. R. Manjunatha Kini
Guest Editors

Manuscript Submission Information

Manuscripts should be submitted online at www.mdpi.com by registering and logging in to this website. Once you are registered, click here to go to the submission form. Manuscripts can be submitted until the deadline. All submissions that pass pre-check are peer-reviewed. Accepted papers will be published continuously in the journal (as soon as accepted) and will be listed together on the special issue website. Research articles, review articles as well as short communications are invited. For planned papers, a title and short abstract (about 250 words) can be sent to the Editorial Office for assessment.

Submitted manuscripts should not have been published previously, nor be under consideration for publication elsewhere (except conference proceedings papers). All manuscripts are thoroughly refereed through a single-blind peer-review process. A guide for authors and other relevant information for submission of manuscripts is available on the Instructions for Authors page. International Journal of Molecular Sciences is an international peer-reviewed open access semimonthly journal published by MDPI.

Please visit the Instructions for Authors page before submitting a manuscript. There is an Article Processing Charge (APC) for publication in this open access journal. For details about the APC please see here. Submitted papers should be well formatted and use good English. Authors may use MDPI's English editing service prior to publication or during author revisions.

Keywords

  • venom
  • toxin
  • antitoxin
  • antivenom
  • neurotoxin
  • cytotoxin
  • hemotoxin
  • conotoxin
  • snake
  • scorpion
  • spider

Benefits of Publishing in a Special Issue

  • Ease of navigation: Grouping papers by topic helps scholars navigate broad scope journals more efficiently.
  • Greater discoverability: Special Issues support the reach and impact of scientific research. Articles in Special Issues are more discoverable and cited more frequently.
  • Expansion of research network: Special Issues facilitate connections among authors, fostering scientific collaborations.
  • External promotion: Articles in Special Issues are often promoted through the journal's social media, increasing their visibility.
  • Reprint: MDPI Books provides the opportunity to republish successful Special Issues in book format, both online and in print.

Further information on MDPI's Special Issue policies can be found here.

Published Papers (10 papers)

Order results
Result details
Select all
Export citation of selected articles as:

Editorial

Jump to: Research, Review, Other

5 pages, 648 KB  
Editorial
The Need for and Importance of Thorough and Comprehensive Studies on the Molecular Mechanisms of Action of Animal Toxins, Venoms, and Antivenoms
by R. Manjunatha Kini and Yuri N. Utkin
Int. J. Mol. Sci. 2025, 26(22), 11007; https://doi.org/10.3390/ijms262211007 - 13 Nov 2025
Viewed by 358
Abstract
Many species of animals are commonly referred to as venomous, as they can produce special secretions known as venoms for defense and/or attack/hunting [...] Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

Research

Jump to: Editorial, Review, Other

20 pages, 3670 KB  
Article
Discovery of a Novel Anticoagulant Cystine Knot Peptide from Spider Venom Gland Transcriptome
by Jinai Gao, Di Yang, Wanting Wang, Xiaoshan Huang, Ruiyin Guo, Kaixun Cao, Qiumin Lu, Ziyi Wang, Ren Lai and Juan Li
Int. J. Mol. Sci. 2025, 26(20), 10154; https://doi.org/10.3390/ijms262010154 - 19 Oct 2025
Cited by 1 | Viewed by 766
Abstract
The development of effective anticoagulants remains a critical need in modern medicine, particularly for preventing and treating thromboembolic disorders, such as arterial thrombosis and deep vein thrombosis (DVT), as well as complications like ischemic stroke. This study identifies a cysteine-knotted peptide GC38 (sequence: [...] Read more.
The development of effective anticoagulants remains a critical need in modern medicine, particularly for preventing and treating thromboembolic disorders, such as arterial thrombosis and deep vein thrombosis (DVT), as well as complications like ischemic stroke. This study identifies a cysteine-knotted peptide GC38 (sequence: GCSGKGARCAPSKCCSGLSCGRHGGNMYKSCEWNWKTG) derived from the venom gland transcriptome of the Macrothele sp. spider, which exerts thrombus-inhibitory effects by potentiating activated protein C (APC) activity. In vitro assays reveal that GC38 enhances APC activity, prolongs plasma clotting time, and shows no significant cytotoxicity or hemolytic activity. Mechanistically, GC38 interacts allosterically with APC; biolayer interferometry (BLI) confirms this direct interaction, with a dissociation constant KD of 6.16 μM. Additionally, three in vivo thrombosis models (FeCl3-induced arterial occlusion, stasis-induced DVT, and cortical photothrombotic stroke) consistently demonstrated that GC38 was effective in alleviating thrombus formation, with tail-bleeding assays confirming its low hemorrhagic risk. Collectively, our findings position GC38 as a pioneering spider venom-derived lead molecule that addresses dual arterial and venous antithrombotic actions. This opens new avenues for developing spider venom-derived peptides as therapeutic agents targeting intravascular coagulation in arteries and veins. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Graphical abstract

16 pages, 5613 KB  
Article
Cobra Three-Finger Toxins Interact with RNA and DNA: Nucleic Acids as Their Putative Biological Targets
by Alexey V. Osipov, Vladislav G. Starkov, Victor I. Tsetlin and Yuri N. Utkin
Int. J. Mol. Sci. 2025, 26(9), 4291; https://doi.org/10.3390/ijms26094291 - 1 May 2025
Cited by 1 | Viewed by 1167
Abstract
Three-finger toxins (TFTs), including neurotoxins and cytotoxins, form one of the largest families of snake venom proteins and interact with various biological targets. Neurotoxins target proteinaceous receptors while cytotoxins interact mainly with the lipids of cell membranes and to a lesser extent with [...] Read more.
Three-finger toxins (TFTs), including neurotoxins and cytotoxins, form one of the largest families of snake venom proteins and interact with various biological targets. Neurotoxins target proteinaceous receptors while cytotoxins interact mainly with the lipids of cell membranes and to a lesser extent with carbohydrates. However, no data about the interaction of TFTs with nucleic acids can be found. To detect this interaction, we applied spectrophotometry, ion-paired HPLC and electrophoretic mobility shift assay (EMSA). Using spectrophotometry, we found that TFTs from cobra venom increased the optical density of an RNA solution in a time-dependent manner indicating toxin interaction with RNA. A decrease in the net negative charge of the RNA molecule upon interaction with neurotoxin II from cobra venom was revealed by ion-pair HPLC. EMSA showed decreased electrophoretic mobility of both RNA and DNA upon addition of different TFTs including the non-conventional cobra toxin WTX and water-soluble recombinant human three-finger protein lynx1. We suggest that the interaction with nucleic acids may be a common property of TFTs, and some biological effects of TFTs, for example, cytotoxin-induced apoptosis in cancer cell lines, may be mediated by interaction with nucleic acids. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

28 pages, 7774 KB  
Article
A Russian Doll of Resistance: Nested Gains and Losses of Venom Immunity in Varanid Lizards
by Uthpala Chandrasekara, Marco Mancuso, Lorenzo Seneci, Lachlan Bourke, Dane F. Trembath, Joanna Sumner, Christina N. Zdenek and Bryan G. Fry
Int. J. Mol. Sci. 2024, 25(5), 2628; https://doi.org/10.3390/ijms25052628 - 23 Feb 2024
Cited by 3 | Viewed by 7003
Abstract
The interplay between predator and prey has catalyzed the evolution of venom systems, with predators honing their venoms in response to the evolving resistance of prey. A previous study showed that the African varanid species Varanus exanthematicus has heightened resistance to snake venoms [...] Read more.
The interplay between predator and prey has catalyzed the evolution of venom systems, with predators honing their venoms in response to the evolving resistance of prey. A previous study showed that the African varanid species Varanus exanthematicus has heightened resistance to snake venoms compared to the Australian species V. giganteus, V. komodoensis, and V. mertensi, likely due to increased predation by sympatric venomous snakes on V. exanthematicus. To understand venom resistance among varanid lizards, we analyzed the receptor site targeted by venoms in 27 varanid lizards, including 25 Australian varanids. The results indicate an active evolutionary arms race between Australian varanid lizards and sympatric neurotoxic elapid snakes. Large species preying on venomous snakes exhibit inherited neurotoxin resistance, a trait potentially linked to their predatory habits. Consistent with the ‘use it or lose it’ aspect of venom resistance, this trait was secondarily reduced in two lineages that had convergently evolved gigantism (V. giganteus and the V. komodoensis/V. varius clade), suggestive of increased predatory success accompanying extreme size and also increased mechanical protection against envenomation due to larger scale osteoderms. Resistance was completely lost in the mangrove monitor V. indicus, consistent with venomous snakes not being common in their arboreal and aquatic niche. Conversely, dwarf varanids demonstrate a secondary loss at the base of the clade, with resistance subsequently re-evolving in the burrowing V. acanthurus/V. storri clade, suggesting an ongoing battle with neurotoxic predators. Intriguingly, within the V. acanthurus/V. storri clade, resistance was lost again in V. kingorum, which is morphologically and ecologically distinct from other members of this clade. Resistance was also re-evolved in V. glebopalma which is terrestrial in contrast to the arboreal/cliff dwelling niches occupied by the other members of its clade (V. glebopalma, V. mitchelli, V. scalaris, V. tristis). This ‘Russian doll’ pattern of venom resistance underscores the dynamic interaction between dwarf varanids and Australian neurotoxic elapid snakes. Our research, which included testing Acanthophis (death adder) venoms against varanid receptors as models for alpha-neurotoxic interactions, uncovered a fascinating instance of the Red Queen Hypothesis: some death adders have developed more potent toxins specifically targeting resistant varanids, a clear sign of the relentless predator–prey arms race. These results offer new insight into the complex dynamics of venom resistance and highlight the intricate ecological interactions that shape the natural world. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

18 pages, 2114 KB  
Article
Acetylcholine-Binding Protein Affinity Profiling of Neurotoxins in Snake Venoms with Parallel Toxin Identification
by Giulia Palermo, Wietse M. Schouten, Luis Lago Alonso, Chris Ulens, Jeroen Kool and Julien Slagboom
Int. J. Mol. Sci. 2023, 24(23), 16769; https://doi.org/10.3390/ijms242316769 - 26 Nov 2023
Cited by 4 | Viewed by 3115
Abstract
Snakebite is considered a concerning issue and a neglected tropical disease. Three-finger toxins (3FTxs) in snake venoms primarily cause neurotoxic effects since they have high affinity for nicotinic acetylcholine receptors (nAChRs). Their small molecular size makes 3FTxs weakly immunogenic and therefore not appropriately [...] Read more.
Snakebite is considered a concerning issue and a neglected tropical disease. Three-finger toxins (3FTxs) in snake venoms primarily cause neurotoxic effects since they have high affinity for nicotinic acetylcholine receptors (nAChRs). Their small molecular size makes 3FTxs weakly immunogenic and therefore not appropriately targeted by current antivenoms. This study aims at presenting and applying an analytical method for investigating the therapeutic potential of the acetylcholine-binding protein (AChBP), an efficient nAChR mimic that can capture 3FTxs, for alternative treatment of elapid snakebites. In this analytical methodology, snake venom toxins were separated and characterised using high-performance liquid chromatography coupled with mass spectrometry (HPLC-MS) and high-throughput venomics. By subsequent nanofractionation analytics, binding profiling of toxins to the AChBP was achieved with a post-column plate reader-based fluorescence-enhancement ligand displacement bioassay. The integrated method was established and applied to profiling venoms of six elapid snakes (Naja mossambica, Ophiophagus hannah, Dendroaspis polylepis, Naja kaouthia, Naja haje and Bungarus multicinctus). The methodology demonstrated that the AChBP is able to effectively bind long-chain 3FTxs with relatively high affinity, but has low or no binding affinity towards short-chain 3FTxs, and as such provides an efficient analytical platform to investigate binding affinity of 3FTxs to the AChBP and mutants thereof and to rapidly identify bound toxins. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

23 pages, 4028 KB  
Article
Comparative Biochemical, Structural, and Functional Analysis of Recombinant Phospholipases D from Three Loxosceles Spider Venoms
by Hanna Câmara da Justa, Jorge Enrique Hernández González, Larissa Vuitika, Ricardo Barros Mariutti, Pedro Augusto Martinho Magnago, Fábio Rogério de Moraes, Andrea Senff-Ribeiro, Luiza Helena Gremski, Raghuvir Krishnaswamy Arni and Silvio Sanches Veiga
Int. J. Mol. Sci. 2023, 24(15), 12006; https://doi.org/10.3390/ijms241512006 - 26 Jul 2023
Cited by 4 | Viewed by 2809
Abstract
Spiders of Loxosceles genus are widely distributed and their venoms contain phospholipases D (PLDs), which degrade phospholipids and trigger inflammatory responses, dermonecrosis, hematological changes, and renal injuries. Biochemical, functional, and structural properties of three recombinant PLDs from L. intermedia, L. laeta, and [...] Read more.
Spiders of Loxosceles genus are widely distributed and their venoms contain phospholipases D (PLDs), which degrade phospholipids and trigger inflammatory responses, dermonecrosis, hematological changes, and renal injuries. Biochemical, functional, and structural properties of three recombinant PLDs from L. intermedia, L. laeta, and L. gaucho, the principal species clinically relevant in South America, were analyzed. Sera against L. gaucho and L. laeta PLDs strongly cross-reacted with other PLDs, but sera against L. intermedia PLD mostly reacted with homologous molecules, suggesting underlying structural and functional differences. PLDs presented a similar secondary structure profile but distinct melting temperatures. Different methods demonstrated that all PLDs cleave sphingomyelin and lysophosphatidylcholine, but L. gaucho and L. laeta PLDs excelled. L. gaucho PLD showed greater “in vitro” hemolytic activity. L. gaucho and L. laeta PLDs were more lethal in assays with mice and crickets. Molecular dynamics simulations correlated their biochemical activities with differences in sequences and conformations of specific surface loops, which play roles in protein stability and in modulating interactions with the membrane. Despite the high similarity, PLDs from L. gaucho and L. laeta venoms are more active than L. intermedia PLD, requiring special attention from physicians when these two species prevail in endemic regions. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

15 pages, 2107 KB  
Article
New Insights into Immunopathology Associated to Bothrops lanceolatus Snake Envenomation: Focus on PLA2 Toxin
by Joel J. M. Gabrili, Giselle Pidde, Fabio Carlos Magnoli, Rafael Marques-Porto, Isadora Maria Villas-Boas, Carla Cristina Squaiella-Baptistão, Felipe Silva-de-França, François Burgher, Joël Blomet and Denise V. Tambourgi
Int. J. Mol. Sci. 2023, 24(12), 9931; https://doi.org/10.3390/ijms24129931 - 9 Jun 2023
Cited by 7 | Viewed by 2279
Abstract
The systemic increase in inflammatory mediator levels can induce diverse pathological disorders, including potentially thrombus formation, which may be lethal. Among the clinical conditions in which the formation of thrombi dictates the patient’s prognosis, envenomation by Bothrops lanceolatus should be emphasized, as it [...] Read more.
The systemic increase in inflammatory mediator levels can induce diverse pathological disorders, including potentially thrombus formation, which may be lethal. Among the clinical conditions in which the formation of thrombi dictates the patient’s prognosis, envenomation by Bothrops lanceolatus should be emphasized, as it can evolve to stroke, myocardial infarction and pulmonary embolism. Despite their life-threatening potential, the immunopathological events and toxins involved in these reactions remain poorly explored. Therefore, in the present study, we examined the immunopathological events triggered by a PLA2 purified from B. lanceolatus venom, using an ex vivo human blood model of inflammation. Our results showed that the purified PLA2 from the venom of B. lanceolatus damages human erythrocytes in a dose dependent way. The cell injury was associated with a decrease in the levels of CD55 and CD59 complement regulators on the cell surface. Moreover, the generation of anaphylatoxins (C3a and C5a) and the soluble terminal complement complex (sTCC) indicates that human blood exposure to the toxin activates the complement system. Increased production of TNF-α, CXCL8, CCL2 and CCL5 followed complement activation. The venom PLA2 also triggered the generation of lipid mediators, as evidenced by the detected high levels of LTB4, PGE2 and TXB2. The scenario here observed of red blood cell damage, dysfunctions of the complement regulatory proteins, accompanied by an inflammatory mediator storm, suggests that B. lanceolatus venom PLA2 contributes to the thrombotic disorders present in the envenomed individuals. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

Review

Jump to: Editorial, Research, Other

43 pages, 3650 KB  
Review
Snake Toxins Affecting Blood Vessel Walls: Mode of Action and Biological Significance
by Alexey V. Osipov and Yuri N. Utkin
Int. J. Mol. Sci. 2025, 26(19), 9439; https://doi.org/10.3390/ijms26199439 - 26 Sep 2025
Cited by 1 | Viewed by 1150
Abstract
One of the main targets for snake venoms in animal and human organisms is the circulatory system. Mechanisms of circulatory system injury within the victim’s body include, among others, the direct effect of snake toxins on structures in blood vessel walls. The interaction [...] Read more.
One of the main targets for snake venoms in animal and human organisms is the circulatory system. Mechanisms of circulatory system injury within the victim’s body include, among others, the direct effect of snake toxins on structures in blood vessel walls. The interaction of a toxin with cells and the extracellular matrix of the vessel wall may manifest as cytotoxicity, leading to cell death by necrosis or apoptosis, and damage to vascular wall structures. Such interactions may increase capillary permeability, promoting hemorrhage or edema, and may also induce alterations in vascular tone, resulting in changes in blood pressure. Snake toxins may also affect the growth, function, and regenerative ability of the endothelium, thus modulating angiogenesis; some toxins exert protective or anti-atherosclerotic effects. Toxins interacting with the vasculature may be classified as enzymes (phospholipases A2, metalloproteinases, L-amino acid oxidases, and hyaluronidases), proteins without enzymatic activity (vascular endothelial growth factors, disintegrins, C-type lectins and snaclecs, three-finger toxins, etc.), peptides (bradykinin-potentiating peptides, natriuretic peptides, sarafotoxins), and low-molecular-weight substances. This review summarizes the data on the vascular effects, particularly on the blood vessel wall, exhibited by various classes and groups of snake toxins. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

19 pages, 3519 KB  
Review
Plant-Derived Lapachol Analogs as Selective Metalloprotease Inhibitors Against Bothrops Venom: A Review
by Paulo A. Melo, Pâmella Dourila Nogueira-Souza, Mayara Amorim Romanelli, Marcelo A. Strauch, Marcelo de Oliveira Cesar, Marcos Monteiro-Machado, Fernando Chagas Patrão-Neto, Sabrina R. Gonsalez, Nilton Ghiotti Siqueira, Edgar Schaeffer, Paulo R. R. Costa and Alcides J. M. da Silva
Int. J. Mol. Sci. 2025, 26(9), 3950; https://doi.org/10.3390/ijms26093950 - 22 Apr 2025
Viewed by 1525
Abstract
Plant compounds that inhibit snake venom activities are relevant and can provide active molecules to counteract snake venom effects. Numerous studies on snake viperid venoms found that metalloproteinases play a significant role in the pathophysiology of hemorrhage that occurs on envenomation. Preclinical studies [...] Read more.
Plant compounds that inhibit snake venom activities are relevant and can provide active molecules to counteract snake venom effects. Numerous studies on snake viperid venoms found that metalloproteinases play a significant role in the pathophysiology of hemorrhage that occurs on envenomation. Preclinical studies using vitro and in vivo protocols investigated natural compounds and viperid snake venoms, evaluating the enzymatic, procoagulant, hemorrhagic, edematogenic, myotoxic, and lethal activities. Many studies focused on Bothrops venoms and ascribed that angiorrhexis and hemorrhage resulted from the metalloproteinase action on collagen in the basal lamina. This effect resulted in a combined action with phospholipase A2 and hyaluronidase, inducing hemorrhage, edema, and necrosis. Due to the lack of efficient antivenoms in remote areas, traditional native plant treatments remain common, especially in the Amazon. Our group studied plant extracts, isolated compounds, and lapachol synthetic derivative analogs with selective inhibition for Bothrops venom proteolytic and hemorrhagic activity and devoid of phospholipase activity. We highlight those new synthetic naphthoquinones which inhibit snake venom metalloproteinases and that are devoid of other venom enzyme inhibition. This review shows the potential use of snake venom effects, mainly Bothrops venom metalloproteinase activity, as a tool to identify and develop new active molecules against hemorrhagic effects. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

Other

12 pages, 992 KB  
Hypothesis
Sodium Channel β Subunits—An Additional Element in Animal Tetrodotoxin Resistance?
by Lorenzo Seneci and Alexander S. Mikheyev
Int. J. Mol. Sci. 2024, 25(3), 1478; https://doi.org/10.3390/ijms25031478 - 25 Jan 2024
Cited by 3 | Viewed by 4003
Abstract
Tetrodotoxin (TTX) is a neurotoxic molecule used by many animals for defense and/or predation, as well as an important biomedical tool. Its ubiquity as a defensive agent has led to repeated independent evolution of tetrodotoxin resistance in animals. TTX binds to voltage-gated sodium [...] Read more.
Tetrodotoxin (TTX) is a neurotoxic molecule used by many animals for defense and/or predation, as well as an important biomedical tool. Its ubiquity as a defensive agent has led to repeated independent evolution of tetrodotoxin resistance in animals. TTX binds to voltage-gated sodium channels (VGSC) consisting of α and β subunits. Virtually all studies investigating the mechanisms behind TTX resistance have focused on the α subunit of voltage-gated sodium channels, where tetrodotoxin binds. However, the possibility of β subunits also contributing to tetrodotoxin resistance was never explored, though these subunits act in concert. In this study, we present preliminary evidence suggesting a potential role of β subunits in the evolution of TTX resistance. We gathered mRNA sequences for all β subunit types found in vertebrates across 12 species (three TTX-resistant and nine TTX-sensitive) and tested for signatures of positive selection with a maximum likelihood approach. Our results revealed several sites experiencing positive selection in TTX-resistant taxa, though none were exclusive to those species in subunit β1, which forms a complex with the main physiological target of TTX (VGSC Nav1.4). While experimental data validating these findings would be necessary, this work suggests that deeper investigation into β subunits as potential players in tetrodotoxin resistance may be worthwhile. Full article
(This article belongs to the Special Issue Molecular Mechanisms of Animal Toxins, Venoms and Antivenoms 2.0)
Show Figures

Figure 1

Back to TopTop