Next Article in Journal
Exploratory Study of the Phase IV Immunization Schedule of Quadrivalent Influenza Split-Virion Vaccine in Children Aged 3–8 Years
Previous Article in Journal
Differential Immune Response Patterns Induced by Anionic and Cationic Lipid Adjuvants in Intranasal Anti-Influenza Immunization
Previous Article in Special Issue
Factors Associated with Treatment Prescription to Pulmonary Tuberculosis Contacts in Catalonia (2019–2021): A Population-Based Epidemiological Study
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Bioinformatic, Biochemical, and Immunological Mining of MHC Class I Restricted T Cell Epitopes for a Marburg Nucleoprotein Microparticle Vaccine

1
Vagelos College of Physicians and Surgeons, Columbia University, New York, NY 10032, USA
2
Flow Pharma Inc., Warrensville Heights, OH 44128, USA
3
Cleveland Medical Center, University Hospitals, Cleveland, OH 44106, USA
*
Authors to whom correspondence should be addressed.
Vaccines 2024, 12(3), 322; https://doi.org/10.3390/vaccines12030322
Submission received: 19 January 2024 / Revised: 26 February 2024 / Accepted: 15 March 2024 / Published: 18 March 2024
(This article belongs to the Special Issue Recent Vaccine Development for Emerging Infectious Diseases)

Abstract

The Marburg virus (MARV), the virus responsible for Marburg hemorrhagic fever (MHF), is considered a top-priority pathogen for vaccine development. Recent outbreaks in Equatorial Africa have highlighted the urgency of MARV because of its high fatality rate and historical concerns about potential weaponization. Currently, there are no licensed vaccines for MARV. Existing vaccine candidates rely on attenuated recombinant vesicular stomatitis virus carrying MARV glycoprotein (VSVΔG) or the chimpanzee replication-defective adenovirus 3 vector ChAd3-MARV. Although these platforms provide significant protection in animal models, they face challenges because of their limited thermal stability and the need for cold storage during deployment in resource-poor areas. An alternative approach involves using adjuvanted poly (lactic-co-glycolic acid) (PLGA) microparticles loaded with synthetic peptides representing MHC class I—restricted T cell epitopes. This vaccine platform has demonstrated effectiveness in protecting against SARS-CoV-2 and EBoV disease in animal models and has the advantage of not requiring cold storage and remaining stable at room temperature for over six months. This report outlines the design, manufacturing, and in vivo immunogenicity testing of PLGA microparticle human vaccines designed to prevent Marburg hemorrhagic fever.

Graphical Abstract

1. Introduction

The Centers for Disease Control Strategic Planning Workgroup has recently classified several hemorrhagic fever viruses (HFVs), including the Marburg virus, as Category A pathogens. Category A signifies that preparedness, including vaccine development, is of utmost priority [1]. This designation stems from two critical factors: the exponential significant rise in human infections originating from their zoonotic reservoirs and their potential for use as biological weapons [2].
Meadows and colleagues conducted a recent survey on zoonotic outbreaks and mortality caused by human pathogens, including those from the Coronaviridae, Filoviridae, Arenaviridae, and Paramyxoviridae families [3]. The number of outbreaks and deaths caused by these viral pathogens collectively increased exponentially from 1963 to 2019. Highlighting this unease is the recent outbreak (February 2023) of MARV hemorrhagic fever in Equatorial Guinea [4]. Of further concern is that many of these viruses (a) can be disseminated via aerosol and are infectious at low doses; (b) have no currently available or feasibly deployable vaccines [5]; and (c) have been previously researched for use as biological weapons [1,5,6,7,8].
Viral hemorrhagic fever (VHF) is a clinical syndrome marked by a sudden onset of fever and nonspecific symptoms, progressing to septic shock and often resulting in bleeding disorders [9]. Over 25 viruses from four viral families are known to cause VHFs, including Lassa, Junín, Crimean–Congo hemorrhagic fever, Rift Valley fever, yellow fever, Ebola (EBoV), and MARV. These viruses pose a significant threat because of their high rates of illness and mortality [10], coupled with a limited understanding of hemorrhagic fever syndrome [11].
The Marburg virus, the first recognized filovirus, was identified in 1967 among laboratory workers reporting symptoms of hemorrhagic fever in Marburg, Germany [12]. All infected workers had contact with materials from African green monkeys, resulting in 32 cases and an overall mortality rate of 23% [13]. In the community setting, Marburg hemorrhagic fever may spread between people via direct contact through broken skin or mucous membranes with the blood, secretions, organs, or other bodily fluids of infected people and with surfaces and materials such as bedding and clothing contaminated with these fluids [14]. Following exposure, MARV enters the body, replicates intracellularly (preferentially in monocytes, dendritic cells, and endothelial cells [15]), disseminates, and leads to a clinical syndrome comprising an Ebola-like cytokine storm [16,17,18], fever, malaise, myalgia, and blood coagulation disorders [2]. These symptoms progress to shock, multiorgan failure, and death, with a case fatality rate ranging from 20–100% [10].
Unlike Ebola VHFs [19], there are no licensed vaccines or therapeutics for Marburg virus outbreaks [20]. While MARV vaccine candidates are in clinical and preclinical testing, they rely on platforms such as attenuated recombinant vesicular stomatitis virus carrying the viral glycoprotein (VSVΔG) [21,22] or the chimpanzee replication-defective adenovirus 3 vector ChAd3-MARV [23,24]. These viral vector vaccine platforms efficiently induce robust protective antibody responses [25], but they face challenges such as cost and limited thermal stability [26,27].
Controlled-release poly (lactic-co-glycolic acid) (PLGA) microparticles loaded with synthetic peptides corresponding to immunogenic epitopes found in pathogens [28,29,30,31,32,33,34,35,36] and tumor cells [37,38,39,40] are a vaccine platform of emerging interest [41,42]. The manufacture and characterization of the PLGA microparticles used in the current study have been previously described in detail [29,30,32,36,37]. Briefly, a PLGA solution containing MHC class I and MHC class II-restricted synthetic peptide immunogens and the toll-like receptor 9 (TLR-9) oligonucleotide agonist CpG (ODN-1018) adjuvant was spray-dried to form microparticles with an average diameter of 6 μm. The microparticles were delivered in a saline-DMSO vehicle containing the toll-like receptor 4 (TLR-4) agonist monophosphoryl-lipid A (MPLA) adjuvant. In-house studies have revealed that the CpG and peptide content of the microparticles are structurally stable for more than six months when stored at room temperature, suggesting that this vaccine platform may be ideal for deployment in infrastructure-poor or conflict zones around the globe.
The design rationale for the selection of MHC class I and MHC class II-restricted peptide immunogens in this platform has focused on the following: (a) inclusion of peptide immunogens previously reported to be targets of human T cell responses, (b) toward peptides corresponding to structurally conserved, low mutational variability protein targets, and (c) inclusion of a diverse set of potential peptide immunogens capable of binding to multiple MHC molecules such that the final vaccine formulation can induce T cell responses across a wide swath of MHC molecules expressed by the world population (>85%). In preclinical testing, we found that microparticle vaccine formulations following these design guidelines conferred protection from disease to 100% of the virally challenged cohort in (a) a murine model of EBoV [32] and (b) a rhesus model of Severe acute respiratory syndrome coronavirus 2 (SARS-CoV2) [30]. Following microparticle vaccination and challenge with SAR-CoV2, macaque subjects remained pneumonia-free; however, viral titers were significant, suggesting that induction of CD8+ T cell immunity was protective but not sterilizing, unlike many of their virally delivered recombinant whole protein counterparts [43,44,45].
In this study, we discuss the development, production, and preclinical testing of a vaccine composed of adjuvanted microparticles containing immunogenic T cell epitopes derived from the MARV nucleoprotein. Recently, the Marburg proteome was screened to identify potential immunogenic epitopes that bind to human MHC molecules. However, previous reports have focused solely on bioinformatics and in silico screening studies [46,47,48,49,50,51,52,53,54,55,56,57] for human MHC molecules. Our contribution involves a bioinformatics analysis of potential immunogenic T cell epitopes specific to human MHC class I (i.e., HLA–A and B) and Cynomolgus MHC class I (Mafa MHC–A). In addition, we provide an in vitro biochemical characterization of the MHC binding strength of these peptides to their respective restriction elements. Our workflow provides a path to identifying T cell epitopes where currently available immunoinformatic tools are limited.
Despite the challenges associated with the limited availability of non-human primates (NHPs) [58], we obtained a cohort of Cynomolgus monkeys (Macaca fascicularis) from a colony with limited MHC diversity for in vivo/ex vivo testing of the immunogenicity of these nucleoprotein derived peptides. The peptides were delivered in vivo using the microparticle vaccine platform, and the T cell immunogenic potential of these peptides was assessed ex vivo with an interferon γ ELISpot assay. We found that the MARV nucleoprotein can be “mined” by bioinformatics and biochemical characterization of peptide binding to MHC molecules for primate immunogenic T cell epitopes, some of which may be suitable for inclusion in a thermostable MARV synthetic peptide T cell microparticle vaccine.

2. Materials and Methods

2.1. Immunoinformatics

2.1.1. Protein Sequence Variability/Shannon Entropy Scores

Multiple amino acid sequences in the fasta format of the MARV nucleoprotein (n = 204, 90 from Los Alamos National Laboratories (LANL), 34 from Swiss-Prot (UniProtKB), 80 from the National Center for Biotechnology Information (NCBI)), including nucleoprotein sequences obtained from sampling the zoonotic host and patients with MHF disease across both equatorial Africa as well as MARV laboratory stocks. Similar data for MARV Glycoprotein (n = 135) and MARV matrix protein (VP40) (n = 98) were also downloaded from the LANL, UniProtKB, and NCBI databases. Multiple sequence alignments for MARV nucleoprotein, envelope glycoprotein, and VP40 were obtained using the online web tool Clustal Omega (http://www.clustal.org/ accessed on 6 December 2023) and the Shannon entropy plots (where the range varies from 0 to 4.32, and the domain is the length in amino acids of the protein) in Figure 1 were calculated using the Clustal Omega alignments at the PVS server (http://imed.med.ucm.es/PVS/ accessed on 6 December 2023) [59,60].

2.1.2. Antigenicity Predictions

The VaxiJen antigenicity model is a computational tool designed to predict protein and peptide antigenicity. It employs an artificial neural network that has been trained on a database containing examples of both antigens and non-antigens. Using an alignment-independent approach, VaxiJen uses characteristics such as hydrophobicity, size, charge, and aromaticity of amino acids within the primary sequence of the query protein to predict antigenicity. The predicted antigenicity of all seven MARV structural proteins was assessed using the VaxiJen v2.0 server (http://www.ddg-pharmfac.net/vaxijen/ accessed on 6 December 2023) [61]. The empirical threshold of a score of 0.4 was used to determine whether a protein or peptide might or might not be antigenic.

2.1.3. In Silico MHC Class I Restricted T Cell Epitope Prediction

As the reference amino acid sequence for microparticle T cell Marburg vaccine development, we selected the ABE27012.1 nucleoprotein amino acid sequence from the laboratory MARV Angola strain [62]. Although we originally planned to study peptide immunogenicity in a rhesus NHP model, at the time of the study, no rhesus macaques were available [63,64]. Instead, we were able to secure a small cohort of Mauritian Cynomolgus macaques (Macaca fascicularis) (n = 4) sharing the Mafa-A1*063:01 or Mafa-A1*063:02 MHC class I genotype. The IEDB T cell epitope prediction server [65] allows the input of the amino acid sequence of the Mafa-A63:01 or Mafa-A63:02 MHC class I molecules (accession number AY958100.2) for use in T cell epitope predictions. The output from the Immune Epitope Database (IEDB) server, using the Marburg nucleoprotein sequence and the Mafa-A63 MHC class I sequence, is a ranked list of approximately 690 nine-mer peptides. Because suboptimal anchor residues in the peptide can cause instability of peptide-MHC-I complexes, to further limit this list, we took advantage of an additional published MHC peptide binding motif based on the elution and sequencing of peptides bound to Mafa-A63:02 MHC class I molecules [66]. The IEDB list of peptides was further prioritized by ranking the IEDB list according to the published peptide binding motif of Mafa-A63:02 MHC class I molecules, giving a higher score to nine-mer peptides having P in the P2 position and F or W in the P9 position [66]. The final list of potential MARV nucleoprotein-Mafa A63 binding peptides is given in Appendix A Table A1. To this list, we added the following: (a) three T cell epitopes peptides whose immunogenicity was known to be restricted to the Mafa-A*063:02 MHC class I gene [67,68,69], bore the above Mafa-A63 peptide binding motif, and corresponded to sequences within simian immunodeficiency virus (SIV) envelop protein or the SIV Negative Factor (NEF) transcription factor; (b) several potential MARV T cell epitopes that did not contain the above Mafa-A63 MHC class I peptide binding motif but scored high in the original IEDB predicted T cell epitope list and had possible binding affinity (<2000 nM) to human class I MHC molecules (HLA); and (c) several MARV, EBoV, HIV, or SIV nine-mer peptides that did not carry the Mafa-A63:02 MHC class I peptide binding motif and were predicted to have little to no Mafa-A63:02 binding affinity. The predicted affinity of binding to several HLA class I molecules for peptides in Appendix A Table A1 was also characterized at the IEDB server.

2.2. Biochemical Characterization of Peptide Binding to Mafa-A63 MHC Class I Molecules

2.2.1. Peptide Synthesis, MHC Class I Peptide Binding Affinity, and Stabilization Assays

Peptides were synthesized (Peptides International, Louisville, KY, USA, InnoPep, San Diego, CA, USA and JPT Peptide Technologies GmbH, Berlin, Germany) by standard 9-fluorenylmethyloxycarbonyl (FMOC) chemistry, purified by reversed-phase high-performance liquid chromatography (>95% purity), and the correct sequence was confirmed by mass spectrometry.
The interactions of these peptides with Mafa-A63:02 MHC class I molecules were determined using a previously described biochemical binding assay [70] for measurements of peptide MHC class I binding affinity. Briefly, the Mafa-A1*063:02 MHC I allele was amplified by reverse transcription polymerase chain reaction, cloned, and sequence validated (The European Nucleotide Archive (ENA) accession AY958100.2) as previously described [70,71]. The Mafa-A1:063:02 heavy chain sequence was mutated to remove the cytosolic and transmembrane regions, and biotin acceptor sequences were added at the C-terminus of the heavy chain, as previously described [72]. The induced expression of Mafa- A1:063:02 heavy chain (HC) or beta 2 microglobulin (β2M) was performed in the Escherichia coli expression host BL21 (DE3), HC harvested as inclusion bodies, extracted into a urea buffer, purified by gel filtration, and biotinylated as previously described [73]. Next, measurements of MHC class I peptide complex binding affinity [70] were performed in a refolding assay. Purified urea-denatured Mafa-A63 heavy chains were diluted 100-fold into a buffer containing β2M and varying concentrations (5 × 10−3 to 5 × 104 nM) of the test peptide. Each peptide was assayed at least two to three times in the refolding assay. Complexes were allowed to form for 24 h at 18 °C and then captured on a W632 mAb-coated enzyme-linked immunosorbent assay (ELISA) plate, washed, and captured complexes were detected with a polyclonal anti β2M—horseradish peroxidase (HRP) conjugated antibody. Once developed, the colorimetric reaction was read at 450 nm (OD450) using an ELISA plate reader. The OD450 data versus peptide concentration data were fitted to a four-parameter logistic (4PL) nonlinear regression model using a web-based tool (https://mycurvefit.com/ accessed on 6 December 2023), and the peptide concentration at half-maximal folding, equivalent to the Kd for peptide-Mafa-A63 MHC class I binding, was extracted from the estimated regression equation. The estimated Kd measurements are the mean of two to three refolding assays. The MHC class I peptide stability assay was performed as previously reported [74] with modifications. Refolded test peptide-Mafa A63 MHC class I—β2M complexes were captured via their biotin tag on ELISA plates, incubated in 0, 2, 4, and 6 M urea for 2 h at 18 °C, and then detected with W632 as described above. The stability challenge outcome measure, rather than the half-life of peptide-Mafa A63 MHC class I complexes incubated at 37 °C, was calculated as the average yield (OD450) of stable peptide-Mafa A63 MHC class I—β2M complexes incubated in the presence of four concentrations of the urea chaotrope minus the associated background relative to the stability of the reference Mafa-A063 binding SIV-NEF peptide, RPKVPLRTM, and expressed as a percentage.
The affinity binding data (as OD450) for all peptides was then percentile ranked, and the stability of the MHC complexes for each peptide, expressed as a percent, was combined in a data frame (66 × 9 elements) and submitted to Morpheus (https://software.broadinstitute.org/morpheus accessed on 6 December 2023) for dimension reduction by t-distributed stochastic neighbor embedding (t-SNE) and ranked by the t-SNE T2 axis for grouping of peptides by similarity of binding to Mafa-A063 MHC Class I binding.
From the list of peptides in Appendix A Table A1, we selected 16 nine-mer, 1 eight-mer, and 3 ten-mer peptides with IEDB-predicted HLA binding affinity < 600 nM (Appendix A Table A2). The binding affinity of each of these peptides to HLA class I molecules was measured in a classical competition assay. The set of 29 HLA class I molecules used in this assay is given in Appendix A Table A3. Each peptide was tested for its capacity to bind to the corresponding predicted HLA class I allele(s). Additional molecules of HLA alleles of interest were selected for binding studies with each candidate peptide if the predicted binding affinity was <2000 nM. The purification of MHC molecules for binding studies by affinity chromatography and the competition assay was performed as detailed elsewhere [75]. In brief, varying concentrations of candidate test peptide and 0.1–1 nM of a radiolabeled reference peptide were co-incubated at room temperature or 37 °C with purified HLA molecules in the presence of a cocktail of protease inhibitors. Following a 2- to 4-day incubation, HLA molecule-bound radioactivity was determined by capturing MHC/peptide complexes on mAb W6/32- or B123.2-coated Lumitrac 600 plates (Greiner Bio-one, Frickenhausen, Germany) and measuring bound cpm using the TopCount (Packard Instrument Co., Meriden, CT, USA) microscintillation counter. The concentration of peptide yielding 50% inhibition of binding of the radiolabeled peptide was calculated. Under the conditions utilized, where [label] < [MHC] and IC50 ≥ [MHC], the measured IC50 values are reasonable approximations of true Kd. Each competitor peptide was tested at six different concentrations covering a 100,000-fold range in three or more independent experiments. As a positive control, the unlabeled version of the radiolabeled probe was also tested in each experiment.

2.2.2. Preparation of Adjuvanted MARV Microspheres for In Vivo Studies

The selection of peptides representing potential MARV T cell epitopes was based on the Mafa-A063 binding affinity and stability (Appendix A Table A2), with priority given to peptide sequences carrying the published peptide binding motif of Mafa-A063 MHC class I molecules [66] and the highest measured affinity/stability. As a second criterion, we selected two additional peptides that demonstrated high binding activity to human HLA class I molecules (Figure 2). The amino acid sequences of the MARV peptides selected for in vivo testing are given in Appendix A Table A4. Additional peptides could not be selected because of our limitations in the total number of peptides that could be tested in vivo.
The peptide epitopes used in this study were delivered in vivo by intramuscular injection of a formulation of PLGA microspheres containing the corresponding synthetic nine-mer peptides and the TLR-9 agonist CpG oligonucleotide adjuvant in a vehicle containing the TLR-4 agonist monophosphoryl lipid A (MPLA). The rationale for choosing the delivery platform and the basic manufacturing scheme used in production has been previously described [29,30,32,36,37]. In brief, room-temperature solutions of synthetic peptide (Appendix A Table A4) and CpG oligonucleotide were mixed with a solution of PLGA in acetone. A second batch of microspheres was prepared as above but with the addition of two additional peptides, ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ (TpD) [76] and QYIKANSKFIGITEL (TT830-844) [77], which are reported to be promiscuous MHC class II-binding T helper (Th) epitopes in Cynomolgus macaques.
The formulation was then processed using a precision spray-drying device (GEA, Columbia, MD, USA) and passed through a nitrogen gas-filled drying chamber at 65 °C to allow evaporation of the acetone. The dry microsphere stream was analyzed in real-time using a laser particle size analyzer (SprayTech, Malvern Instruments, Malvern, PA, USA) before collection (Buchi cyclone dryer) as a dry powder. The microsphere powder was admixed with mannose and hypromellose as resuspension aids. At the time of delivery, a diluent containing oleic acid, 2% dimethylsulfoxide (DMSO), and MPLA (20 μg/mL) in an aqueous buffer was used to reconstitute the microsphere formulation. Each microsphere contained peptide loaded at approximately 0.1% by weight and CpG 0.01% by weight. Monitoring the microsphere diameters allowed the production of microspheres with a mean diameter of 10 ± 2 microns. This diameter was selected for formulation to ensure delivery to antigen presenting cells (APC) via phagocytosis of no more than 1–4 microspheres per cell, which have average diameters of 13 microns. GMP manufacturing protocols were employed using GMP grade synthetic peptides (Peptides International, Louisville, Kentucky, USA, InnoPep, San Diego, CA, USA and JPT Peptide Technologies GmbH, Berlin, Germany), GMP grade CpG oligodeoxynucleotides (Trilink Biosciences, San Diego, CA, USA), and GMP grade MPLA (Avanti Polar Lipids, Alabaster, AL, USA). The CpG oligonucleotide and MPLA used in this study were manufactured using the same chemical compositions as the equivalent materials used in FDA-approved vaccines. Assessment of the thermal stability of the synthetic peptides within the microspheres has been previously reported [36]. The peptide content and structure in microspheres were determined by high-performance liquid chromatography after two months of room-temperature storage. We found that over 99% of the peptide was structurally intact.

2.3. In Vivo Experiments

Mauritian Cynomolgus macaques were selected for testing because of their well-characterized MHC immunogenetics [78]. Macaques were obtained from the testing facility holding pool of Worldwide Primates (Miami, FL, USA). Before shipping, peripheral blood samples were obtained from a cohort of 26 macaques and shipped to the Wisconsin National Primate Research Center for MHC class I and class II typing as previously described [79]. From the MHC Class I typing data, we selected four macaques (3 males/1 female, 3–4 years old, and 2–6 kg) sharing the MHC class I genotype Mafa-A1*063:01 or Mafa-A1*063:02 genotype. In vivo testing of MARV microsphere immunogenicity was performed at AmplifyBio (West Jefferson, OH, USA).

2.3.1. Animal Care and Housing

General procedures for animal care and housing met AAALAC International recommendations (AAALAC unit # 000446), current requirements stated in the “Guide for the Care and Use of Laboratory Animals” (National Research Council, Current Edition), and current requirements as stated by the US. Department of Agriculture through the Animal Welfare Act, as amended, and conformed to the applicable testing facility SOP. Prior to study initiation, the study design was reviewed and approved by the Institutional Animal Care and Use Committee (IACUC).
Animals were socially housed during the study. The temperature and humidity ranges of the study room were set to maintain 74 ± 10 °F and 50 ± 20%, respectively. The light cycle was set to maintain 12 h on/12 h off. Animals were provided with fresh water ad libitum and PMI Certified Primate Diet (LabDiet 5048) twice daily, except during specified fasting periods or when the animal was away from its home cage for study events (e.g., when placed in restraint chairs for dose administrations and blood collections). The diet was also supplemented with fresh fruits, vegetables, or other supplemental enrichment (e.g., manipulatives). Animals were fasted, as appropriate, for sedation.

2.3.2. MARV Microsphere Immunization

Macaques were vaccinated according to the schedule shown in Table 1. Peripheral blood sampling was scheduled before vaccination but under the same session of intramuscular (IM) Ketamine-induced sedation (5–20 mg/kg). Microsphere vaccine formulations were suspended in the diluent to deliver 20 mg/mL of microspheres. Sedated macaques received IM injections of vaccine to both right and left (1 mL each) thigh muscles and one arm (1 mL). Macaques received four weekly injections of MARV vaccine microspheres, followed by three additional doses of MARV microspheres supplemented with the TpD and TT830–844 peptides, on days 84, 110, and 150. Between MARV microsphere dosing and the last MARV boost doses, macaques received four IM doses (0.5 mL at 2.5 mg/0.5 mL) on (days 63, 81, 110, and 150) of a human use approved Diphtheria and tetanus toxoids and Acellular Pertussis vaccine (TDaP, Adacel, Sanofi-Pasteur, Inc., Bridgewater, NJ, USA).

2.3.3. ELISpot Assays

Femoral vein peripheral blood (4–6 mL) was collected from each animal into a BD Vacutainer® K2EDTA tube (Becton, Dickinson and Company, Franklin Lakes, NJ, USA), diluted 1:2 with Hanks buffered salt solution (HBSS), and processed by buoyant density centrifugation using Lymphoprep density gradient medium diluted 9 parts medium plus 1 part HBSS to obtain peripheral blood mononuclear cells (PBMCs). Collected macaque PBMCs were washed in HBSS and diluted to 2.5 × 106 cells/mL in complete growth medium (CGM) (i.e., Gibco RPMI 1640 high glucose medium, HEPES, Glutamax, supplemented with 10% fetal bovine serum, non-essential amino acids, sodium pyruvate, and antibiotics) and then assessed for MARV peptide immunoreactivity using an ELISpot assay. In brief, ELISpot assay plates (MabTech Inc., Cincinnati, OH, USA) specific for the detection of primate IFN γ were used according to the manufacturer’s instructions. Diluted PBMC cells were dispensed (100 µL/well) into a 96-well plate that had been pre-plated using an automated liquid handler (Opentrons, Queens, NY, USA) under sterile filtered air flow. One hundred µL of CGM alone (negative control), Phytohemagglutinin-A/L (PHA-L) in CGM at 5 µg/mL (positive control), MARV peptides (Appendix A Table A4) at 10–20 g/mL, tetanus toxoid (positive control) (List laboratories, Campbell, CA, USA) at 2 g/mL, or tetanus peptide (positive control) (TT830–844) at 10 g/mL were added. Peptides used for macaque microsphere immunization were added to the wells at a concentration of 10 g/mL. All samples were assayed in duplicate. Plates were incubated at 37 °C/5% CO2 for 36–48 h, after which plates were thoroughly washed. The conjugated detection antibody was then added and incubated, followed by additional washing. Wells were developed using 3,3′,5,5′-tetramethylbenzidine as the substrate. Counts were performed at the Cellular Technology Limited Corporation (Shaker Heights, OH, USA) using an S6 Entry M2 immunospot analyzer (CTL, Shaker Heights, OH, USA), and all well images were quality-controlled on-site. All spot-forming cell counts reported are the result of averaging counts from the duplicate wells. PBMC-peptide immunoreactivity was considered to be positive if the average number of spot-forming cells (SPC) per million plated PBMC of the duplicate wells was greater than or equal to two times the average of its corresponding control well with CGM but no peptide. A one-sided t-test for the duplicate wells was <0.05 relative to all the control wells (complete growth medium alone wells, n = 8) on the ELISpot plate.

3. Results and Discussion

3.1. Immunoinformatic Screening of Marburg Proteins: Shannon Sequence Variability and Antigenicity Predictions

The calculated Shannon sequence variability scores for proteins are well correlated with structural entropy and are considered a metric of the compositional stability and packing density of proteins in solution. Protein domains with lower packing density and higher local flexibility have increased Shannon variability scores and are associated with higher mutation and structural variability [80,81]. Conversely, low sequence variability in a protein region suggests that this region is essential for protein function, making it less likely to mutate without compromising the fitness of the virus [82]. The Shannon variability or entropy metric has been frequently used in the design of vaccines for HIV [83] and SARS-CoV-2 [30].
We analyzed the Shannon entropy scores for different proteins of MARV, specifically the nucleoprotein, glycoprotein, and matrix proteins. We calculated the average Shannon sequence variability score across the entire length of each protein (Figure 1). Our findings showed that the MARV nucleoprotein amino acid sequences, as sourced from databases, exhibited lower sequence variability than the MARV matrix protein and envelope glycoprotein.
As a second-level triage, we examined the predicted antigenicity of the seven MARV structural proteins (Table 2). While all the MARV proteins scored as possibly antigenic (score > 0.4), based on the low mutational probability predicted by the Shannon sequence variability score and our previous successful experiences with the SARS-CoV2 and EBoV nucleoprotein as the viral target molecule [30,32], we decided to focus on identifying potential T cell epitopes within the MARV nucleoprotein.

3.2. Immunoinformatic Screening of Marburg Proteins: Prediction of Mafa–A063 T Cell Epitopes

The output from the IEDB server, using the Marburg nucleoprotein sequence and the Mafa-A063 MHC class I sequence as input, is a ranked list of approximately 690 nine-mer peptides. These potential T cell epitopes were next ranked by the published peptide binding motif of Mafa-A63:02 MHC class I molecules, giving a higher score to nine-mer peptides having P in the P2 position and F or W in the P9 position [66]. To this list, we added both positive and negative control peptides to aid in the physical characterization of the binding of these peptides to both Mafa–A063 molecules and several alleles of HLA class I molecules to obtain a set of 66 peptides (Appendix A Table A1).

3.3. MARV Peptide Binding to Mafa-A063 and HLA Class I Molecules

The in vitro binding and stability of the 66 peptides to Mafa-A063 MHC class I molecules are summarized in Figure 2. We observed that both MARV test peptides and reference peptides, carrying the expected peptide binding motif of Mafa-A063, generally showed the highest binding affinity and stability relative to other MARV peptides lacking the P2-proline pattern. We also observed several moderate-to-high-affinity binding peptides to human HLA class I molecules, three of which shared the Mafa-A063 peptide-binding motif. We ranked the test peptides using a combination of both measured binding affinity and stability to obtain a set of peptides that would be most suitable for in vivo immunogenicity testing based on a set of three reference peptides whose immunogenicity was known to be restricted to the Mafa-A*063:02 MHC class I gene [67,68,69]. These synthetic peptides (Appendix A Table A2) were incorporated into adjuvanted PLGA microspheres and tested in vivo for their ability to evoke a T cell response in the Cynomolgus primate model.

3.4. In Vivo Immunogenicity Testing of MARV Peptide-Containing Microspheres in Cynomolgus Macaques Carrying the Mafa–A1*063 MHC Class I Allele

Four macaques were administered four weekly IM injections of MARV peptide-containing microspheres (100 mg microsphere formulation total dose/week), and the T cell response was studied using ELISpot (Figure 3, Panel A). Peripheral T cell immunoreactivity to MARV peptides was detected in all four macaques, but the pattern and range of immunoreactivity toward the challenge peptide varied widely between macaques. Macaque ELISpot signal strengths as SFC/million cells were similar to those of previous single peptide studies in primates [84]; however, we did observe that some ELISpot responses appeared, then disappeared, only to appear again during the study. The waxing and waning of T cell IFN γ responses during longitudinal studies of T cell reactivity has been previously reported [85,86,87] and is consistent with T effector cell differentiation and migration from the peripheral circulation into the tissue to become resident T memory cells [88].
Unlike most humans, cynomolgus macaques do not receive TDaP vaccination as part of their routine veterinary care. To induce an anti-tetanus toxoid Th cell response, macaques were administered four doses of TDaP vaccine (the only NHP-approved vaccine containing tetanus toxoid) starting on day 63. Microspheres containing MARV peptides and tetanus toxoid T helper cell epitopes (TpD and TT830–844) were used in the boost phase of vaccination that started on day 84 of the experiment. We reasoned that the inclusion of Th epitopes in the MARV vaccine microspheres might enhance the CD8+ T cell responses to the MARV T cell epitopes presented by APC through the provision of CD4+T cell help. Although vaccination with tetanus toxoid, either as whole protein or long synthetic peptides, did elicit an anti-tetanus T cell IFN γ response as visualized by the ELISpot assay (tox and TT, Figure 3), it is not clear from our study whether the provision of Th epitopes in the microsphere vaccine had an effect on the in vivo anti-MARV peptide MHC class I restricted T cell response.
One workaround to the apparent lack of MHC class II-restricted T helper activity provided by the TpD and TT (830–844) peptides would be to substitute them with MHC class II T helper epitopes from the Marburg proteins themselves (e.g., MARV glycoprotein) as suggested by the protective efficacy of viral vector vaccines delivering both MARV nucleoprotein and glycoprotein [89]. Current immunoinformatic tools, however, are not tailored to the prediction of peptide binding affinities for mafa-MHC Class II molecules, and epitope predictions must be based on the homologies of the mafa MHC class II molecules to their human or rhesus counterparts. Examples of these “best guess” mafa-MHC class II binding epitopes are listed in Appendix A Table A4.
The set of peptides selected for in vivo testing were selected for high affinity and stable binding to Mafa-A063 MHC class I molecules because efficient MHC class I binding is a necessary but not sufficient condition of immunogenicity [74,90]. All the selected MARV peptides tested were found to evoke MARV peptide-specific peripheral T cell IFNγ secretory responses, consistent with previous reports [91], but in disagreement with the predicted immunogenicity of the set of peptides predicted by the VaxiJen model (Appendix A Table A5). This discordance may be attributable to insufficient training of the model on immunogenic epitopes in the Cynomolgus model. We further note that despite the genetic similarities at the MHC Class I locus of the macaque study cohort, the pattern of T cell responses between probands was dissimilar, probably attributable to other genetic influences (e.g., genes associated with antigen processing and presentation or MHC Class I expression or T Cell receptors) lying both within and outside the MHC.
Several reverse vaccinology or immunoinformatic (in silico only) studies of Marburg structural proteins have been recently published [46,47,48,49,50,51,52,53,54,55,56,57]. The bulk of these studies limited their characterization of potential T cell epitopes to the envelope glycoproteins, VP 24 matrix protein, VP30 transcription factor, VP35 polymerase cofactor, and VP matrix protein of MARV [46,51,56,57]. However, two studies reported on potential HLA class I or class II-restricted T cell epitopes within the MARV nucleoprotein [49,55]. Sami et al. [55] reported on two potentially HLA-B*08:01 restricted T cell epitopes, one of which is common to our list of peptides studied for binding to Mafa-A063 molecules (high-affinity binding). Baral et al. [49] also characterized potential MARV nucleoprotein-derived HLA Class I restricted T cell epitopes. They identified 12 potential HLA class I restricted T cell epitopes based on predicted HLA binding by the IEDB server, of which four peptides overlapped with the potential T cell epitopes characterized in our study (Appendix A Table A1). Three of these peptides, YPQLSAIAL, GLYPQLSAI, and LEHGLYPQL, showed high affinity binding to soluble HLA molecules in our studies (Appendix A Table A2).

4. Conclusions

Systemic vaccination of Cynomolgus Macaques with a Venezuelan equine encephalitis virus replicon carrying MARV nucleoprotein has demonstrated only partial success in providing protection against MARV challenge [89]. Our main goal has been to develop a vaccine to protect against Marburg hemorrhagic fever disease that offers unique advantages (detailed in Appendix A Table A6) not available in existing Marburg vaccines currently being tested in clinical trials [92,93]. These advantages included (a) the ability to distribute the vaccine without the need for refrigeration, removing the dependency on cold storage logistics; (b) the absence of animal products in its composition, making it compliant with halal standards [94]; and (c) being deliverable to the mucosa and potentially suitable for multiple dosing via an inhalation route [95,96]. This report represents an intermediate step, a preclinical study in a NHP model, towards that objective.
We characterized the in vivo immunogenicity of a set of potential T cell epitopes within the MARV nucleoprotein, predominantly carrying the Mafa-A63 peptide binding motif (i.e., proline in the P2 position and, to a lesser extent, phenylalanine, tryptophan, or leucine in the P9 position). The Mafa-A63 peptide binding motif [66] and the HLA-B07:02 peptide binding motif [97] are very similar at the P2 and P9 positions. One peptide (AL9) carrying this motif was found to be immunogenic in the context of Mafa-A063 (Figure 2) and demonstrated in vitro binding activity to HLA-B07:02 molecules, as was predicted in silico. There were several other potential MARV T cell epitopes that were demonstrated to bind to HLA-B07:02 as well as other HLA class I molecules, but they were not studied in vitro because of poor Mafa-A063 class I molecule—peptide complex stability.
The provision of tetanus toxoid-based MHC class II-restricted peptide epitopes in the microsphere vaccine did not clearly enhance the mafa-MHC class I-restricted T cell responses to the MARV nucleoprotein peptide epitopes. In future iterations of the microsphere vaccine, substitution of the tetanus peptide epitopes with MHC Class II binding epitopes from other MARV proteins (e.g., envelop glycoprotein) is indicated. The value of these potential MARV MHC class I and class II-restricted T cell epitopes toward the construction of a human T cell epitope vaccine for protection against Marburg virus infection awaits further validation.

Author Contributions

Conceptualization, P.E.H., S.B., C.V.H. and R.M.R.; methodology, P.E.H., S.B., and C.V.H.; software, P.E.H. and S.B.; validation, P.E.H. and S.B.; formal analysis, P.E.H. and S.B.; investigation, P.E.H., S.B., R.M.R. and C.V.H.; data curation, P.E.H. and S.B.; writing—original draft preparation, P.E.H.; writing—review and editing, P.E.H., S.B., C.V.H. and R.M.R.; visualization, P.E.H.; supervision and project administration, P.E.H. and S.B.; funding acquisition, R.M.R. All authors have read and agreed to the published version of the manuscript.

Funding

This material is based upon work supported by the US Army Contracting Command—Aberdeen Proving Ground—Natick Contracting Division under Contract No. W911QY-18-P-0298 and Con-tract No. W911QY-20-C-0057.

Institutional Review Board Statement

Prior to study initiation, the study design was reviewed and approved by the Institutional Animal Care and Use Committee (IACUC), approval #A06366.

Informed Consent Statement

Not applicable.

Data Availability Statement

The data presented in this study are available on request from the corresponding author.

Acknowledgments

The Mafa-A063 MHC class I test peptide affinity and stability measurements were performed under contract by Immunitrack, ApS (Copenhagen Ø, Denmark), the HLA class I test peptide affinity measurements were performed under contract at the La Jolla Institute for Immunology (La Jolla, CA, USA), and the in vivo testing of vaccine microspheres was performed under contract at AmplifyBio (Columbus, OH, USA).

Conflicts of Interest

R.M.R., S.B., P.E.H. and C.V.H. are employees of Flow Pharma, Inc., compensated in cash and stock, and are named inventors on various issued and pending patents assigned to Flow Pharma. Some of these pending patents are directly related to the study presented here. The United States Department of Defense consulted with Flow Pharma in the design of several experiments.

Appendix A

Table A1. Synthetic peptide sequences used in binding and stability assays.
Table A1. Synthetic peptide sequences used in binding and stability assays.
NumberPeptide
Sequence
IEDB Focused on the Mafa-A63 Peptide Binding MotifIEDB High Binding Score Rank without MotifMafa-A063 Positive or Negative Control Peptide
1APFARVLNLX
2APHVRNKKVX
3APQEDTRARX
4DPFALLNEDX
5DPFGSIGDVX
6DPIQHPAVSX
7DPTPVEVTVX
8EPHYSPLILX
9EPIRSPSSPX
10EPPRQSQDIX
11HPAVSSQDPX
12HPLVRTSKVX
13IPEPPRQSQX
14IPNEPHYSPX
15IPSTTSREFX
16KPFLRYQELX
17KPTAPHVRNX
18LPKLVVGDRX
19LPPPPLYAQX
20LPPPVDSKIX
21LPPVQEDDEX
22NPPESLITAX
23NPVSAKELQX
24PPESLITALX
25PPLYAQEKRX
26PPPLYAQEKX
27PPPPLYAQEX
28PPPVDSKIEX
29PPRQSQDIDX
30PPVDSKIEHX
31PPVQEDDESX
32QPGSDNEQGX
33RPINRPTALX
34RPTALPPPVX
35SPDFTNYEDX
36SPIAKYLRDX
37SPLILALKTX
38SPSAPQEDTX
39SPSSPSAPQX
40TPVEVTVQAX
41WPDMSFDERX
42WPQRVVTKKX
43YPNDLLQTNX
44YPNHWLTTGX
45YPQLSAIALX
46EVASFKQAL X
47GEYAPFARV X
48GLYPQLSAI X
49HYSPLILAL X
50KVKNEVASF X
51LEHGLYPQL X
52LIVKTVLEF X
53QLSAIALGV X
54TRFSGLLIV X
55TVLEFILQK X
56VGQTRFSGL X
57RPKQAWCWF Control HIV ENV peptide with a motif
59FLSFCSLFL Negative Control-Low IEDB rank
60LFLSFCSLF Negative Control-Low IEDB rank
61LYPQLSAIAL Negative Control-Low IEDB rank
62QTRFSGLLIV Negative Control-Low IEDB rank
63LSFCSLFLPK Negative Control-Low IEDB rank Control
64LLIVKTVL Negative control reference: EBOV NP (8 mer)
58RPKVPLRTM Positive control reference SIV NEF [69]
65GPRKPIKCW Positive control reference–SIV GP [67]
66HPAQTSQW Positive control reference: SIV NEF [68]
Notes: HIV ENV, Human immunodeficiency virus envelope protein, EBOV NP, Ebola virus nucleoprotein, SIV GP, Simian immunodeficiency virus glycoprotein, SIV NEF Simian immunodeficiency virus-negative regulatory factor.
Table A2. Synthetic peptides incorporated into PLGA microspheres.
Table A2. Synthetic peptides incorporated into PLGA microspheres.
NumberPeptide SequenceIEDB-Predicted Binding Allele and Affinity (nM)Measured Affinity as IC50 (nM)IEDB-Predicted Binding Allele and Affinity (nM)Measured Affinity as IC50 (nM)IEDB-Predicted Binding Allele and Affinity (nM)Measured Affinity as IC50 (nM)
1APFARVLNLHLA-B*07:02–320.21HLA-B*08:01–287 67
2HPLVRTSKVHLA-B*07:02–87 HLA-B*08:01–268
3YPQLSAIALHLA-B*07:02–1544HLA-B*08:01–48117
4EVASFKQALHLA-A*26:01–57486HLA-A*68:02 12.7HLA-B*07:02250
5GEYAPFARVHLA-B*40:01–145107HLA-B*44:02214
6GLYPQLSAIHLA-A*02:01–185.9HLA-A*02:031.4HLA-A*02:066.9
7HYSPLILALHLA-A*24:02–19064HLA-B*23:013.5
8KVKNEVASFHLA-B*15:01–325.6HLA-A*32:012.9HLA-A*30:02158
9LEHGLYPQLHLA-B*40:01–2314HLA-B*44:023.4
10LIVKTVLEFHLA-B*15:01–260.80HLA-A*23:01109
11QLSAIALGVHLA-A*02:01–283.9HLA-A*02:03
HLA-A*02:06
4.4
12
HLA-A*32:01
HLA-A*68:02
81
11
12TRFSGLLIVHLA-B*27:05–116 HLA-B*39:015–344
13TVLEFILQKHLA-A*03:01–6419HLA-A*11:01
HLA-A*68:01
2.2HLA-A*30:01365
14VGQTRFSGLHLA-B*08:01–442
15FLSFCSLFLHLA-A*02:01–41.8HLA-A*02:0329HLA-A*02:06121
16LFLSFCSLFHLA-A*24:02–98633HLA-A*23:0133
17LYPQLSAIALHLA-A*24:02 −148179HLA-B*07:02–120134HLA-A*24:02179
18QTRFSGLLIVHLA-B*27:05–600533HLA-A*30:01421HLA-B*15:014682
19LSFCSLFLPKHLA-A*03:01–384.3HLA-A*11:01
HLA-A*30:01
0.68
238
HLA-A*31:01
HLA-A*68:01
686
1.0
20LLIVKTVLHLA-B*08:01–1796.1
Notes: Where no predicted affinity measurements are given, the result to the right is the actual measured affinity as IC50 from the competition assay.
Table A3. Mafa MHC class I binding peptides tested for binding to HLA Class I molecules.
Table A3. Mafa MHC class I binding peptides tested for binding to HLA Class I molecules.
Peptides from Appendix A Table A2 Tested against the HLA AllelePeptides Tested# of. Binders
A*01:0110
A*02:0153
A*02:0373
A*02:0693
A*03:0122
A*11:0122
A*23:0144
A*24:0232
A*26:0131
A*30:0143
A*30:0211
A*31:0120
A*32:0143
A*33:0130
A*68:0132
A*68:0252
B*07:0275
B*08:0174
B*15:0173
B*27:0521
B*35:0181
B*39:0100
B*40:0122
B*44:0222
B*44:0320
B*51:0150
B*53:0150
B*57:0110
B*58:0131
Table A4. Potential Mauritian Cynomolgus macaque MHC class II binding T helper epitopes from MARV envelope glycoprotein (GP).
Table A4. Potential Mauritian Cynomolgus macaque MHC class II binding T helper epitopes from MARV envelope glycoprotein (GP).
Peptide SequenceIDDRB1_0104 1DRB1_0901DRB1_1602DRB5_0101
CorenMCorenMCorenMCorenM
QYIKANSKFIGITELTet 830–844YIKANSKFI27YIKANSKFI13YIKANSKFI13YIKANSKFI17
VADSPLEASKRWAFRTGVPPKNVEYTE 2,3GP 59–85FRTGVPPKN122FRTGVPPKN LEASKRWAF85WAFRTGVPP165FRTGVPPKN46
FISLILIQGIKTLPILEIASNNQPQNGP 7–32IKTLPILEI19IKTLPILEI IQGIKTLPI62IKTLPILEI55IQGIKTLPI ILEIASNNQ117
RVFTEGNIAAMIVNKTVHKMIFSRQ 4GP 158–182IAAMIVNKT69IAAMIVNKT286IAAMIVNKT223MIVNKTVHK114
Notes: 1 Using HLA-DRB1*04 (the closest human homolog to mafa-DRB*w501 of the H1 haplotype of Mauritian Cynomolgus Macaques [98] and the closest human homolog of mafa- DRB1*0402 of the H6 haplotype), HLA-DRB1*09 (the closest human homolog to mafa-DRB1*1001 or mafa-DRB1*1002 of the H2 and H3 haplotype, respectively), HLA-DRB1*16 (the closest human homolog to mafa-DRB4*0101 of the H4 haplotype), and HLA-DRB5*01 (the closest human homolog to mafa-DRB5*0301 of the H5 haplotype), NetPan MHC II web tools were used to predict potential mafa-MHC class II binding peptides. 2 Potential mafa-A63 MHC class I binding epitope within the longer peptide sequence shown in bold text. 3 Also identified as a possible human linear B cell epitope in Ref. [55]. 4 Also identified as a possible human CTL epitope in Ref. [55].
Table A5. VaxiJen prediction of microsphere peptide immunogenicity.
Table A5. VaxiJen prediction of microsphere peptide immunogenicity.
IDPeptide SequenceVaxiJen Score
SD9SPDFTNYED1.31
IQ9IPEPPRQSQ0.156
HP9HPAVSSQDP1.00
LQ9LPPPPLYAQ0.872
TA9TPVEVTVQA1.16
PL9PPESLITAL−0.094
EI9EPPRQSQDI0.482
LE9LPPVQEDDE0.669
EP9EPIRSPSSP−0.484
YN9YPNDLLQTN0.212
KF9KVKNEVASF0.610
AL9APFARVLNL0.6130
RV9RPTALPPPV0.9853
HL9HYSPLILAL1.4600
Notes: VaxiJen scores > 0.4 predicted to be immunogenic are shown in bold text.
Table A6. Unique characteristics of the microsphere vaccine platform relative to recombinant viral vaccines and bare peptide vaccines.
Table A6. Unique characteristics of the microsphere vaccine platform relative to recombinant viral vaccines and bare peptide vaccines.
AdvantagesLimitations
Cost-Effectiveness: Readily synthesized and peptides purified at low cost, making them economically viable. Deployable in areas where ring vaccination strategies might fail. Uses off-the-shelf reagents, simplifying the production process.HLA Type Restriction: Class I MHC restriction limits the relevance of individual peptides to certain HLA types, reducing universality.
Stability: Stable at room temperature for more than six months, ensuring a longer shelf-life. Freedom from cold-chain logistic limitations.Immune Response: T cell immune responses may be transient and/or of low magnitude, potentially impacting long-term efficacy.
Safety: Synthetic peptides have demonstrated safety in many human studies. The controlled-release adjuvanted microsphere–short peptide vaccine used in this study has demonstrated safety in rodent and NHP models.Epitope Diversity: Peptide vaccine may have to include a large number of epitopes to confer disease protection across a wide range of patients.
Specificity and Targeted Delivery: Using defined epitopes avoids uncharacterized antigens that may cause non-therapeutic or autoimmune activity. Microsphere diameter is optimized to target APCs with phagocytic properties and avoids nonprofessional nonphagocytic APCs.Induction of B cell antibody responses:
Currently, there is limited information regarding Ebola or Marburg linear B cell epitopes [48] that might be included in the microspheres to induce an effective antibody response. At present, the microsphere platform is a “T cell vaccine” only.
Monitoring: Known MHC class I and class II epitope sequences enable direct monitoring of T cell responses, enhancing vaccine efficacy assessment.Disease protection vs. Sterilizing immunity: T cell vaccines may not provide sterilizing immune protection, although they may prevent disease
Booster Vaccines: Feasibility of repeated booster vaccines to maintain or enhance immune responses
No anti-vector immune response.
Inaccuracy of T cell epitope prediction methods: Bioinformatic T cell epitope prediction methods fall short of 100% accuracy in the absence of confirmational studies.
Protection: Peptide encapsulation in controlled release PLGA microspheres protects T cell epitopes from extracellular degradation.
Adjuvant Efficacy: Microsphere-encapsulated synthetic adjuvants promote optimal co-stimulation molecule expression by targeted APCs.
Mucosal Delivery: Adjuvanted microspheres are suitable for mucosal surface delivery by inhalation, broadening the application scope.
Compliance with Standards: The Microsphere vaccine platform is animal product-free and conforms to halal standards.

References

  1. CDC Strategic Planning Workgroup. Biological and chemical terrorism: Strategic plan for preparedness and response. Recommendations of the CDC Strategic Planning Workgroup. MMWR Recomm. Rep. 2000, 49, 1–14. [Google Scholar]
  2. Salvaggio, M.R.; Baddley, J.W. Other viral bioweapons: Ebola and Marburg hemorrhagic fever. Dermatol. Clin. 2004, 22, 291–302. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Meadows, A.J.; Stephenson, N.; Madhav, N.K.; Oppenheim, B. Historical trends demonstrate a pattern of increasingly frequent and severe spillover events of high-consequence zoonotic viruses. BMJ Glob. Health 2023, 8, e012026. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. World Health Organization. Marburg Virus Disease—Equatorial Guinea. Available online: https://www.who.int/emergencies/disease-outbreak-news/item/2023-DON472 (accessed on 11 May 2023).
  5. Suschak, J.J.; Schmaljohn, C.S. Vaccines against Ebola virus and Marburg virus: Recent advances and promising candidates. Hum. Vaccines Immunother. 2019, 15, 2359–2377. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  6. Davis, C.J. Nuclear blindness: An overview of the biological weapons programs of the former Soviet Union and Iraq. Emerg. Infect. Dis. 1999, 5, 509–512. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Miller, J.; Broad, W.J.; Engelberg, S. Germs: Biological Weapons and America’s Secret War; Miller, J., Engelberg, S., Broad, W., Eds.; Simon & Schuster: New York, NY, USA, 2001; Volume 323. [Google Scholar]
  8. Borio, L.; Inglesby, T.; Peters, C.J.; Schmaljohn, A.L.; Hughes, J.M.; Jahrling, P.B.; Ksiazek, T.; Johnson, K.M.; Meyerhoff, A.; O’Toole, T.; et al. Hemorrhagic fever viruses as biological weapons: Medical and public health management. JAMA 2002, 287, 2391–2405. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  9. Bausch, D.G.; Ksiazek, T.G. Viral hemorrhagic fevers including hantavirus pulmonary syndrome in the Americas. Clin. Lab. Med. 2002, 22, 981–1020. [Google Scholar] [CrossRef] [Scilit]
  10. Srivastava, D.; Kutikuppala, L.V.S.; Shanker, P.; Sahoo, R.N.; Pattnaik, G.; Dash, R.; Kandi, V.; Ansari, A.; Mishra, S.; Desai, D.N.; et al. The neglected continuously emerging Marburg virus disease in Africa: A global public health threat. Health Sci. Rep. 2023, 6, e1661. [Google Scholar] [CrossRef] [Scilit]
  11. Abir, M.H.; Rahman, T.; Das, A.; Etu, S.N.; Nafiz, I.H.; Rakib, A.; Mitra, S.; Emran, T.B.; Dhama, K.; Islam, A.; et al. Pathogenicity and virulence of Marburg virus. Virulence 2022, 13, 609–633. [Google Scholar] [CrossRef] [Scilit]
  12. Klenk, H.D.; Slenczka, W. Marburg- and Ebolaviruses: A Look Back and Lessons for the Future. In Ebolaviruses: Methods and Protocols; Hoenen, T., Groseth, A., Eds.; Springer: New York, NY, USA, 2017; pp. 3–14. [Google Scholar] [CrossRef] [Scilit]
  13. Slenczka, W.G. The Marburg virus outbreak of 1967 and subsequent episodes. Curr. Top Microbiol. Immunol. 1999, 235, 49–75. [Google Scholar] [CrossRef] [Scilit]
  14. Hunter, N.; Rathish, B. Marburg Fever. In StatPearls; StatPearls: Treasure Island, FL, USA, 2023. [Google Scholar]
  15. Bosio, C.M.; Aman, M.J.; Grogan, C.; Hogan, R.; Ruthel, G.; Negley, D.; Mohamadzadeh, M.; Bavari, S.; Schmaljohn, A. Ebola and Marburg viruses replicate in monocyte-derived dendritic cells without inducing the production of cytokines and full maturation. J. Infect. Dis. 2003, 188, 1630–1638. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  16. Fernando, L.; Qiu, X.; Melito, P.L.; Williams, K.J.; Feldmann, F.; Feldmann, H.; Jones, S.M.; Alimonti, J.B. Immune Response to Marburg Virus Angola Infection in Nonhuman Primates. J. Infect. Dis. 2015, 212 (Suppl. S2), S234–S241. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Prator, C.A.; Dorratt, B.M.; O’Donnell, K.L.; Lack, J.; Pinski, A.N.; Ricklefs, S.; Martens, C.A.; Messaoudi, I.; Marzi, A. Transcriptional profiling of immune responses in NHPs after low-dose, VSV-based vaccination against Marburg virus. Emerg. Microbes Infect. 2023, 12, 2252513. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Rubsamen, R.; Burkholz, S.; Massey, C.; Brasel, T.; Hodge, T.; Wang, L.; Herst, C.; Carback, R.; Harris, P. Anti-IL-6 Versus Anti-IL-6R Blocking Antibodies to Treat Acute Ebola Infection in BALB/c Mice: Potential Implications for Treating Cytokine Release Syndrome. Front. Pharmacol. 2020, 11, 574703. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  19. Woolsey, C.; Geisbert, T.W. Current state of Ebola virus vaccines: A snapshot. PLoS Pathog. 2021, 17, e1010078. [Google Scholar] [CrossRef] [Scilit]
  20. Parish, L.A.; Stavale, E.J.; Houchens, C.R.; Wolfe, D.N. Developing Vaccines to Improve Preparedness for Filovirus Outbreaks: The Perspective of the USA Biomedical Advanced Research and Development Authority (BARDA). Vaccines 2023, 11, 1120. [Google Scholar] [CrossRef] [Scilit]
  21. Geisbert, T.W.; Geisbert, J.B.; Leung, A.; Daddario-DiCaprio, K.M.; Hensley, L.E.; Grolla, A.; Feldmann, H. Single-injection vaccine protects nonhuman primates against infection with marburg virus and three species of ebola virus. J. Virol. 2009, 83, 7296–7304. [Google Scholar] [CrossRef] [Scilit]
  22. Reiter, D. $35.7 Million Awarded for Marburg Virus Vaccine Development. Available online: https://www.precisionvaccinations.com/iavi-rvsv%CE%B4g-marv-gp-marburg-virus-vaccine-candidate (accessed on 15 November 2023).
  23. Hamer, M.J.; Houser, K.V.; Hofstetter, A.R.; Ortega-Villa, A.M.; Lee, C.; Preston, A.; Augustine, B.; Andrews, C.; Yamshchikov, G.V.; Hickman, S.; et al. Safety, tolerability, and immunogenicity of the chimpanzee adenovirus type 3-vectored Marburg virus (cAd3-Marburg) vaccine in healthy adults in the USA: A first-in-human, phase 1, open-label, dose-escalation trial. Lancet 2023, 401, 294–302. [Google Scholar] [CrossRef] [Scilit]
  24. Hunegnaw, R.; Honko, A.N.; Wang, L.; Carr, D.; Murray, T.; Shi, W.; Nguyen, L.; Storm, N.; Dulan, C.N.M.; Foulds, K.E.; et al. A single-shot ChAd3-MARV vaccine confers rapid and durable protection against Marburg virus in nonhuman primates. Sci. Transl. Med. 2022, 14, eabq6364. [Google Scholar] [CrossRef] [Scilit]
  25. McCann, N.; O’Connor, D.; Lambe, T.; Pollard, A.J. Viral vector vaccines. Curr. Opin. Immunol. 2022, 77, 102210. [Google Scholar] [CrossRef] [Scilit]
  26. Berg, A.; Wright, D.; Dulal, P.; Stedman, A.; Fedosyuk, S.; Francis, M.J.; Charleston, B.; Warimwe, G.M.; Douglas, A.D. Stability of Chimpanzee Adenovirus Vectored Vaccines (ChAdOx1 and ChAdOx2) in Liquid and Lyophilised Formulations. Vaccines 2021, 9, 1249. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  27. Toniolo, S.P.; Afkhami, S.; D’Agostino, M.R.; Lichty, B.D.; Cranston, E.D.; Xing, Z.; Thompson, M.R. Spray dried VSV-vectored vaccine is thermally stable and immunologically active in vivo. Sci. Rep. 2020, 10, 13349. [Google Scholar] [CrossRef] [Scilit]
  28. Afley, P.; Dohre, S.K.; Prasad, G.B.; Kumar, S. Prediction of T cell epitopes of Brucella abortus and evaluation of their protective role in mice. Appl. Microbiol. Biotechnol. 2015, 99, 7625–7637. [Google Scholar] [CrossRef] [Scilit]
  29. Cunha-Neto, E.; Rosa, D.S.; Harris, P.E.; Olson, T.; Morrow, A.; Ciotlos, S.; Herst, C.V.; Rubsamen, R.M. An Approach for a Synthetic CTL Vaccine Design against Zika Flavivirus Using Class I and Class II Epitopes Identified by Computer Modeling. Front. Immunol. 2017, 8, 640. [Google Scholar] [CrossRef] [Scilit]
  30. Harris, P.E.; Brasel, T.; Massey, C.; Herst, C.V.; Burkholz, S.; Lloyd, P.; Blankenberg, T.; Bey, T.M.; Carback, R.; Hodge, T.; et al. A Synthetic Peptide CTL Vaccine Targeting Nucleocapsid Confers Protection from SARS-CoV-2 Challenge in Rhesus Macaques. Vaccines 2021, 9, 520. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  31. Heng, W.T.; Lim, H.X.; Tan, K.O.; Poh, C.L. Validation of Multi-epitope Peptides Encapsulated in PLGA Nanoparticles Against Influenza A Virus. Pharm. Res. 2023, 40, 1999–2025. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  32. Herst, C.V.; Burkholz, S.; Sidney, J.; Sette, A.; Harris, P.E.; Massey, S.; Brasel, T.; Cunha-Neto, E.; Rosa, D.S.; Chao, W.C.H.; et al. An effective CTL peptide vaccine for Ebola Zaire Based on Survivors’ CD8+ targeting of a particular nucleocapsid protein epitope with potential implications for COVID-19 vaccine design. Vaccine 2020, 38, 4464–4475. [Google Scholar] [CrossRef] [Scilit]
  33. Hiremath, J.; Kang, K.I.; Xia, M.; Elaish, M.; Binjawadagi, B.; Ouyang, K.; Dhakal, S.; Arcos, J.; Torrelles, J.B.; Jiang, X.; et al. Entrapment of H1N1 Influenza Virus Derived Conserved Peptides in PLGA Nanoparticles Enhances T Cell Response and Vaccine Efficacy in Pigs. PLoS ONE 2016, 11, e0151922. [Google Scholar] [CrossRef] [Scilit]
  34. Nixon, D.F.; Hioe, C.; Chen, P.D.; Bian, Z.; Kuebler, P.; Li, M.L.; Qiu, H.; Li, X.M.; Singh, M.; Richardson, J.; et al. Synthetic peptides entrapped in microparticles can elicit cytotoxic T cell activity. Vaccine 1996, 14, 1523–1530. [Google Scholar] [CrossRef] [Scilit]
  35. Roozbehani, M.; Falak, R.; Mohammadi, M.; Hemphill, A.; Razmjou, E.; Meamar, A.R.; Masoori, L.; Khoshmirsafa, M.; Moradi, M.; Gharavi, M.J. Characterization of a multi-epitope peptide with selective MHC-binding capabilities encapsulated in PLGA nanoparticles as a novel vaccine candidate against Toxoplasma gondii infection. Vaccine 2018, 36, 6124–6132. [Google Scholar] [CrossRef] [Scilit]
  36. Rubsamen, R.M.; Herst, C.V.; Lloyd, P.M.; Heckerman, D.E. Eliciting cytotoxic T-lymphocyte responses from synthetic vectors containing one or two epitopes in a C57BL/6 mouse model using peptide-containing biodegradable microspheres and adjuvants. Vaccine 2014, 32, 4111–4116. [Google Scholar] [CrossRef] [Scilit]
  37. Burkholz, S.R.; Herst, C.V.; Carback, R.T.; Harris, P.E.; Rubsamen, R.M. Survivin (BIRC5) Peptide Vaccine in the 4T1 Murine Mammary Tumor Model: A Potential Neoadjuvant T Cell Immunotherapy for Triple Negative Breast Cancer: A Preliminary Study. Vaccines 2023, 11, 644. [Google Scholar] [CrossRef] [Scilit]
  38. Chen, Q.; Bao, Y.; Burner, D.; Kaushal, S.; Zhang, Y.; Mendoza, T.; Bouvet, M.; Ozkan, C.; Minev, B.; Ma, W. Tumor growth inhibition by mSTEAP peptide nanovaccine inducing augmented CD8(+) T cell immune responses. Drug Deliv. Transl. Res. 2019, 9, 1095–1105. [Google Scholar] [CrossRef] [Scilit]
  39. Herrmann, V.L.; Wieland, D.E.; Legler, D.F.; Wittmann, V.; Groettrup, M. The STEAP1(262-270) peptide encapsulated into PLGA microspheres elicits strong cytotoxic T cell immunity in HLA-A*0201 transgenic mice—A new approach to immunotherapy against prostate carcinoma. Prostate 2016, 76, 456–468. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  40. Ma, W.; Smith, T.; Bogin, V.; Zhang, Y.; Ozkan, C.; Ozkan, M.; Hayden, M.; Schroter, S.; Carrier, E.; Messmer, D.; et al. Enhanced presentation of MHC class Ia, Ib and class II-restricted peptides encapsulated in biodegradable nanoparticles: A promising strategy for tumor immunotherapy. J. Transl. Med. 2011, 9, 34. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  41. Horvath, D.; Basler, M. PLGA Particles in Immunotherapy. Pharmaceutics 2023, 15, 615. [Google Scholar] [CrossRef] [Scilit]
  42. McHugh, K.J.; Nguyen, T.D.; Linehan, A.R.; Yang, D.; Behrens, A.M.; Rose, S.; Tochka, Z.L.; Tzeng, S.Y.; Norman, J.J.; Anselmo, A.C.; et al. Fabrication of fillable microparticles and other complex 3D microstructures. Science 2017, 357, 1138–1142. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  43. Furuyama, W.; Shifflett, K.; Pinski, A.N.; Griffin, A.J.; Feldmann, F.; Okumura, A.; Gourdine, T.; Jankeel, A.; Lovaglio, J.; Hanley, P.W.; et al. Rapid Protection from COVID-19 in Nonhuman Primates Vaccinated Intramuscularly but Not Intranasally with a Single Dose of a Vesicular Stomatitis Virus-Based Vaccine. mBio 2022, 13, e0337921. [Google Scholar] [CrossRef] [Scilit]
  44. Tioni, M.F.; Jordan, R.; Pena, A.S.; Garg, A.; Wu, D.; Phan, S.I.; Weiss, C.M.; Cheng, X.; Greenhouse, J.; Orekov, T.; et al. Mucosal administration of a live attenuated recombinant COVID-19 vaccine protects nonhuman primates from SARS-CoV-2. NPJ Vaccines 2022, 7, 85. [Google Scholar] [CrossRef] [Scilit]
  45. Woolsey, C.; Cross, R.W.; Agans, K.N.; Borisevich, V.; Deer, D.J.; Geisbert, J.B.; Gerardi, C.; Latham, T.E.; Fenton, K.A.; Egan, M.A.; et al. A highly attenuated Vesiculovax vaccine rapidly protects nonhuman primates against lethal Marburg virus challenge. PLoS Neglected Trop. Dis. 2022, 16, e0010433. [Google Scholar] [CrossRef] [Scilit]
  46. Albaqami, F.F.; Altharawi, A.; Althurwi, H.N.; Alharthy, K.M.; Qasim, M.; Muhseen, Z.T.; Tahir Ul Qamar, M. Computational Modeling and Evaluation of Potential mRNA and Peptide-Based Vaccine against Marburg Virus (MARV) to Provide Immune Protection against Hemorrhagic Fever. Biomed. Res. Int. 2023, 2023, 5560605. [Google Scholar] [CrossRef] [Scilit]
  47. Dhasmana, A.; Dhasmana, S.; Alsulimani, A.; Kotnala, S.; Kashyap, V.K.; Haque, S.; Jaggi, M.; Yallapu, M.M.; Chauhan, S.C. In silico CD4 + T-cell multiepitope prediction and HLA distribution analysis for Marburg Virus—A strategy for vaccine designing. J. King Saud Univ. Sci. 2022, 34, 101751. [Google Scholar] [CrossRef] [Scilit]
  48. Babirye, P.; Musubika, C.; Kirimunda, S.; Downing, R.; Lutwama, J.J.; Mbidde, E.K.; Weyer, J.; Paweska, J.T.; Joloba, M.L.; Wayengera, M. Identity and validity of conserved B cell epitopes of filovirus glycoprotein: Towards rapid diagnostic testing for Ebola and possibly Marburg virus disease. BMC Infect. Dis. 2018, 18, 498. [Google Scholar] [CrossRef] [Scilit]
  49. Baral, P.; Pavadai, E.; Zhou, Z.; Xu, Y.; Tison, C.K.; Pokhrel, R.; Gerstman, B.S.; Chapagain, P.P. Immunoinformatic screening of Marburgvirus epitopes and computational investigations of epitope-allele complexes. Int. Immunopharmacol. 2022, 111, 109109. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  50. Debroy, B.; Chowdhury, S.; Pal, K. Designing a novel and combinatorial multi-antigenic epitope-based vaccine “MarVax” against Marburg virus-a reverse vaccinology and immunoinformatics approach. J. Genet. Eng. Biotechnol. 2023, 21, 143. [Google Scholar] [CrossRef] [Scilit]
  51. Hasan, M.; Azim, K.F.; Begum, A.; Khan, N.A.; Shammi, T.S.; Imran, A.S.; Chowdhury, I.M.; Urme, S.R.A. Vaccinomics strategy for developing a unique multi-epitope monovalent vaccine against Marburg marburgvirus. Infect. Genet. Evol. 2019, 70, 140–157. [Google Scholar] [CrossRef] [Scilit]
  52. Mujahed, I.; Mustafa, S.W.S. Next generation multi epitope based peptide vaccine against Marburg Virus disease combined with molecular docking studies. Inform. Med. Unlocked 2022, 33, 101087. [Google Scholar] [CrossRef] [Scilit]
  53. Pervin, T.; Oany, A.R. Vaccinomics approach for scheming potential epitope-based peptide vaccine by targeting l-protein of Marburg virus. In Silico Pharmacol. 2021, 9, 21. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Mahmud, S.M.N.; Rahman, M.; Kar, A.; Jahan, N.; Khan, A. Designing of an Epitope-Based Universal Peptide Vaccine against Highly Conserved Regions in RNA Dependent RNA Polymerase Protein of Human Marburg Virus: A Computational Assay. Anti Infect Agents 2020, 18, 294–305. [Google Scholar] [CrossRef] [Scilit]
  55. Sami, S.A.; Marma, K.K.S.; Mahmud, S.; Khan, M.A.N.; Albogami, S.; El-Shehawi, A.M.; Rakib, A.; Chakraborty, A.; Mohiuddin, M.; Dhama, K.; et al. Designing of a Multi-epitope Vaccine against the Structural Proteins of Marburg Virus Exploiting the Immunoinformatics Approach. ACS Omega 2021, 6, 32043–32071. [Google Scholar] [CrossRef] [Scilit]
  56. Soltan, M.A.; Abdulsahib, W.K.; Amer, M.; Refaat, A.M.; Bagalagel, A.A.; Diri, R.M.; Albogami, S.; Fayad, E.; Eid, R.A.; Sharaf, S.M.A.; et al. Mining of Marburg Virus Proteome for Designing an Epitope-Based Vaccine. Front. Immunol. 2022, 13, 907481. [Google Scholar] [CrossRef] [Scilit]
  57. Yousaf, H.; Naz, A.; Zaman, N.; Hassan, M.; Obaid, A.; Awan, F.M.; Azam, S.S. Immunoinformatic and reverse vaccinology-based designing of potent multi-epitope vaccine against Marburgvirus targeting the glycoprotein. Heliyon 2023, 9, e18059. [Google Scholar] [CrossRef] [Scilit]
  58. Supply of Monkeys for Research Is at a Crisis Point, U.S. Government Report Concludes. Available online: https://www.science.org/content/article/supply-monkeys-research-crisis-point-u-s-government-report-concludes (accessed on 11 May 2023).
  59. Garcia-Boronat, M.; Diez-Rivero, C.M.; Reinherz, E.L.; Reche, P.A. PVS: A web server for protein sequence variability analysis tuned to facilitate conserved epitope discovery. Nucleic Acids Res. 2008, 36, W35–W41. [Google Scholar] [CrossRef] [Scilit]
  60. Mullick, B.; Magar, R.; Jhunjhunwala, A.; Barati Farimani, A. Understanding mutation hotspots for the SARS-CoV-2 spike protein using Shannon Entropy and K-means clustering. Comput. Biol. Med. 2021, 138, 104915. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  61. Zaharieva, N.; Dimitrov, I.; Flower, D.; Doytchinova, I. Immunogenicity prediction by VaxiJen: A ten year overview. J. Proteom. Bioinform. 2017, 10, 298–310. [Google Scholar]
  62. Lin, K.L.; Twenhafel, N.A.; Connor, J.H.; Cashman, K.A.; Shamblin, J.D.; Donnelly, G.C.; Esham, H.L.; Wlazlowski, C.B.; Johnson, J.C.; Honko, A.N.; et al. Temporal Characterization of Marburg Virus Angola Infection following Aerosol Challenge in Rhesus Macaques. J. Virol. 2015, 89, 9875–9885. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  63. Callaway, E. Labs rush to study coronavirus in transgenic animals—Some are in short supply. Nature 2020, 579, 183–184. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  64. Neergaard, L. Research Monkey Shortage Undermines US Readiness, Panel Says; Associated Press: New York, NY, USA, 2023. [Google Scholar]
  65. Reynisson, B.; Alvarez, B.; Paul, S.; Peters, B.; Nielsen, M. NetMHCpan-4.1 and NetMHCIIpan-4.0: Improved predictions of MHC antigen presentation by concurrent motif deconvolution and integration of MS MHC eluted ligand data. Nucleic Acids Res. 2020, 48, W449–W454. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  66. Lan Zhang, G.; Budde, M.L.; Lhost, J.J.; O’Connor, D.H.; Hildebrand, W.H.; Brusic, V. PREDmafa: A system for prediction of peptide binding to several MHC class I molecules in cynomolgus macaques. In Proceedings of the 2nd ACM Conference on Bioinformatics, Computational Biology and Biomedicine, New York, NY, USA, 1–3 August 2011; pp. 602–606. [Google Scholar]
  67. Budde, M.L.; Greene, J.M.; Chin, E.N.; Ericsen, A.J.; Scarlotta, M.; Cain, B.T.; Pham, N.H.; Becker, E.A.; Harris, M.; Weinfurter, J.T.; et al. Specific CD8+ T cell responses correlate with control of simian immunodeficiency virus replication in Mauritian cynomolgus macaques. J. Virol. 2012, 86, 7596–7604. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  68. Mohns, M.S.; Greene, J.M.; Cain, B.T.; Pham, N.H.; Gostick, E.; Price, D.A.; O’Connor, D.H. Expansion of Simian Immunodeficiency Virus (SIV)-Specific CD8 T Cell Lines from SIV-Naive Mauritian Cynomolgus Macaques for Adoptive Transfer. J. Virol. 2015, 89, 9748–9757. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  69. Passaes, C.; Millet, A.; Madelain, V.; Monceaux, V.; David, A.; Versmisse, P.; Sylla, N.; Gostick, E.; Llewellyn-Lacey, S.; Price, D.A.; et al. Optimal Maturation of the SIV-Specific CD8(+) T Cell Response after Primary Infection Is Associated with Natural Control of SIV: ANRS SIC Study. Cell Rep. 2020, 32, 108174. [Google Scholar] [CrossRef] [Scilit]
  70. Sylvester-Hvid, C.; Kristensen, N.; Blicher, T.; Ferre, H.; Lauemoller, S.L.; Wolf, X.A.; Lamberth, K.; Nissen, M.H.; Pedersen, L.O.; Buus, S. Establishment of a quantitative ELISA capable of determining peptide—MHC class I interaction. Tissue Antigens 2002, 59, 251–258. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  71. Ostergaard Pedersen, L.; Nissen, M.H.; Hansen, N.J.; Nielsen, L.L.; Lauenmoller, S.L.; Blicher, T.; Nansen, A.; Sylvester-Hvid, C.; Thromsen, A.R.; Buus, S. Efficient assembly of recombinant major histocompatibility complex class I molecules with preformed disulfide bonds. Eur. J. Immunol. 2001, 31, 2986–2996. [Google Scholar] [CrossRef] [Scilit]
  72. Sarkar, R.; Sharma, Y.; Jain, A.; Tehseen, A.; Singh, S.; Sehrawat, S. A Combinatorial in-silico, in-vitro and in-vivo Approach to Quantitatively Study Peptide Induced MHC Stability. Bio. Protoc. 2021, 11, e4255. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  73. Justesen, S.; Harndahl, M.; Lamberth, K.; Nielsen, L.L.; Buus, S. Functional recombinant MHC class II molecules and high-throughput peptide-binding assays. Immunome. Res. 2009, 5, 2. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  74. Harndahl, M.; Rasmussen, M.; Roder, G.; Dalgaard Pedersen, I.; Sorensen, M.; Nielsen, M.; Buus, S. Peptide-MHC class I stability is a better predictor than peptide affinity of CTL immunogenicity. Eur. J. Immunol. 2012, 42, 1405–1416. [Google Scholar] [CrossRef] [Scilit]
  75. Sidney, J.; Southwood, S.; Moore, C.; Oseroff, C.; Pinilla, C.; Grey, H.M.; Sette, A. Measurement of MHC/peptide interactions by gel filtration or monoclonal antibody capture. Curr. Protoc. Immunol. 2013, 100, 18.3.1–18.3.36. [Google Scholar] [CrossRef] [Scilit]
  76. Fraser, C.C.; Altreuter, D.H.; Ilyinskii, P.; Pittet, L.; LaMothe, R.A.; Keegan, M.; Johnston, L.; Kishimoto, T.K. Generation of a universal CD4 memory T cell recall peptide effective in humans, mice and non-human primates. Vaccine 2014, 32, 2896–2903. [Google Scholar] [CrossRef] [Scilit]
  77. Laubreton, D.; Bay, S.; Sedlik, C.; Artaud, C.; Ganneau, C.; Deriaud, E.; Viel, S.; Puaux, A.L.; Amigorena, S.; Gerard, C.; et al. The fully synthetic MAG-Tn3 therapeutic vaccine containing the tetanus toxoid-derived TT830-844 universal epitope provides anti-tumor immunity. Cancer Immunol. Immunother. 2016, 65, 315–325. [Google Scholar] [CrossRef] [Scilit]
  78. Berry, N.; Mee, E.T.; Almond, N.; Rose, N.J. The Impact and Effects of Host Immunogenetics on Infectious Disease Studies Using Non-Human Primates in Biomedical Research. Microorganisms 2024, 12, 155. [Google Scholar] [CrossRef] [Scilit]
  79. Agarwal, D.; Liu, C.; Bhoj, V.; Kearns, J.; Bharani, T.; Choe, I.; Vivek, K.; O’Connor, D.H.; Wiseman, R.W.; Duquesnoy, R.J.; et al. Adaptation of HLA testing to characterize the cynomolgus macaque MHC polymorphisms and alloantibody signatures. HLA 2023, 103, e15239. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  80. Koehl, P.; Levitt, M. Sequence variations within protein families are linearly related to structural variations. J. Mol. Biol. 2002, 323, 551–562. [Google Scholar] [CrossRef] [Scilit]
  81. Liao, H.; Yeh, W.; Chiang, D.; Jernigan, R.L.; Lustig, B. Protein sequence entropy is closely related to packing density and hydrophobicity. Protein. Eng. Des. Sel. 2005, 18, 59–64. [Google Scholar] [CrossRef] [Scilit]
  82. Gaschen, B.; Taylor, J.; Yusim, K.; Foley, B.; Gao, F.; Lang, D.; Novitsky, V.; Haynes, B.; Hahn, B.H.; Bhattacharya, T.; et al. Diversity considerations in HIV-1 vaccine selection. Science 2002, 296, 2354–2360. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  83. Kunwar, P.; Hawkins, N.; Dinges, W.L.; Liu, Y.; Gabriel, E.E.; Swan, D.A.; Stevens, C.E.; Maenza, J.; Collier, A.C.; Mullins, J.I.; et al. Superior control of HIV-1 replication by CD8+ T cells targeting conserved epitopes: Implications for HIV vaccine design. PLoS ONE 2013, 8, e64405. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  84. Kumar, A.; Weiss, W.; Tine, J.A.; Hoffman, S.L.; Rogers, W.O. ELISPOT assay for detection of peptide specific interferon-gamma secreting cells in rhesus macaques. J. Immunol. Methods 2001, 247, 49–60. [Google Scholar] [CrossRef] [Scilit]
  85. Arrode-Bruses, G.; Moussa, M.; Baccard-Longere, M.; Villinger, F.; Chebloune, Y. Long-term central and effector SHIV-specific memory T cell responses elicited after a single immunization with a novel lentivector DNA vaccine. PLoS ONE 2014, 9, e110883. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  86. Kamperschroer, C.; O’Donnell, L.M.; Schneider, P.A.; Li, D.; Roy, M.; Coskran, T.M.; Kawabata, T.T. Measuring T-cell responses against LCV and CMV in cynomolgus macaques using ELISPOT: Potential application to non-clinical testing of immunomodulatory therapeutics. J. Immunotoxicol. 2014, 11, 35–43. [Google Scholar] [CrossRef] [Scilit]
  87. Quinn, K.M.; Da Costa, A.; Yamamoto, A.; Berry, D.; Lindsay, R.W.; Darrah, P.A.; Wang, L.; Cheng, C.; Kong, W.P.; Gall, J.G.; et al. Comparative analysis of the magnitude, quality, phenotype, and protective capacity of simian immunodeficiency virus gag-specific CD8+ T cells following human-, simian-, and chimpanzee-derived recombinant adenoviral vector immunization. J. Immunol. 2013, 190, 2720–2735. [Google Scholar] [CrossRef] [Scilit]
  88. Nolz, J.C. Molecular mechanisms of CD8(+) T cell trafficking and localization. Cell Mol. Life Sci. 2015, 72, 2461–2473. [Google Scholar] [CrossRef] [Scilit]
  89. Hevey, M.; Negley, D.; Pushko, P.; Smith, J.; Schmaljohn, A. Marburg virus vaccines based upon alphavirus replicons protect guinea pigs and nonhuman primates. Virology 1998, 251, 28–37. [Google Scholar] [CrossRef] [Scilit]
  90. Feltkamp, M.C.; Vierboom, M.P.; Kast, W.M.; Melief, C.J. Efficient MHC class I-peptide binding is required but does not ensure MHC class I-restricted immunogenicity. Mol. Immunol. 1994, 31, 1391–1401. [Google Scholar] [CrossRef] [Scilit]
  91. Croft, N.P.; Smith, S.A.; Pickering, J.; Sidney, J.; Peters, B.; Faridi, P.; Witney, M.J.; Sebastian, P.; Flesch, I.E.A.; Heading, S.L.; et al. Most viral peptides displayed by class I MHC on infected cells are immunogenic. Proc. Natl. Acad. Sci. USA 2019, 116, 3112–3117. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  92. Dulin, N.; Spanier, A.; Merino, K.; Hutter, J.N.; Waterman, P.E.; Lee, C.; Hamer, M.J. Systematic review of Marburg virus vaccine nonhuman primate studies and human clinical trials. Vaccine 2021, 39, 202–208. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  93. Sharma, G.; Sharma, A.R.; Kim, J.-C. Recent Advancements in the Therapeutic Development for Marburg Virus: Updates on Clinical Trials. In Current Infectious Disease Reports; Springer: Berlin/Heidelberg, Germany, 2024; pp. 1–11. [Google Scholar]
  94. Feizollah, A.; Anuar, N.B.; Mehdi, R.; Firdaus, A.; Sulaiman, A. Understanding COVID-19 Halal Vaccination Discourse on Facebook and Twitter Using Aspect-Based Sentiment Analysis and Text Emotion Analysis. Int. J. Environ. Res. Public Health 2022, 19, 6269. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  95. Meyer, M.; Garron, T.; Lubaki, N.M.; Mire, C.E.; Fenton, K.A.; Klages, C.; Olinger, G.G.; Geisbert, T.W.; Collins, P.L.; Bukreyev, A. Aerosolized Ebola vaccine protects primates and elicits lung-resident T cell responses. J. Clin. Investig. 2015, 125, 3241–3255. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  96. Su, Y.; Zhang, B.; Sun, R.; Liu, W.; Zhu, Q.; Zhang, X.; Wang, R.; Chen, C. PLGA-based biodegradable microspheres in drug delivery: Recent advances in research and application. Drug Deliv. 2021, 28, 1397–1418. [Google Scholar] [CrossRef] [Scilit]
  97. Tadros, D.M.; Eggenschwiler, S.; Racle, J.; Gfeller, D. The MHC Motif Atlas: A database of MHC binding specificities and ligands. Nucleic Acids Res. 2023, 51, D428–D437. [Google Scholar] [CrossRef] [Scilit]
  98. O’Connor, S.L.; Blasky, A.J.; Pendley, C.J.; Becker, E.A.; Wiseman, R.W.; Karl, J.A.; Hughes, A.L.; O’Connor, D.H. Comprehensive characterization of MHC class II haplotypes in Mauritian cynomolgus macaques. Immunogenetics 2007, 59, 449–462. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Amino acid variability analysis of MARV proteins. The sequences of MARV nucleoprotein (NP), envelope glycoprotein, and matrix protein (VP40) were downloaded from the LANL, UniProtKB, and NCBI databases, aligned, and submitted for analysis at the Protein Variability Server. The average Shannon variability score (SVS) across the entire amino acid sequence was calculated for comparison.
Figure 1. Amino acid variability analysis of MARV proteins. The sequences of MARV nucleoprotein (NP), envelope glycoprotein, and matrix protein (VP40) were downloaded from the LANL, UniProtKB, and NCBI databases, aligned, and submitted for analysis at the Protein Variability Server. The average Shannon variability score (SVS) across the entire amino acid sequence was calculated for comparison.
Vaccines 12 00322 g001
Figure 2. t-SNE–based ranking of MARV test peptides based on Mafa-A63 binding affinity and stability. Peptides from Appendix A Table A1, including reference peptides, were characterized in Mafa-A63 binding affinity and stability studies. The entire binding affinity data set for 66 peptides was percentile-ranked. The stability assay outcome measure was separately ranked as the percentile score. The binding and stability data as percent were analyzed by t-distributed stochastic neighbor embedding (t-SNE) and ranked by the second dimension of the t-SNE plot (T2) (Orange gradient line at left). Both binding affinity and stability data are illustrated above in a heat map, where the magnitude of the percentile rank is reflected in both the size and color of the associated measurement. As expected, the three reference positive control peptides (RPKVPLRTM, GPRKPIKCW, HPAQTSQW), with known affinity and stability of Mafa-A063 binding, scored high on the t-SNE T2 axis. Peptides from Appendix A Table A1 were submitted to IEDB, and their predicted HLA class I molecule affinity was calculated and ranked. Twenty peptides with predicted high affinity binding to HLA class I molecules were assayed using a soluble HLA class I molecule-based competitive binding assay.
Figure 2. t-SNE–based ranking of MARV test peptides based on Mafa-A63 binding affinity and stability. Peptides from Appendix A Table A1, including reference peptides, were characterized in Mafa-A63 binding affinity and stability studies. The entire binding affinity data set for 66 peptides was percentile-ranked. The stability assay outcome measure was separately ranked as the percentile score. The binding and stability data as percent were analyzed by t-distributed stochastic neighbor embedding (t-SNE) and ranked by the second dimension of the t-SNE plot (T2) (Orange gradient line at left). Both binding affinity and stability data are illustrated above in a heat map, where the magnitude of the percentile rank is reflected in both the size and color of the associated measurement. As expected, the three reference positive control peptides (RPKVPLRTM, GPRKPIKCW, HPAQTSQW), with known affinity and stability of Mafa-A063 binding, scored high on the t-SNE T2 axis. Peptides from Appendix A Table A1 were submitted to IEDB, and their predicted HLA class I molecule affinity was calculated and ranked. Twenty peptides with predicted high affinity binding to HLA class I molecules were assayed using a soluble HLA class I molecule-based competitive binding assay.
Vaccines 12 00322 g002
Figure 3. Time course study of macaque ELISpot reactivity to selected MARV peptides following microsphere vaccination. (A) Four Cynomolgus macaques carrying the Mafa-A*062 MHC genotype were vaccinated with synthetic peptides corresponding to Mafa-A063 restricted CD8+ T cell epitopes. On the day indicated on the x-axis, PBMCs were harvested from the macaques and processed for ELISpot analysis. PBMCs (2.5 × 105/well) and the indicated synthetic peptide were added to duplicate wells. PBMCs were also added to ELISpot plate wells with complete growth medium (CGM) with no peptide (BKG—8 wells/plate), ELISpot plate wells with CGM and tetanus toxoid (tox), and ELISpot plate wells with CGM and tetanus toxoid peptide TT830–844. Following incubation, the plates were developed for gamma interferon immunoreactivity according to the manufacturer’s instructions. The developed plates were machine counted using an S6 Entry M2 immunospot analyzer. The averages of duplicate wells were compared with plate background wells using Student’s t-statistics. Only wells that showed (1) average responses greater than 2X the background and (2) statistically significant (one-sided, p < 0.05) responses greater than the plate background were considered positive. Heat maps of the responses are summarized in the figure above. The magnitude of each response, expressed as the number of Interferon γ spot-forming cells (SFC) per million PBMCs from the animals included in the study, is given inside the circle. (B) The magnitude of the total number of Interferon γ spot-forming cells, summed across all four study macaques, is shown in a heat map format (yellow to blue to green). The number of macaques responding to the same peptide on the same day is shown within the circle when greater than 1.
Figure 3. Time course study of macaque ELISpot reactivity to selected MARV peptides following microsphere vaccination. (A) Four Cynomolgus macaques carrying the Mafa-A*062 MHC genotype were vaccinated with synthetic peptides corresponding to Mafa-A063 restricted CD8+ T cell epitopes. On the day indicated on the x-axis, PBMCs were harvested from the macaques and processed for ELISpot analysis. PBMCs (2.5 × 105/well) and the indicated synthetic peptide were added to duplicate wells. PBMCs were also added to ELISpot plate wells with complete growth medium (CGM) with no peptide (BKG—8 wells/plate), ELISpot plate wells with CGM and tetanus toxoid (tox), and ELISpot plate wells with CGM and tetanus toxoid peptide TT830–844. Following incubation, the plates were developed for gamma interferon immunoreactivity according to the manufacturer’s instructions. The developed plates were machine counted using an S6 Entry M2 immunospot analyzer. The averages of duplicate wells were compared with plate background wells using Student’s t-statistics. Only wells that showed (1) average responses greater than 2X the background and (2) statistically significant (one-sided, p < 0.05) responses greater than the plate background were considered positive. Heat maps of the responses are summarized in the figure above. The magnitude of each response, expressed as the number of Interferon γ spot-forming cells (SFC) per million PBMCs from the animals included in the study, is given inside the circle. (B) The magnitude of the total number of Interferon γ spot-forming cells, summed across all four study macaques, is shown in a heat map format (yellow to blue to green). The number of macaques responding to the same peptide on the same day is shown within the circle when greater than 1.
Vaccines 12 00322 g003
Table 1. Vaccination and blood draw schedule.
Table 1. Vaccination and blood draw schedule.
Experiment DayBlood Draw and ELISpotMARV
Microsphere Vaccination
TDaP
Vaccination
MARV Microsphere with TpD and TT830–844 Vaccination
Day 0
(Baseline)
XX
Day 6XX
Day 13XX
Day 21XX
Day 28X
Day 63X X
Day 81No ELISpot X
Day 84X X
Day 110X XX
Day 150No ELISpot XX
Day 164X
Table 2. VaxiJen predicted antigenicity scores.
Table 2. VaxiJen predicted antigenicity scores.
MARV Protein NameAccession NumberVaxiJen Overall Protective Antigen Prediction Score
VP30ABA87128.10.5636
glycoprotein GPCAA78117.10.5481
VP24ABA87129.10.5423
Nucleoprotein (NP) ABE27012.10.4784
Polymerase (L)ABA87130.10.4428
VP35ABA87125.10.4316
matrix protein VP40ABA87126.10.4107
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Harris, P.E.; Burkholz, S.; Herst, C.V.; Rubsamen, R.M. Bioinformatic, Biochemical, and Immunological Mining of MHC Class I Restricted T Cell Epitopes for a Marburg Nucleoprotein Microparticle Vaccine. Vaccines 2024, 12, 322. https://doi.org/10.3390/vaccines12030322

AMA Style

Harris PE, Burkholz S, Herst CV, Rubsamen RM. Bioinformatic, Biochemical, and Immunological Mining of MHC Class I Restricted T Cell Epitopes for a Marburg Nucleoprotein Microparticle Vaccine. Vaccines. 2024; 12(3):322. https://doi.org/10.3390/vaccines12030322

Chicago/Turabian Style

Harris, Paul E., Scott Burkholz, Charles V. Herst, and Reid M. Rubsamen. 2024. "Bioinformatic, Biochemical, and Immunological Mining of MHC Class I Restricted T Cell Epitopes for a Marburg Nucleoprotein Microparticle Vaccine" Vaccines 12, no. 3: 322. https://doi.org/10.3390/vaccines12030322

APA Style

Harris, P. E., Burkholz, S., Herst, C. V., & Rubsamen, R. M. (2024). Bioinformatic, Biochemical, and Immunological Mining of MHC Class I Restricted T Cell Epitopes for a Marburg Nucleoprotein Microparticle Vaccine. Vaccines, 12(3), 322. https://doi.org/10.3390/vaccines12030322

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop