Next Article in Journal
Image-Based Evaluation of Cracking Degrees on Wood Fiber Bundles: A Machine Learning Approach
Next Article in Special Issue
Effects of the Cultivation Substrate pH and Ammonium-to-Nitrate Nitrogen Ratio on the C:N:P Stoichiometry in Leaves of Cunninghamia lanceolata and Schima superba
Previous Article in Journal
Evolutionary Characterization of tubulin Gene Family in the Desert Biomass Willow (Salix psammophila) and Expression of the β-tubulin Gene SpsTUB10 during Different Stresses
Previous Article in Special Issue
In Situ Rainwater Harvesting System Slows Forest Decline through Increasing Soil Water Content, Fine-Root Traits, and Plant Hydraulic Conductivity
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Genome-Wide Identification and Expression of the AP2/ERF Gene Family in Morus notabilis

College of Forestry, Henan Agricultural University, Zhengzhou 450002, China
*
Authors to whom correspondence should be addressed.
Forests 2024, 15(4), 697; https://doi.org/10.3390/f15040697
Submission received: 6 February 2024 / Revised: 10 April 2024 / Accepted: 11 April 2024 / Published: 13 April 2024

Abstract

The AP2/ERF gene family, referring to an exclusive class of transcription factors unique to plants, is involved in various biological processes, including plant growth and responses to environmental stresses like high salt and drought. In this study, the AP2/ERF gene in M. notabilis was comprehensively identified and bioinformatically analyzed based on the genomic data of M. notabilis. 106 members in the MnAP2/ERF gene family were identified in the M. notabilis genome and were categorized into five subfamilies: ERF, AP2, DREB, RAV, and Soloist, with the ERF subfamily representing 80.19% of the total. The MnAP2/ERF gene family was observed to be distributed on six chromosomes of M. notabilis. Members in the MnAP2/ERF gene family exhibited obvious differences in amino acid number, molecular weight, isoelectric point, and other properties. Approximately 68.87% of the MnAP2/ERF proteins were acidic, all exhibiting hydrophilic characteristics. Differences in conserved sequences and arrangement of AP2 domains were observed among distinct subfamilies, with genes in the same subfamily sharing similar conserved domain compositions. There were 47 genes without untranslated regions and 44 genes with two untranslated regions. The upstream functions of promoters were concentrated on light reactions and plant hormones. Evolutionarily, significant structural differences were identified, and 28 MnAP2/ERF gene family proteins could interact with each other. Moreover, 35 family genes were involved in 22 fragment repeat events, and 55 MnAP2/ERF and 84 AtAP2/ERF genes showed collinearity. The expression of the MnAP2/ERF gene family was significantly different in different parts, indicating that these gene family members were involved in different physiological activities. These results established a theoretical foundation for investigating the functional and evolutionary aspects of AP2/ERF gene family genes in M. notabilis, as well as exploring the root morphogenesis of M. notabilis. Additionally, this study contributes to a basis for the improvement of cultivar stress resistance of M. notabilis.

1. Introduction

Morus notabilis (M. notabilis), a deciduous tree or shrub belonging to the Moraceae Gaudich. family, is a perennial woody plant native to central China. It is widely distributed in Guangxi, Yunnan, and Hubei in China [1,2,3]. Renowned for its robust adaptability to various soils, M. notabilis is extensively utilized in afforestation and mountain reforestation efforts. It thrives in soils ranging from slightly acidic to slightly alkaline [4]. Beyond its ecological benefits, M. notabilis holds good economic benefits. Its fruit, a sweet and juicy mulberry, is praised by the medical community as “the best health fruit in the 21st century” [5]. Additionally, M. notabilis wood is dense, tough, and beautifully textured, making it a high-grade raw material for crafting agricultural tools and furniture [6,7]. Moreover, M. notabilis cuttings propagation has found its widespread application in mass propagation. This is attributed to the fact that it not only can fully respond to the rapid construction and development requirements of mulberry production but also can maintain the good traits of the mother plant while avoiding degradation and producing better seed stocks faster [8,9,10]. In each stage of cutting propagation, how to improve the stress resistance of cutting roots is an urgent problem to be solved at present [11]. Furthermore, the survival rate of cuttings directly affects their overall quality, and there is a growing imperative to breed high-yielding and stress-resistant M. notabilis clones, facilitating their adaption to marginal land development and utilization.
Transcription factors can regulate the specific expression of target genes at particular times and in specific spatial locations, exerting a pivotal effect on gene expression [12,13,14]. They can enhance the ability of plants to withstand various stresses by modulating the level of target genes. Among all transcription factors, the APETALA2/Ethylene-responsive factor (AP2/ERF) family serves as the largest family in plants. It regulates the plant growth and development and responds crucially to environmental stresses. This family, a major player in plant transcription factors, participates in regulating diverse plant signaling pathways [15,16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35,36,37,38,39,40,41,42,43,44]. A key characteristic of the AP2/ERF gene family is the presence of at least one AP2 domain, consisting of 60–70 amino acids, in all its members [18,19,20]. Categorization of the AP2/ERF gene family is based on the number of AP2 domains contained and other conserved sequence features, resulting in four subfamilies: AP2, ERF, RAV, and Soloist [21]. In general, the AP2 subfamily possesses two AP2 domains, while ERF, RAV, and Soloist have a single AP2 domain [22]. The ERF subfamily, in addition to the AP2 domain, features a B3 domain. Further division of the ERF family can be performed based on the DNA-binding domain, resulting in the ERF and DREB subfamilies [23]. The Soloist subfamily stands out due to substantial differences in its protein sequence characteristics and specific gene structures, warranting its classification as a distinct subfamily within the AP2/ERF family [24].
With the widespread adoption of genome sequencing in various plant species, the AP2/ERF gene family has found its extensive application in Arabidopsis thaliana [25], Populus L. [26], Oryza sativa L. [27], Zea mays L. [28], Vigna radiata (L.) R. Wilczek [29], and Betula alba. [30]. The RAV genes within the AP2/ERF gene family are responsive to hormones such as ethylene and brassinolide [31], and their overexpression has been demonstrated to enhance plant resistance to salt and drought stresses [32,33]. On the other hand, genes in the ERF subfamily primarily participate in the responses to both biotic and abiotic stresses, including pathogenic bacteria and disease stimuli [34,35], water stress [36], salt stress [37], as well as high and low-temperature stresses [38,39]. Furthermore, some AP2/ERF transcription factors in A. thaliana stimulate the expression of several crucial enzymes involved in proline synthesis, facilitating and promoting the synthesis of proline. This, in turn, elevates the content of free proline, thereby contributing to an enhancement in plant cold tolerance [40]. Some previous studies focusing on AP2/ERF gene families across different plant species have highlighted their significant role in the generation and development of adventitious roots [41]. For example, Ye et al. [42] found that ABR1 and ERF109 promoted the accumulation of auxin after injury treatment and actively participated in the regulation of adventitious root regeneration. Conversely, the SPL2/10/11 transcription factor inhibited auxin synthesis after injury treatment, thereby weakening the ability of adventitious root regeneration. Yuka Kitomi et al. [43] identified the involvement of CRL5 in priming rice crown root development by inducing the expression of OsRR1 (a type A response regulator in cytokinin signaling). Moreover, Dossa et al. [44], in their analysis of AP2/ERF transcription factors in sesame seeds, noted that most DREB genes exhibited higher expressions in the roots, primarily functioning in response to drought stress. In addition, Swinka et al. [45] reported that certain ERF-VI proteins mediated the transcription of cytokinins, representing crucial factors in the production of adventitious roots. At present, while the whole-genome sequencing of the M. notabilis genome has been completed, a comprehensive genome-wide exploration of the structure, classification, and expression patterns of the MnAP2/ERF gene family remains unreported.
Here, we employed bioinformatics methods to delve into the MnAP2/ERF gene family, covering different aspects like chromosome localization, evolutionary analysis, protein physicochemical properties, conserved domains, gene structures, and species co-linearity. Meanwhile, expression patterns of genes in this family were examined at the protein tertiary structure level. This research aims to establish a foundational reference for further investigation of the transcription factor functions in M. notabilis. Additionally, it seeks to offer molecular insights into theories related to cutting propagation and stress resistance formation in M. notabilis.

2. Materials and Methods

2.1. Data Sources

The entire genome sequence and protein sequence data for M. notabilis employed in this research were acquired from the M. notabilis gap-free reference genome (BioProject number: PRJCA015883), as published by Ningjia He’s team at Southwest University [46]. Additionally, the whole genome sequence and protein sequence data for A. thaliana were downloaded from the TAIR database (https://www.arabidopsis.org/, accessed on 18 October 2023).

2.2. Identification of Members of the MnAP2/ERF Gene Family

Firstly, the protein sequence data for AtAP2/ERF gene family members were retrieved from the plantTFDB database (http://planttfdb.gao-lab.org/, accessed on 18 October 2023). One hundred and seventy-five associated protein sequences were yielded. The local blast analysis (E value < 0.05) was then performed on 175 AtAP2/ERF gene family members using M. notabilis genome data to identify the homologous proteins in A. thaliana. Concurrently, the hidden Markov model (HMM) with the AP2 domain (PF00847) was downloaded from the InterPro database (https://www.ebi.ac.uk/interpro/, accessed on 18 October 2023). The M. notabilis whole protein database was searched using HMMER v3.4 (http://eddylab.org/software/hmmer/, accessed on 18 October 2023) software (E value < 0.05), generating proteins containing at least one AP2 domain. All protein sequences obtained by the above two methods underwent scrutiny using the online software NCBI-CDD (https://www.ncbi.nlm.nih.gov/cdd/, accessed on 18 October 2023) and SMART (https://smart.embl.de, accessed on 18 October 2023). Redundant sequences and proteins without the AP2 domain were excluded. Consequently, 106 complete AP2 domain protein sequences were retained, constituting the members of the MnAP2/ERF gene family in M. notabilis. Finally, these 106 members of the MnAP2/ERF gene family were named based on the aforementioned domain characteristics.

2.3. Chromosomal Mapping and Numbering of MnAP2/ERF Gene Family Members

Using TBtools v2.038 software [47], the M. notabilis genomic GFF file and the gene IDs corresponding to the previously mentioned 106 MnAP2/ERF proteins were simultaneously inputted. Subsequently, the positions of the MnAP2/ERF proteins on the chromosomes (Chr 1–Chr 6) were visualized and annotated according to their sequence order.

2.4. Analysis of Physicochemical Properties of MnAP2/ERF Gene Family Members

The physical and chemical properties of the 106 MnAP2/ERF gene family members, such as amino acid number, molecular weight, isoelectric point, and average hydrophobic index, were analyzed using the online software ExPASy-Compute pI/Mw tool (https://web.expasy.org/compute_pi/, accessed on 19 October 2023). In addition, WoLF PSORT (https://wolfpsort.hgc.jp/, accessed on 19 October 2023) was employed to predict the subcellular localization of these MnAP2/ERF gene family members.

2.5. Evolutionary Tree Construction of MnAP2/ERF Gene Family Members

To explore the evolutionary relationship between the MnAP2/ERF gene family and other plant AP2/ERF gene families, an evolutionary tree of M. notabilis and A. thaliana AP2/ERF gene family proteins was constructed using the neighbor-joining (NJ) method. The process involved aligning a total of 281 protein sequences from M. notabilis and A. thaliana using ClustalW 2.0 software. The parameters were set to Gap Opening of 10, Extension of 0.2, Delay Divergent Sequences of 30, and DNA Transition Weight of 0.5. Subsequently, the alignment results were entered into MEGA 11 software (https://www.megasoftware.net/, accessed on 23 October 2023) to build the evolutionary tree based on 1000 Bootstrap samples, with other parameters set to their default values.

2.6. Motif Analysis and Gene Structure Analysis of MnAP2/ERF Gene Family

The motif sequences of the MnAP2/ERF gene family were examined using the online software MEME (https://meme-suite.org/meme/tools/meme, accessed on 23 October 2023), with the number of motifs set to 10. After that, the obtained motif sequences were visualized using TBtools v2.038 software [47]. Moving on to gene structure analysis, the M. notabilis genome CDS file was initially searched to retrieve the CDS sequence of the MnAP2/ERF gene family. Subsequently, the full-length gene file was obtained with the assistance of Activestate software (https://www.activestate.com/, accessed on 23 October 2023). Finally, both files were inputted into the online software GSDS 2.0 (http://gsds.gao-lab.org/, accessed on 23 October 2023) for visualization of the gene structure.

2.7. Promoter Cis-Acting Elements of the MnAP2/ERF Gene Family

To investigate the specific cis-acting elements influencing the gene expression in the promoter region of the MnAP2/ERF gene, DNA sequences from the promoter region of these gene family members were extracted from the M. notabilis genome. Then, predictive analysis was conducted using the PlantCARE database (https://bioinformatics.psb.ugent.be/webtools/plantcare/html/, accessed on 25 October 2023). Next, the analysis was specifically focused on predicting the functional elements associated with light response, hormone response, stress response, and growth and development response within the promoter region. Finally, a visual analysis of the results was performed using TBtools v2.038 software.

2.8. Tertiary Structure and Protein–Protein Interaction (PPI) Analysis of MnAP2/ERF Gene Family Proteins

The online tool CPHmodels database (https://services.healthtech.dtu.dk/services/CPHmodels-3.2/, accessed on 25 October 2023) was employed to predict the tertiary structure of the identified MnAP2/ERF protein sequences by homology modeling. Subsequently, utilizing the MnAP2/ERF protein sequence as a basis, the STRING online platform (https://cn.string-db.org/, accessed on 25 October 2023) was utilized to elucidate the primary mode of action of homologous proteins in A. thaliana using 106 MnAP2/ERF gene family protein sequences as the reference species. The results were then visually analyzed using Cytoscape software (https://cytoscape.org/, accessed on 25 October 2023).

2.9. Gene Repeat Events and Collinearity Analysis of the MnAP2/ERF Gene Family

To comprehend the repeat events within the MnAP2/ERF gene family and their collinearity with the AtAP2/ERF gene family, a comparative analysis was conducted on protein sequences. Specifically, M. notabilis itself and AP2/ERF protein sequences of A. thaliana were compared by MCScanX v3-28-2013 software. Gene pairs within M. notabilis species and A. thaliana were extracted with the help of TBtools v2.038 software to construct a collinearity map for M. notabilis within its own genome and between M. notabilis and A. thaliana AP2/ERF genes (E value < −10).

2.10. Analysis of the Expression Pattern of the MnAP2/ERF Gene Family in Different Organs of M. notabilis

We downloaded the transcriptome data of M. notabilis from NCBI (accession number: PRJNA597172) [48] and used RSEM v1.3.3 software to calculate the gene expression level of each sample to derive the FPKM value [49], from which we extracted the MnAP2/ERF family genes of M. notabilis, organized them into a matrix file, and submitted them to the local software TBtools v2.038 to draw a heatmap of the tissue expression of the MnAP2/ERF family genes in the M. notabilis.

3. Results and Analysis

3.1. Chromosomal Location and Nomenclature of MnAP2/ERF Gene Family Members

To investigate the distribution of MnAP2/ERF proteins on the M. notabilis chromosome, the localization of 106 MnAP2/ERF genes on the chromosome was visualized by TBtools v2.038 software, as illustrated in Figure 1. The results unveiled an uneven distribution on six chromosomes of M. notabilis, with the highest concentration on chromosome 1, comprising 31 family members. There are 23, 27, 16, and 6 family members on chromosomes 2, 3, 4, and 5, respectively. Notably, the least distribution was observed on chromosome 6, with only three family members. Then, the MnAP2/ERF gene family members were named based on their gene IDs, considering their order, spatial distribution on the chromosomes, and binding domains. This nomenclature provided a foundation framework for the subsequent exploration of the functional characteristics of the MnAP2/ERF proteins.

3.2. Physicochemical Properties of MnAP2/ERF Gene Family Members

Based on M. notabilis genomic data, we identified a total of 85 MnERF members, 16 MnAP2 members, 2 MnRAV members, 2 MnDREB members, and 1 Soloist member in this investigation. The physicochemical analysis of the protein properties of MnAP2/ERF gene family members, as outlined in Table S1, revealed notable differences in the number, molecular weight, isoelectric point, and other properties of amino acids. The protein lengths of the 106 MnAP2/ERF gene family members ranged from 129 aa (MnERF47) to 1119 aa (MnAP 2-15), which was slightly different within the same subfamily. Remarkably, the protein length of the MnAP2 subfamily proteins was significantly higher than that of the other four subfamilies. The molecular weight of the protein exhibited a wide range, spanning from 14.6 kD (MnERF47) to 123.15 kD (MnAP2–MnAP15). Regarding the isoelectric point, 31.13% of the MnAP2/ERF family proteins had values greater than 7 with an average value of 6.67, while 68.87% had values less than 7, averaging 6.60. These data indicate that most of the MnAP2/ERF family proteins were acidic in nature. Furthermore, the average hydrophobicity index of the MnAP2/ERF family proteins was less than 0, signifying their hydrophilic nature. Subcellular localization bioinformatics analysis of MnAP2/ERF gene family proteins demonstrated that 77 proteins are located in the nucleus, 11 in chloroplasts, 2 in peroxisomes, 2 proteins in the lysosome, and 1 in the cytoskeleton.

3.3. Evolutionary Analysis of AP2/ERF Gene Family

An evolutionary tree was generated using protein sequences from the AtAP2/ERF gene family and the identified MnAP2/ERF gene family, with the results presented in Figure 2. Based on the evolutionary analysis, the 281 AP2/ERF proteins were categorized into five ERF (I–V) subfamilies, two AP2 (I–II) subfamilies, one DREB subfamily, one Soloist subfamily, and one RAV subfamily. Among these subfamilies, ERF-V exhibited the most members, while the Soloist subfamily possessed the fewest members, with only one member. Through evolutionary tree and binding domain analyses of the tree, it was evident that the evolutionary structure of ERF, AP2, and RAV gene family in M. notabilis closely resembles that of A. thaliana. The gene homology between MnAP2/ERF genes and AtAP2/ERF genes indicates a relatively conserved evolutionary pattern within the AP2/ERF gene family across these species.

3.4. Conserved Motifs and Gene Structures of MnAP2/ERF Gene Family Members

The results of intron/exome analysis depicted in the structure of MnAP2-ERF genes in Figure 3 revealed that all 106 MnAP2/ERF genes contained exons. Notably, only one gene (MnERF13) displayed a distinctive structure with 18 exons, while the other remaining genes exhibited exon numbers of 1~11. The largest proportion of genes (62) had a single exon, followed by 20 genes with two exons. Moreover, there were 55 genes without introns and 21 genes with one intron, while there were 20 genes containing more than three exons and introns. Among the 106 MnAP2-ERF genes, 47 genes did not have untranslated regions, while 44 genes featured two untranslated regions, primarily located at both ends. Upon closer gene structure analysis, it was observed that the absence of both introns and untranslated regions was exclusive to the ERF subfamily, with 30 genes exhibiting this pattern. Conversely, most genes in the AP2 subfamily showcased a higher number of introns and exons. In conclusion, the MnAP2/ERF genes demonstrated consistent gene structures within the same subfamily.
Utilizing the MEME tool to investigate the conserved motifs in MnAP2/ERF proteins, 10 conserved motifs were identified and listed in Table 1, with detailed characteristic information presented in Figure 3. The analysis unveiled noteworthy findings within the ERF subfamily, where motif 8 was observed in eight genes (MnERF58, MnERF62, MnERF60, MnERF57, MnERF61, MnERF63, MnERF78, and MnERF77) and motifs 4, 2, 1, 5, and 7 usually persisted consecutively. Motif 3 was identified in the AP2 and DREB subfamilies, although the specific motif composition varied between the two subfamilies. Among the 106 genes analyzed, three genes (MnRAV1, MnRAV2, and MnSoloist) contained only two motifs, and the motif composition of MnSoloist (Motif1 and Motif5) appeared in 90% of MnAP2/ERF proteins.

3.5. Cis-Acting Elements in the Promoter Region of MnAP2/ERF

The promoter sequences, spanning 2000 bp upstream of the start site of the MnAP2ERF gene family, were subjected to analysis using Plant CARE, and the results are illustrated n in Figure 4. The findings revealed that 20 cis-acting elements were detected in the MnAP2ERF gene family in four types: light-responsive, hormone-responsive, stress-responsive, and developmentally responsive. Overall, there are a maximum of 34 cis-acting elements on MnERF64 and a minimum of 6 cis-acting elements on MnERF5. With the exception of MnERF74 and MnERF73, all MnAP2/ERF genes encompassed multiple promoter cis-elements. Each MnAP2/ERF gene contained light-responsive elements, which accounted for 36.6% of the AP2/ERF gene family. In addition, several MnAP2/ERF family members included a large number of response elements associated with plant hormones and stress response. Notably, elements responding to the methyl jasmonate constituted the largest proportion at 15.0%, followed by the abscisic acid response elements at 14.7% and the anaerobic sensing elements at 8.1%. Additionally, a substantial number of elements were observed to be involved in abiotic stress and other related elements in the MnAP2/ERF family, such as cryogenic response, defense, and stress response elements. Among them, 61 genes contained low-temperature response elements, and 64 genes contained defense stress elements. This suggests a pivotal regulatory role of the MnAP2/ERF in response to various abiotic stress conditions.

3.6. Tertiary Structure and Protein–Protein Interaction Association of MnAP2/ERF Gene Family Proteins

In this study, we conducted homology modeling to derive the 3D structures for the 106 MnAP2/ERF transcription factors based on their amino acid sequences. The outcomes are visually presented in Figure 5. The analysis revealed a high degree of structural similarity among the 106 MnAP2/ERF proteins, indicating a generally uncomplicated structure for these transcription factors. Despite the overall structural uniformity, distinct coiling patterns were observed in different sequences, likely associated with the composition of α-helix, β-fold, corner, and random coil. Notably, the MnERF13 protein exhibited the highest counts, with 20 α-helices and 36 β-folds, while MnSoloist, MnERF70, and MnERF32 displayed the least structures, with one α-helix and two β-folds. Other proteins predominantly featured α-helix counts ranging from 8 to 17 and β-fold counts of 15~23. Among the 106 proteins, MnERF32 in the ERF-V subfamily and MnERF43 and MnERF65 in the ERF-III subfamily were similar in spatial structure. The resemblances or disparities between these three proteins and the remaining 103 proteins may underlie the functional similarities or differences.
To explore the protein–protein interactions (PPI) in the MnAP2/ERF family and their gene functions, a homology mapping method was employed to predict the PPI network, taking the protein interaction relationships in AtAP2/ERF as a reference. The results of this analysis highlight 28 MnAP2/ERF protein interaction relationships, as presented in Figure 6. Among them, there are many interactions between MnAP2/ERFARF family proteins, such as MnAP2-2, which can interact with MnERF59, MnERF58, MnERF34, MnERF82, MnERF57, MnERF77, MnERF47, MnERF17, MnERF26, MnERF56, MnERF31, and MnERF8. Additionally, MnAP2-2 demonstrated interactions with AtEIL1, AtEIN3, AtDREB3, and AtABF2 in the AtAP2/ERF family of proteins. The graphical representation indicates that MnAP2-2, MnERF21, MnERF77, and MnERF72 exhibit high connectivity within the PPI network. The functions associated with MnAP2-2 and MnERF77 appear to be related to stress, growth, and development. This observation suggests that these proteins may be crucial in the reproduction and stress resistance of M. notabilis, providing potential molecular insights for future research endeavors.

3.7. Gene Duplication Events and Species Collinearity of the MnAP2/ERF Gene Family

Figure 7A demonstrates the intraspecific collinearity analysis on MnAP2/ERF members. It revealed the involvement of 35 genes from the MnAP2/ERF gene family in 22 segmental duplication events, indicating the significant role of segmental duplication in shaping the MnAP2/ERF gene family. Specifically, MnERF16, MnERF24, MMnAP2-2, MnERF34, MnERF40, MnERF50, MnAP2-8, and MnAP2-14 were all involved in the two fragment duplication events each, indicating a high degree of similarity with other genes. To delve deeper into the evolutionary dynamics of the MnAP2/ERF gene family, collinearity analysis was conducted between A. thaliana and M. notabilis AP2/ERF genes. The results, as demonstrated in Figure 7B, suggested the collinearity between 55 MnAP2/ERF and 84 AtAP2/ERF, revealing 99 collinearity events. This signifies that the gene family was highly conserved in the evolutionary process. However, some MnAP2/ERF and AtAP2/ERF displayed no collinearity relationship. This could be attributed to the emergence of new genes in the AP2/ERF gene family during later family evolution.

3.8. Expression Analysis of MnAP2/ERF Gene Family in M. notabilis

Based on the transcriptome data of M. notabilis, the expressions of 106 MnAP2/ERF genes were obtained in different tissues of M. notabilis, and the results were visualized by using TBtools v2.038 software to draw heat maps (Figure 8). The results showed that most of the MnAP2/ERF genes were detected to be expressed and formed five specific expression clusters in five tissues. MnERF6, MnERF7, MnERF12, MnERF13, MnERF16, MnERF19, MnERF22, MnERF23, MnERF24, MnERF30, MnERF35, MnERF38, MnERF41, MnERF44, MnERF47, MnERF51, MnERF52, MnERF63, MnERF65, MnERF79, MnAP2-2, MnAP2-16, MnAP2-7, and MnAP2-8 showed a high expression pattern in the root tissues, and a low expression in flowers and leaves. It is hypothesized that these genes may be involved in gene regulation in the underground. MnERF3, MnERF33, MnERF50, MnERF80, MnERF81, and MnAP2-10, MnAP2-12, and MnAP2-14 showed significantly higher expression in male flowers than in other parts of the body, and MnERF1, MnERF9, MnERF10, MnERF25, MnERF48, MnERF53, MnERF57, MnERF58, MnERF61, MnERF62, MnERF64, MnERF69, MnERF71, MnERF73, MnERF74, and MnAP2-3 were expressed significantly higher in leaves than in other parts of the plant, MnERF21, MnERF25, MnERF32, MnERF34, MnERF36, MnERF37, MnERF39, MnERF42, MnERF46, MnERF54, MnERF77, MnERF84, MnERF85, MnAP2-4, MnAP2-11, MnSoloist, and MnRAV1 were expressed in bark significantly higher than other sites, and MnERF15, MnERF17, MnERF20, MnERF27, MnERF29, MnERF43, MnERF45, MnERF49, MnERF55, MnERF66, MnERF82, MnAP2-15, MnAP2-1, and MnAP2-9 were specifically expressed in the winter buds. MnAP2-6, MnAP2-7, MnRAV1, MnERF18, MnERF37, MnERF35, MnERF5, MnERF78, and MnERF79 were very low or even not expressed in the five tissues, suggesting that these genes were relatively silent in the five tissues.

4. Discussion

The AP2/ERF family, recognized as one of the largest transcription factor families in plants, is widely distributed across various pathways [16] and has been extensively investigated because of its high significance in gene breeding and stress resistance. In this study, 106 members of the MnERF gene family were screened from the whole genome of M. notabilis, which was comparatively lower than that in other plants such as Solanum lycopersicum (112) [50], A. thaliana (147) [25], Glycine max. (148) [51], and Solanum tuberosum L. (181) [52]. According to the phylogenetic and domain characteristics, the 106 MnAP2/ERF gene family members were classified into five subfamilies: ERF, AP2, DREB, RAV, and Soloist. Among these, the ERF subfamily displayed the largest number of members (85), accounting for 80.19% of the total. This distribution is similar to the observation in other species, where the ERF subfamily comprised over 80% of the total gene families, including A. thaliana, tomato, and poplar.
The transgenic and overexpression studies involving AP2/ERF transcription factors have demonstrated their potential to enhance plant resistance to both biotic and abiotic stresses. For instance, the DREB subfamily transcription factor has been shown to interact with the cis-acting dehydration response elements to improve the plant response to stress, and the overexpression of the AhDREB1 gene in tobacco can improve salt and drought resistance [53]. Similarly, the overexpression of DREB19 in A. thaliana significantly enhances the ability of plants to withstand drought and high salinity stress without adversely affecting their phenotype [54]. The expression of the DREB transcription factor VrDREB2A of Vigna radiata is induced by high salt, drought, and abscisic acid treatment. Compared with wild-type A. thaliana, overexpression of this gene can activate the expression of downstream genes of transgenic A. thaliana and improve the tolerance of transgenic Arabidopsis to high salt and drought stress [55]. Wheat transcription factor TaERF3 positively regulates adaptive responses to salt and drought stress by activating stress-related genes [56]. DREBA-5 transcription factor ScDREB5 in Syntrichia caninervis Mitt. can enhance reactive oxygen species (ROS), the salt-tolerance of transgenic A. thaliana can be improved by reactive oxygen species clearance, up-regulation of genes related to ion homeostasis, and jasmonic acid biosynthesis [57]. Meanwhile, they observed that inhibiting the expression of ERF3 led to a great reduction in the number and length of root crowns and the root crown development was delayed or even inhibited through experimental observation. Consequently, ERF genes are critical in the formation and early development of root crowns. In A. thaliana, AtRAP2.6 has been recognized as an important regulator of plant meristem regeneration and exerts a vital role in recovering cell damage. Moreover, the activity of the RAP2.6 gene was inversely proportional to the concentration of auxin IAA, highlighting its inhibitory role in IAA synthesis [58]. Combined with the expression changes of the MnAP2/ERF gene family in five tissues, we found that most MnAP2/ERFs have some tissue expression specificity. The identification and analysis of MnAP2/ERF transcription factors serve as valuable genetic resources for cultivating M. notabilis with high resistance to biotic and abiotic stresses through transgenic culture.

5. Conclusions

In this study, the MnAP2/ERF gene family of M. notabilis was analyzed. Most of the MnAP2/ERF proteins were acidic proteins, accounting for 68.87% of all members, and exhibited hydrophilic characteristics. Evolutionary analysis of the protein in the MnAP2/ERF gene family suggested that the ERF subfamily can be categorized into five (ERF I~ERF V), while the AP2 subfamily was composed of two classes (AP2-I.~AP2-II.). The other three subfamilies constituted separate classes, and proteins within the same class possessed similar properties. Furthermore, a comparison with A. thaliana revealed that the MnAP2/ERF genes experienced high conservation during the species evolution. An investigation on the conserved motifs and gene structure of the MnAP2/ERF gene family reported that the MnAP2/ERF genes had similar structures in the same subfamily, with 47 genes without untranslated regions and 44 with two, mainly at both ends of the genes. In addition, the functions of the upstream of the gene promoter were mainly concentrated in the photoreactive and plant hormone components, indicating that this gene family was involved in various physiological activities. Abundant elements involved in abiotic stress, such as hypothermia, defense, and stress response, were also identified in the AP2/ERF family, emphasizing its vital regulatory role in the response to abiotic stress in M. notabilis. Significant differences in conserved sequences among different subfamilies were noted, with varying arrangements of AP2 domains. The analysis of the structure and function of family proteins indicated a notable diversity in the mode of action among the 106 proteins, with 28 MnAP2/ERF gene family proteins implicated. The collinearity analysis further unveiled that 35 family genes in the MnAP2/ERF gene family were involved in 22 fragment repeat events, and 55 MnAP2/ERF genes exhibited collinearity with 84 AtAP2/ERF genes, suggesting the generation of new genes in the AP2/ERF gene family during the evolution. Finally, The MnAP2/ERF gene family formed specific expression clusters in roots, staminate flowers, leaves, bark, and winter buds, which accounted for 76.4% of the gene family, suggesting that most of the MnAP2/ERF genes play a significant role in the growth and development of root, male flower, leaf, bark, and winter buds.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/f15040697/s1, Table S1: Basic information of MnAP2/ERF gene family in M. notabilis.

Author Contributions

Conceptualization—methodology, J.Q. and H.D.; software—validation, T.W.; search. T.W. and X.Z.; writing—original draft software, H.D.; validation, T.W. and X.Z.; formal analysis, T.W. and X.F.; research work, H.D.; data collection, J.Q. and W.T.; original manuscript drafting, H.D.; review preparation and editing, H.D.; guidance, J.Q. and H.B.; administration, H.B.; funding procurement, H.B. and J.Q. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by the National Natural Science Foundation of China, Grant Number 31700549, and the China Postdoctoral Science Foundation Project, Grant Number 2017M612401.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The basic data for this article can be found in the article. However, some data is currently not shared and is also part of ongoing research. If necessary, it can be obtained from the corresponding author upon reasonable request.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Baciu, E.-D.; Baci, G.-M.; Moise, A.R.; Dezmirean, D.S. A Status Review on the Importance of Mulberry (Morus spp.) and Prospects towards Its Cultivation in a Controlled Environment. Horticulturae 2023, 9, 444. [Google Scholar] [CrossRef] [Scilit]
  2. Rohela, G.K.; Shukla, P.; Muttanna; Kumar, R.; Chowdhury, S.R. Mulberry (Morus spp.): An ideal plant for sustainable development. In Trees, Forests and People; Elsevier: Amsterdam, The Netherlands, 2020; Volume 2, p. 100011. [Google Scholar] [CrossRef] [Scilit]
  3. Memete, A.R.; Timar, A.V.; Vuscan, A.N.; Miere Groza, F.; Venter, A.C.; Vicas, S.I. Phytochemical Composition of Different Botanical Parts of Morus Species, Health Benefits and Application in Food Industry. Plants 2022, 11, 152. [Google Scholar] [CrossRef] [Scilit]
  4. Jan, B.; Parveen, R.; Zahiruddin, S.; Khan, M.U.; Mohapatra, S.; Ahmad, S. Nutritional constituents of mulberry and their potential applications in food and pharmaceuticals: A review. Saudi J. Biol. Sci. 2021, 28, 3909–3921. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Bhattacharjya, D.; Sadat, A.; Dam, P.; Buccini, D.F.; Mondal, R.; Biswas, T.; Biswas, K.; Sarkar, H.; Bhuimali, A.; Katı, A.; et al. Current concepts and prospects of mulberry fruits for nutraceutical and medicinal benefits. Curr. Opin. Food Sci. 2021, 40, 121–135. [Google Scholar] [CrossRef] [Scilit]
  6. Guha, A.; Reddy, A.R. Leaf Functional Traits and Stem Wood Characteristics Influencing Biomass Productivity of Mulberry (Morus spp. L) Genotypes Grown in Short-Rotation Coppice System. Bioenerg. Res. 2013, 6, 547–563. [Google Scholar] [CrossRef] [Scilit]
  7. Lu, L.; Tang, Y.; Xie, J.; Yuan, Y. The role of marginal agricultural land-based mulberry planting in biomass energy production. Renew. Energ. 2009, 34, 1789–1794. [Google Scholar] [CrossRef] [Scilit]
  8. Andallu, B.; Suryakantham, V.; Lakshmi Srikanthi, B.; Reddy, G.K. Effect of mulberry (Morus indica L.) therapy on plasma and erythrocyte membrane lipids in patients with type 2 diabetes. Clin. Chim. Acta. 2001, 314, 47–53. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  9. Dubey, V.; Khan, S.; Shah, K.W.; Raghuwanshi, R. Standardization of Protocol for In Vitro Micropropagation of Morus alba L., An Important Economical and Medicinal Plant. J. Pharm. Biomed. 2020, 8, 46. [Google Scholar] [CrossRef] [Scilit]
  10. Baranwal, V.; Negi, N.; Khurana, P. Genome-wide Identification and Structural, Functional and Evolutionary Analysis of WRKY Components of Mulberry. Sci. Rep. 2016, 6, 30794. [Google Scholar] [CrossRef] [Scilit]
  11. Vijayan, K.; Arunakumar, G.S.; Gnanesh, B.N.; Sangannavar, P.A.; Ramesha, A.; Zhao, W. Genomic Designing for Biotic Stress Resistance in Mulberry. In Genomic Designing for Biotic Stress Resistant Technical Crops; Kole, C., Ed.; Springer: Cham, Switzerland, 2022. [Google Scholar] [CrossRef] [Scilit]
  12. Guy, J.L.; Mor, G.G. Transcription Factor-Binding Site Identification and Enrichment Analysis. Methods Mol. Biol. 2021, 2255, 241–261. [Google Scholar] [CrossRef] [Scilit]
  13. Garg, A.; Futcher, B.; Leatherwood, J.K. A new transcription factor for mitosis: In Schizosaccharomyces pombe, the RFX transcription factor Sak1 works with forkhead factors to regulate mitotic expression. Nucleic Acids Res. 2015, 43, 6874–6888. [Google Scholar] [CrossRef] [Scilit]
  14. Jofuku, K.D.; den Boer, B.G.; Van Montagu, M.; Okamuro, J.K. Control of Arabidopsis flower and seed development by the homeotic gene APETALA2. Plant Cell. 1994, 6, 1211–1225. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Wessler, S.R. Homing into the origin of the AP2 DNA binding domain. Trends Plant Sci. 2005, 10, 54–56. [Google Scholar] [CrossRef] [Scilit]
  16. Agarwal, P.K.; Agarwal, P.; Reddy, M.K.; Sopory, S.K. Role of DREB transcription factors in abiotic and biotic stress tolerance in plants. Plant Cell Rep. 2006, 25, 1263–1274. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Ma, Z.; Hu, L.; Jiang, W. Understanding AP2/ERF Transcription Factor Responses and Tolerance to Various Abiotic Stresses in Plants: A Comprehensive Review. Int. J Mol. Sci. 2024, 25, 893. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Chen, Q.; Zhuo, W.; Luo, J.; Yang, S.Y.; Lu, L.M.; Li, L.Q. Expression vector construction and expression pattern analysis of ERF gene NtRAP2-7 in tobacco. Acta Agri. Boreali Sin. 2018, 33, 104–111. [Google Scholar]
  19. Gutterson, N.; Reuber, T.L. Regulation of disease resistance pathways by AP2/ERF transcription factors. Curr. Opin. Plant Biol. 2004, 7, 465–471. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  20. Karanja, B.K.; Xu, L.; Wang, Y.; Tang, M.; M’mbone Muleke, E.; Dong, J.; Liu, L. Genome-wide characterization of the AP2/ERF gene family in radish (Raphanus sativus L.): Unveiling evolution and patterns in response to abiotic stresses. Gene 2019, 718, 144048. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  21. Ritonga, F.N.; Ngatia, J.N.; Wang, Y.; Khoso, M.A.; Farooq, U.; Chen, S. AP2/ERF, an important cold stress-related transcription factor family in plants: A review. Physiol. Mol. Biol. Plants 2021, 27, 1953–1968. [Google Scholar] [CrossRef] [Scilit]
  22. Kim, S.Y.; Kim, Y.C.; Lee, J.H.; Oh, S.K.; Chung, E.; Lee, S.; Lee, Y.H.; Choi, D.; Park, J.M. Identification of a CaRAV1 possessing an AP2/ERF and B3 DNA-binding domain from pepper leaves infected with Xanthomonas ax-onopodis pv. glycines 8ra by differential display. Biochim. Biophys. Acta 2005, 1729, 141–146. [Google Scholar] [CrossRef] [Scilit]
  23. Hassan, S.; Berk, K.; Aronsson, H. Evolution and identification of DREB transcription factors in the wheat genome: Modeling, docking and simulation of DREB proteins associated with salt stress. J. Biomol. Struct. Dyn. 2022, 40, 7191–7204. [Google Scholar] [CrossRef] [Scilit]
  24. Zhao, M.; Haxim, Y.; Liang, Y.; Qiao, S.; Gao, B.; Zhang, D.; Li, X. Genome-wide investigation of AP2/ERF gene family in the desert legume Eremosparton songoricum: Identification, classification, evolution, and expression profiling under drought stress. Front. Plant Sci. 2022, 13, 885694. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Nakano, T.; Suzuki, K.; Fujimura, T.; Shinshi, H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006, 140, 411–432. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Zhao, J.L.; Yao, W.J.; Wang, S.J.; Jiang, T.B.; Zhou, B.R. Bioinformatics analysis of poplar AP2/ERF transcription factor family. J. Northeast Univ. 2015, 43, 21–29. [Google Scholar]
  27. Chen, Y.; Sun, M.Z.; Jia, B.W.; Leng, Y.; Sun, X.L. Advances in molecular mechanisms of rice AP2/ERF transcription factors involved in stress response. Zuo Wu Xue Bao 2022, 48, 781–790. [Google Scholar]
  28. Zhang, J.; Liao, J.; Ling, Q.; Xi, Y.; Qian, Y. Genome-wide identification and expression profiling analysis of maize AP2/ERF superfamily genes reveal essential roles in abiotic stress tolerance. BMC Genom. 2022, 23, 125. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  29. Chen, K.; Zhang, J.; Liu, J.F.; Yang, J.B.; Li, M.X.; Chen, J.B.; Yang, S.Q. Bioinformatics identification and characterization of mung bean AP2/ERF transcription factor family. Mol. Plant Breed. 2020, 18, 6605–6617. [Google Scholar]
  30. Huang, Y.Z.; Qian, W.; Qiu, S.; Wang, W.X.; Huang, H.H.; Lin, E.P. Identification and expression analysis of AP2/ERF gene family in Betula alba. J. Zhejiang AF Univ. 2022, 39, 1183–1193. [Google Scholar]
  31. Hu, Y.X.; Wang, Y.X.; Liu, X.F.; Li, J.Y. Arabidopsis RAV1 is down-regulated by brassinosteroid and may act as a negative regulator during plant development. Cell Res. 2004, 14, 8–15. [Google Scholar] [CrossRef] [Scilit]
  32. Sohn, K.H.; Lee, S.C.; Jung, H.W.; Hong, J.K.; Hwang, B.K. Expression and functional roles of the pepper pathogen-induced transcription factor RAV1 in bacterial disease resistance, and drought and salt stress tolerance. Plant Mol. Biol. 2006, 61, 897–915. [Google Scholar] [CrossRef] [Scilit]
  33. Li, X.J.; Li, M.; Zhou, Y.; Hu, S.; Hu, R.; Chen, Y.; Li, X.B. Overexpression of cotton RAV1 gene in Arabidopsis confers transgenic plants high salinity and drought sensitivity. PLoS ONE 2015, 10, e0118056. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Zhang, G.; Chen, M.; Li, L.; Xu, Z.; Chen, X.; Guo, J.; Ma, Y. Overexpression of the soybean GmERF3 gene, an AP2/ERF type transcription factor for increased tolerances to salt, drought, and diseases in transgenic tobacco. J. Exp. Bot. 2009, 60, 3781–3796. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Zhu, X.; Qi, L.; Liu, X.; Cai, S.; Xu, H.; Huang, R.; Li, J.; Wei, X.; Zhang, Z. The wheat ethylene response factor transcription factor pathogen-induced ERF1 mediates host responses to both the necrotrophic pathogen Rhizoctonia cerealis and freezing stresses. Plant Physiol. 2014, 164, 1499–1514. [Google Scholar] [CrossRef] [Scilit]
  36. Hong, J.P.; Kim, W.T. Isolation and functional characterization of the Ca-DREBLP1 gene encoding a dehydration-responsive element binding-factor-like protein 1 in hot pepper (Capsicum annuum L. cv. Pukang). Planta 2005, 220, 875–888. [Google Scholar] [CrossRef] [Scilit]
  37. Wu, L.; Zhang, Z.; Zhang, H.; Wang, X.C.; Huang, R. Transcriptional modulation of ethylene response factor protein JERF3 in the oxidative stress response enhances tolerance of tobacco seedlings to salt, drought, and freezing. Plant Physiol. 2008, 148, 1953–1963. [Google Scholar] [CrossRef] [Scilit]
  38. Ito, Y.; Katsura, K.; Maruyama, K.; Taji, T.; Kobayashi, M.; Seki, M.; Shinozaki, K.; Yamaguchi-Shinozaki, K. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol. 2006, 47, 141–153. [Google Scholar] [CrossRef] [Scilit]
  39. Qin, F.; Kakimoto, M.; Sakuma, Y.; Maruyama, K.; Osakabe, Y.; Tran, L.S.; Shinozaki, K.; Yamaguchi-Shinozaki, K. Regulation and functional analysis of ZmDREB2A in response to drought and heat stresses in Zea mays L. Plant J. 2007, 50, 54–69. [Google Scholar] [CrossRef] [Scilit]
  40. Gilmour, S.J.; Sebolt, A.M.; Salazar, M.P.; Everard, J.D.; Thomashow, M.F. Overexpression of the Arabidopsis CBF3 transcriptional activator mimics multiple biochemical changes associated with cold acclimation. Plant Physiol. 2000, 124, 1854–1865. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  41. Zhang, H.; Pan, X.; Liu, S.; Lin, W.; Li, Y.; Zhang, X. Genome-wide analysis of AP2/ERF transcription factors in pineapple reveals functional divergence during flowering induction mediated by ethylene and floral organ development. Genomics 2021, 113, 474–489. [Google Scholar] [CrossRef] [Scilit]
  42. Ye, B.B.; Shang, G.D.; Pan, Y.; Xu, Z.G.; Zhou, C.M.; Mao, Y.B.; Bao, N.; Sun, L.; Xu, T.; Wang, J.W. AP2/ERF Transcription Factors Integrate Age and Wound Signals for Root Regeneration. Plant Cell 2020, 32, 226–241. [Google Scholar] [CrossRef] [Scilit]
  43. Soma, F.; Kitomi, Y.; Kawakatsu, T.; Uga, Y. Life-Cycle Multiomics of Rice Shoots Reveals Growth Stage-Specific Effects of Drought Stress and Time-Lag Drought Responses. Plant Cell Physiol. 2024, 65, 156–168. [Google Scholar] [CrossRef] [Scilit]
  44. Dossa, K.; Wei, X.; Li, D.; Fonceka, D.; Zhang, Y.; Wang, L.; Yu, J.; Boshou, L.; Diouf, D.; Cissé, N.; et al. Insight into the AP2/ERF transcription factor superfamily in sesame and expression profiling of DREB subfamily under drought stress. BMC Plant Biol. 2016, 16, 171. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. Swinka, C.; Hellmann, E.; Zwack, P.; Banda, R.; Rashotte, A.M.; Heyl, A. Cytokinin Response Factor 9 Represses Cytokinin Responses in Flower Development. Int. J. Mol. Sci. 2023, 24, 4380. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Ma, B.; Wang, H.; Liu, J.; Chen, L.; Xia, X.; Wei, W.; Yang, Z.; Yuan, J.; Luo, Y.; He, N. The gap-free genome of mulberry elucidates the architecture and evolution of polycentric chromosomes. Hortic. Res. 2023, 10, uhad111. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  47. Chen, C.; Wu, Y.; Li, J.; Wang, X.; Zeng, Z.; Xu, J.; Liu, Y.; Feng, J.; Chen, H.; He, Y.; et al. TBtools-II: A “one for all, all for one” bioinformatics platform for biological big-data mining. Mol. Plant. 2023, 16, 1733–1742. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  48. Jiao, F.; Luo, R.; Dai, X.; Liu, H.; Yu, G.; Han, S.; Lu, X.; Su, C.; Chen, Q.; Song, Q.; et al. Chromosome-Level Reference Genome and Population Genomic Analysis Provide Insights into the Evolution and Improvement of Domesticated Mulberry (Morus alba). Mol. Plant 2020, 13, 1001–1012. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  49. Li, B.; Dewey, C.N. RSEM: Accurate transcript quantification from RNA-Seq data with or without a reference genome. BMC Bioinform. 2011, 12, 323. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  50. Charfeddine, M.; Saïdi, M.N.; Charfeddine, S.; Hammami, A.; Gargouri Bouzid, R. Genome-wide analysis and expression profiling of the ERF transcription factor family in potato (Solanum tuberosum L.). Mol. Biotechnol. 2015, 57, 348–358. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  51. Han, Y.P.; Bo, F.S.; Tian, L.Z.; Jiang, H.P.; Zhao, X. Bioinformatic analysis of AP2/EREBP transcription factors associated with resistance to soybean cystonematode disease. J. Northeast. Univ. 2020, 51, 1–8+73. [Google Scholar]
  52. Sharma, M.K.; Kumar, R.; Solanke, A.U.; Sharma, R.; Tyagi, A.K.; Sharma, A.K. Identification, phylogeny, and transcript profiling of ERF family genes during development and abiotic stress treatments in tomato. Mol. Genet. Genom. 2020, 284, 455–475. [Google Scholar] [CrossRef] [Scilit]
  53. Kasuga, M.; Miura, S.; Shinozaki, K.; Yamaguchi-Shinozaki, K. A combination of the Arabidopsis DREB1A gene and stress-inducible rd29A promoter improved drought- and low-temperature stress tolerance in tobacco by gene transfer. Plant Cell Physiol. 2004, 45, 346–350. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Krishnaswamy, S.; Verma, S.; Rahman, M.H.; Kav, N.N. Functional characterization of four APETALA2-family genes (RAP2.6, RAP2.6L, DREB19 and DREB26) in Arabidopsis. Plant Mol. Biol. 2011, 75, 107–127. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  55. Chen, H.; Liu, L.; Wang, L.; Wang, S.H.; Cheng, X.Z. VrDREB2A, a DREB-binding transcription factor from Vigna radiata, increased drought and high-salt tolerance in transgenic Arabidopsis thaliana. J. Plant Res. 2016, 129, 263–273. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  56. Rong, W.; Qi, L.; Wang, A.; Ye, X.; Du, L.; Liang, H.; Xin, Z.; Zhang, Z. The ERF transcription factor TaERF3 promotes tolerance to salt and drought stresses in wheat. Plant Biotechnol. J. 2014, 12, 468–479. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Liu, J.; Yang, R.; Liang, Y.; Wang, Y.; Li, X. The DREB A-5 Transcription Factor ScDREB5 from Syntrichia caninervis Enhanced Salt Tolerance by Regulating Jasmonic Acid Biosynthesis in Transgenic Arabidopsis. Front. Plant Sci. 2022, 13, 857396. [Google Scholar] [CrossRef] [Scilit]
  58. Zhu, Q.; Zhang, J.; Gao, X.; Tong, J.; Xiao, L.; Li, W.; Zhang, H. The Arabidopsis AP2/ERF transcription factor RAP2.6 participates in ABA, salt and osmotic stress responses. Gene 2010, 57, 1–12. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Chromosome arrangement of MnAP2/ERF gene family members in M. notabilis. Different colors indicate different subgroups: Black indicates the ERF subfamily; green indicates the AP2 subfamily; yellow indicates the DREB subfamily; blue indicates the RAV subfamily; red indicates the Soloist subfamily.
Figure 1. Chromosome arrangement of MnAP2/ERF gene family members in M. notabilis. Different colors indicate different subgroups: Black indicates the ERF subfamily; green indicates the AP2 subfamily; yellow indicates the DREB subfamily; blue indicates the RAV subfamily; red indicates the Soloist subfamily.
Forests 15 00697 g001
Figure 2. Evolutionary tree of AP2/ERF gene family in M. notabilis and A. thaliana. Red stars represent AP2/ERF family genes in M. notabilis; yellow triangles represent AP2/ERF family genes in A. thaliana.
Figure 2. Evolutionary tree of AP2/ERF gene family in M. notabilis and A. thaliana. Red stars represent AP2/ERF family genes in M. notabilis; yellow triangles represent AP2/ERF family genes in A. thaliana.
Forests 15 00697 g002
Figure 3. Gene structure and protein conserved motifs of MnAP2/ERF gene family.
Figure 3. Gene structure and protein conserved motifs of MnAP2/ERF gene family.
Forests 15 00697 g003
Figure 4. Cis-acting elements of the promoter of the MnAP2/ERF gene family.
Figure 4. Cis-acting elements of the promoter of the MnAP2/ERF gene family.
Forests 15 00697 g004
Figure 5. Prediction for tertiary structure of MnAP2/ERF proteins.
Figure 5. Prediction for tertiary structure of MnAP2/ERF proteins.
Forests 15 00697 g005
Figure 6. PPI of MnAP2/ERF and AtAP2/ERF proteins. Red represents the AP2/ERF gene family proteins of M. notabilis, and green represents the AP2/ERF gene family proteins of A. thaliana.
Figure 6. PPI of MnAP2/ERF and AtAP2/ERF proteins. Red represents the AP2/ERF gene family proteins of M. notabilis, and green represents the AP2/ERF gene family proteins of A. thaliana.
Forests 15 00697 g006
Figure 7. Collinearity analysis of AP2/ERF gene families in different species. (A) Collinearity analysis of the MnAP2/ERF gene families in M. notabilis; (B) collinearity analysis of the AP2/ERF gene families in M. notabilis and A. thaliana. Each red line represents a gene repetition event, the heat map and line graph in A represent the density of mulberry genes in each chromosome, and Chr represents the number of chromosomes.
Figure 7. Collinearity analysis of AP2/ERF gene families in different species. (A) Collinearity analysis of the MnAP2/ERF gene families in M. notabilis; (B) collinearity analysis of the AP2/ERF gene families in M. notabilis and A. thaliana. Each red line represents a gene repetition event, the heat map and line graph in A represent the density of mulberry genes in each chromosome, and Chr represents the number of chromosomes.
Forests 15 00697 g007
Figure 8. Expression analysis of the MnAP2/ERF gene family in five tissues.
Figure 8. Expression analysis of the MnAP2/ERF gene family in five tissues.
Forests 15 00697 g008
Table 1. Conserved motif sequence of MnAP2/ERF proteins.
Table 1. Conserved motif sequence of MnAP2/ERF proteins.
MotifLength/aaConserved Amino Acid Sequences
Motif 126VWLGTFDTAEEAARAYDVAALKLRGS
Motif 211RPWGKWVAEIR
Motif 350RAYDLAALKYWGPSTTINFPLSBYEKELEEMKNMTKZEFVASLRRKSSGF
Motif 411RRSSKYRGVRR
Motif 511KAKLNFPELTY
Motif 629HRWTGRYEAHLWDNSCRREGQSRKGRQGA
Motif 723SLPRPASTDAKDIQAAAAEAAAA
Motif 841EEEZRVFYVDEEEVFGMPSFFADLAEGLLLSPPPSYMSSDD
Motif 911GASQYRGVTRH
Motif 1017VIELEYLDDKYLEELLD
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Dou, H.; Wang, T.; Zhou, X.; Feng, X.; Tang, W.; Quan, J.; Bi, H. Genome-Wide Identification and Expression of the AP2/ERF Gene Family in Morus notabilis. Forests 2024, 15, 697. https://doi.org/10.3390/f15040697

AMA Style

Dou H, Wang T, Zhou X, Feng X, Tang W, Quan J, Bi H. Genome-Wide Identification and Expression of the AP2/ERF Gene Family in Morus notabilis. Forests. 2024; 15(4):697. https://doi.org/10.3390/f15040697

Chicago/Turabian Style

Dou, Hao, Tiantian Wang, Xin Zhou, Xi Feng, Wu Tang, Jin’e Quan, and Huitao Bi. 2024. "Genome-Wide Identification and Expression of the AP2/ERF Gene Family in Morus notabilis" Forests 15, no. 4: 697. https://doi.org/10.3390/f15040697

APA Style

Dou, H., Wang, T., Zhou, X., Feng, X., Tang, W., Quan, J., & Bi, H. (2024). Genome-Wide Identification and Expression of the AP2/ERF Gene Family in Morus notabilis. Forests, 15(4), 697. https://doi.org/10.3390/f15040697

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop