Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532.

Noura Al-Zamel; Suleiman Al-Sabah; Yunus Luqmani; Lobna Adi; Siby Chacko; Tom Dario Schneider; Cornelius Krasel

doi:10.3390/ijms21093357

You are currently on the new version of our website. Access the old version .

Correction to Int. J. Mol. Sci. 2019, 20(14), 3532.

Correction

9 May 2020

Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532.

and

Department of Pharmacology & Toxicology, Faculty of Medicine, Kuwait University, PO Box 24923, 13110 Safat, Kuwait

Department of Pharmaceutical Chemistry, Faculty of Pharmacy, Kuwait University, PO Box 24923, 13110 Safat, Kuwait

Institute of Forensic Medicine, Department of Forensic Pharmacology and Toxicology, University of Zurich, 190/52 CH-8057 Zurich, Switzerland

⁴

School of Pharmacy, Institute for Pharmacology and Toxicology, The Philipps University of Marburg, Karl-von-Frisch-Straße, 135033 Marburg, Germany

Int. J. Mol. Sci.2020, 21(9), 3357;https://doi.org/10.3390/ijms21093357

Version Notes

Order Reprints

The author wishes to make the following correction to this paper [1]. Due to mislabeling, replace: Ijms 21 03357 i001

with

There is an error in the peptide sequence of GIP in Figure 1. Two amino acid residues are missing. The correct sequence for GIP is: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ. The authors would like to apologize for any inconvenience caused to the readers by these changes.

References

Al-Zamel, N.; Al-Sabah, S.; Luqmani, Y.; Adi, L.; Chacko, S.; Schneider, T.D.; Krasel, C. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532. [Google Scholar] [CrossRef] [PubMed]

© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).

Article Metrics

Citations

Article Access Statistics

Journal Statistics

Multiple requests from the same IP address are counted as one view.

Swiprosin-1/EFhD-2 Expression in Cardiac Remodeling and Post-Infarct Repair: Effect of Ischemic Conditioning

Genome-Wide Association and Prediction of Traits Related to Salt Tolerance in Autotetraploid Alfalfa (Medicago sativa L.)