Abstract
Polysialic acid (polySia) is an unusual glycan that posttranslational modifies neural cell adhesion molecule (NCAM) proteins in mammalian cells. The up-regulated expression of polySia-NCAM is associated with tumor progression in many metastatic human cancers and in neurocognitive processes. Two members of the ST8Sia family of α2,8-polysialyltransferases (polySTs), ST8Sia II (STX) and ST8Sia IV (PST) both catalyze synthesis of polySia when activated cytidine monophosphate(CMP)-Sialic acid (CMP-Sia) is translocate into the lumen of the Golgi apparatus. Two key polybasic domains in the polySTs, the polybasic region (PBR) and the polysialyltransferase domain (PSTD) areessential forpolysialylation of the NCAM proteins. However, the precise molecular details to describe the interactions required for polysialylation remain unknown. In this study, we hypothesize that PSTD interacts with both CMP-Sia and polySia to catalyze polysialylation of the NCAM proteins. To test this hypothesis, we synthesized a 35-amino acid-PSTD peptide derived from the ST8Sia IV gene sequence and used it to study its interaction with CMP-Sia, and polySia. Our results showed for the PSTD-CMP-Sia interaction, the largest chemical-shift perturbations (CSP) were in amino acid residues V251 to A254 in the short H1 helix, located near the N-terminus of PSTD. However, larger CSP values for the PSTD-polySia interaction were observed in amino acid residues R259 to T270 in the long H2 helix. These differences suggest that CMP-Sia preferentially binds to the domain between the short H1 helix and the longer H2 helix. In contrast, polySia was principally bound to the long H2 helix of PSTD. For the PSTD-polySia interaction, a significant decrease in peak intensity was observed in the 20 amino acid residues located between the N-and C-termini of the long H2 helix in PSTD, suggesting a slower motion in these residues when polySia bound to PSTD. Specific features of the interactions between PSTD-CMP-Sia, and PSTD-polySia were further confirmed by comparing their 800 MHz-derived HSQC spectra with that of PSTD-Sia, PSTD-TriSia (DP 3) and PSTD-polySia. Based on the interactions between PSTD-CMP-Sia, PSTD-polySia, PBR-NCAM and PSTD-PBR, these findingsprovide a greater understanding of the molecular mechanisms underlying polySia-NCAM polysialylation, and thus provides a new perspective for translational pharmacological applications and development by targeting the two polysialyltransferases.
1. Introduction
The α2-8-linked polysialic acid (polySia) glycans are oncodevelopmental, tumor-associated cell surface antigens that covalently modify the neural cell adhesion molecule (NCAM) proteins in mammalian cells. PolySia-NCAMs play key roles in modulating cell-cell interactions during embryonic neural development, synaptic plasticity, synaptogenesis, neural stem cell proliferation, differentiation and tumor metastasis [1,2,3,4,5]. The same polySia-NCAM proteins are also of critical importance in neurodevelopment, learning memory, and intestinal development in neonatal piglets [6,7].
Synthesis of polySia is catalyzed by two polysialyltransferases (polySTs), designated ST8Sia II (STX) and ST8Sia IV (PST). The finding that polyST gene “knock-down” experiments negates events associated with tumor cell dissemination indicates that polySTs are validated targets for potential drug therapies [8,9,10,11,12,13]. It is also known that cytidine monophosphate (CMP)-sialic acid (CMP-Sia), the activated nucleotide sugar of N-acetylneuraminic acid (Neu5Ac; Sia) [14,15,16,17,18,19], is required by the polySTs for biosynthesis of polySia [9,13,20,21]. Accordingly, it has been proposed that ST8Sia II/IV may interact with CMP-Sia and polySia in the lumen of the Golgi apparatus to catalyze synthesis of the polySia-NCAM protein [20,21,22,23,24,25].
Neither X-ray crystal or NMR-derived structures of the mammalian polySTs have been reported, due in part to the presence of a large number of hydrophobic amino acids in the membrane environment, and random domains in these enzymes. This has made it difficult to obtain adequate 3-D crystal structures. Encouragingly, the predicted 3-D structures of ST8Sia II (Figure 1a) and ST8Sia IV (Figure 1b) have been confirmed to be accurate 3-D models [26,27]. However, in order to study the dynamics and interactions of biomolecule-biomolecule or biomolecule-ligand, it is necessary to obtain 3-D solution structure of the specific biomolecule or peptide.
Figure 1.
Theoretical models of human ST8Sia II (a) and ST8Sia IV (b) developed using the Phyre2 server. The basic residues in polysialyltransferase domain (PSTD, yellow) and polybasic region (PBR, blue) are labeled in red. The shortest distance between PBR and PSTD is 4–5 Å.
Based on mutational analysis of ST8Sia II and ST8Sia IV, two polybasic motifs, designated the polysialyltransferase domain (PSTD) of 32-amino acids [28] and the polybasic region (PBR) of 35-amino acids [29] within both of the polySTs were discovered to be essential for polyST activity, leading to polysialylation of the NCAM protein. Accordingly, two similar hypotheses were proposed to describe the role of PSTD and PBR in catalyzing the specific polysialylation of NCAM. In the first, the interaction within the Golgi of the PSTD peptide domain within ST8Sia II/IV with CMP-Sia, and the polySia moiety of polySia-NCAM glycoprotein, are of key importance, while in the second, it is the interaction between PBR-NCAM, PSTD-CMP-Sia and the PSTD-polySia that are also important [26,27,28,29].
The interaction between PBR and NCAM was confirmed in NMR studies by Colley and colleagues in which the basic amino acid residues in the PBR of ST8Sia IV were found to be bind directly to the acidic patch in NCAM [30]. In our present studies, we initiated structural studies of the interactive binding of PSTD and CMP-Sia, TriSia (DP 3) and polySia using NMR and molecular modeling approaches [31].
Our present studies confirm that CMP-Sia and polySia interact with PSTD with different binding affinities. This finding was further confirmed by comparing their 800 MHz-determined HSQC spectra with PSTD-Sia, PSTD- DP 3 and PSTD-PolySia spectra. Accordingly, we have integrated these new NMR results with previous findings on the interactions of PBR-NCAM, and PBR-PSTD, to describe the interactions of polySia-NCAM polysialylation, which is also based on the interaction of PSTD-CMP-Sia and PSTD-polySia in ST8Sia IV. These molecular interactions also provide a potential perspective for rational drug design to target the polySTs that regulate polysialylation.
2. Results and Discussion
2.1. Structural Conformational Features of PSTD in ST8Sia IV
The atomic coordinate files for the 32-amino acid PSTD were recently deposited in the Protein Data Bank with the accession code of 6AHZ. The chemical shift assignments were also deposited in the Biological Magnetic Resonance Data Bank, with the accession number 36,207—available online: http://www.bmrb.wisc.edu (accessed on 24 October 2018).
Our NMR derived 3-D structural model was analyzed using the Pymol software (http://www.pymol.org/) and Discovery Studio Visualizer (Accelrys, Inc., San Diego, CA, USA). The model showed a short helix (H1: L249-K250-V251), a longer helix (H2: S257-N271), and a short C-terminal loop (C-Loop: I275-K276-R277) (Figure 2a). A similar structural configuration was also found in the predicted PSTD model of ST8Sia IV [26,27] using the Phyre2 sever [31], in which the helical range of the short 3-residue helix (H1) is from K250 to R252. And the 12-residue longer helix (H2) is from L258 to L269 (Figure 2b). In addition, the remaining domains in these two models are all unstructured, except for H1, H2 and the C-loop (Figure 2). These structural comparisons provide further evidence that the NMR-derived PSTD structure is consistent with the predicted PSTD configuration in ST8Sia IV (Figure 2a) [26,27].
Figure 2.
3-D structural backbone models of PSTD in ST8Sia IV, based on NMR spectroscopy (a), and the Phyre2 server (b). The short helix and the long helix are labeled H1 and H2, respectively.
Based on our 3-D derived molecular model (Figure 2a), a total of 18 residues in the 32-amino acid PSTD in ST8Sia IV are α-helices. Therefore, 56% of the residues in the PSTD structure have a helical configuration. As shown in Figure 3, our circular dichroism (CD) spectrum confirms that the main secondary structure of the PSTD peptide remains α-helical, even in the presence of polySia, and less than half of the structure is a random-coil.
Figure 3.
Circular dichroism (CD) spectra of the PSTD peptide from ST8Sia IV in the absence and presence of sialic acid (Sia), cytidine monophosphate-sialic acid (CMP-Sia) and polysialic acid (polySia).
2.2. Molecular Interaction between CMP-Sia and PSTD in ST8Sia IV
A Summary: Hypothesis and Biosynthesis of PolySia.
The pathway for biosynthesis of CMP-Sia in all eukaryotic cells is initiated in the cytosol with synthesis of Sia, which is translocated to the nucleus where it is activated with CTP to form CMP-Sia [13,21,25,32,33]. CMP-Sia then returns to the cytosol by an unknown mechanism and is subsequently transported into the lumen of the Golgi by a specific CMP-Sia anti-transporter (CMP-SiaTr), where it serves as the activated Sia donor substrate for polysialylation, catalyzed by either ST8Sia II or ST8Sia IV.
Thus, our working hypothesis is an interactive model that describe how the critically essential PSTD peptide moiety within both ST8Sia II and ST8Sia IV interacts with CMP-Sia and the growing polySia chain to catalyze polysialylation of the N-linked glycans on NCAM proteins. This interaction is a processive reaction whereby the activated Sia moiety on CMP-Sia functions as the Sia donor for the Sia to be transferred to the elongating non-reducing terminus of the growing N-linked glycan on the NCAM glycoprotein [22,25,28].
Our hypothesis is thus consistent with, and predicts, a specific molecular interaction between CMP-Sia andST8Sia IV and PSTD-polySia in the Golgi. This supposition has been confirmed in our 800 MHz studies, as described below.
The interaction between protein–protein or a protein–ligand was confirmed in our studies using two-dimensional 1H-15N HSQC NMR studies, which correlates the 15N frequency (chemical shift) with the directly attached 1H [34]. For a uniformly 15N-labeled protein, the 1H-15N HSQC spectrum showed chemical shifts of amide 15N and 1H for every single amino acid from cross peaks [34,35,36,37,38,39,40,41,42,43,44,45,46,47,48,49,50,51,52,53,54,55]. Because chemical shifts of amides in a protein or peptide are very sensitive to environmental changes including pH, temperature or binding of other ligands, the extent of strong or weak interactions of protein-protein or peptide-ligand interactions are reflected by large or small chemical shift perturbations (CSP) [35]. Generally, CSP of a binding complex is determined through the minimum deviation between each position of the free and the complexed peak in the 1H-15N HSQC spectra [28]. Chemical shift changes can be observed when the CSP value of an amino acid is larger than 0.02 [35].
Accordingly, to confirm a specific interaction between CMP-Sia and PSTD, the overlaid 2D 1H-15N HSQC spectra were obtained in the presence and absence of polySia. As showed in Figure 4a, chemical-shift perturbations were evident in the three amino acid segments, K246-A254, S257-L258, and G266-R277, which are primarily located in the N-terminus region of PSTD (K246-A254), the N-terminus of the long helix H2 (S257-L258), and the C-terminus of PSTD (G266-R277).
Figure 4.
The overlaid 1H-15N HSQC spectra of PSTD in ST8Sia IV at 800 MHz in the absence (black) and presence (red) of CMP-Sia (a) and polySia (b). The CSP values for the PSTD-CMP-Sia interaction are shown in blue, and the PSTD-polySia interactions in red (c).
Among these amino acids, all seven basic residues (K246, K250, R252, H262, K272, K276, R277) and one non-basic residue (I275) are located in the N-terminus, middle and C-terminus of PSTD, as confirmed by site-directed mutagenesis to be critically important for polysialylation of NCAM [28]. However, our NMR findings (Figure 4) further suggest that other non-basic amino acid residues, viz. V251, T253, A254, S257, L258, N271, and V273 are also likely required for polysialylation of the NCAM protein. These NMR results further support our earlier studies showing that the polysialyltransferase activity of ST8Sia IV was not solely dependent on increasing the basicity of PSTD [28].
2.3. Specificity of the Interaction of PSTD-Sia, PSTD- DP3, PST- CMP-Sia and PSTD-polySia
While neither free Sia nor DP 3 are normally found in the Golgi, they remain relevant for comparing their functional interaction with PSTD and the polydisperse chains of polySia with DP’s extending up to >400 Sia residues [56]. Accordingly, we compared the specificity of the interaction of PSTD-CMP-Sia with the interaction of PSTD-Sia, PSTD-DP3 and PSTD-polySia.
As shown in Table 1, Figure A1a in Appendix A, the largest chemical-shift perturbations (CSP > 0.02) are displayed in three amino acid residual ranges, K246-A254, S257-L258, and G266-R277 for the PSTD-Sia interaction and the two residual ranges from K246 to T253, and G266 to T270 for the PSTD-DP 3 interaction.
Table 1.
Major features of the overlaid 1H-15N HSQC spectra of PSTD in the absence and presence of Sia, TriSia, CMP-Sia and polySia.
A common feature is that the larger CSP values (CVP > 0.02) are principally distributed in the N-terminus region of PSTD for the interactions with the three sialyl derivatives. The short helix (L249-V251) is also involved in this amino acid range (Table 1; Figure A1). Although the largest CSP values of the three sialyl interactions are all distributed in the same amino acid residues (V251-A254), the CSP values for the PSTD-Sia interaction are considerably larger than for the interactions between PSTD-CMP-Sia and PSTD-DP 3 (Figure A2). Based on a comparison of the three curves in Figure A2, we conclude that the binding site for the interaction between PSTD-CMP-Sia is between PSTD-Sia and the binding site of PSTD-DP 3.
Also notable from these NMR findings is the interaction between PSTD-Sia, but not PSTD-CMP-Sia, the former showing significant changes in the chemical shift values for amino acid residues V264, Y267, W268, and L269 for PSTD-Sia, but not for PSTD-CMP-Sia. Accordingly, these differences suggest that the configuration of the long H2 helix may be more stable in the interaction between PSTD-CMP-Sia than between PSTD-Sia or between PSTD-DP 3.
2.4. Interaction between PSTD and PolySia
The overlay of the 2D 1H-15N HSQC spectra of PSTD in the absence and presence of polySia are shown in Figure 4b. The following key findings are noted:
- 1.
- The large chemical-shift perturbations (CSP>0.02) are most prominent in the N-terminus amino acids K248 to A254, for the PSTD-polySia interaction, and are less than for the interactions between PSTD-CMP-Sia, PSTD-Sia and PSTD-DP3 (Figure A2). The CSP values for amino acids V260-T270 are also much greater for the interaction between PSTD-polySia than for the interactions between PSTD-CMP-Sia and PSTD-DP 3 (Table 1; Figure 4c). This finding is consistent with a conformational change in the long H2 helix in PSTD, following its interaction with polySia.
- 2.
- These findings also show that the CSP values for the PSTD-polySia interaction in the C-terminus region (from 270 to S279) show small chemical shift perturbations (CSP < 0.02), which are less than for the interaction between PSTD-CMP-Sia and PSTD-Sia (Figure 4c, Figure A2). These results indicate that the predominantly small CSP values are located in the non-structural domains, while the larger CSP values are located on the long H2 helix for the interaction between PSTD-polySia (Figure 4c).
- 3.
- The amide cross-peak intensities for the 20 amino acid PSTD peptide were significantly decreased after interaction with polySia. The binding interaction between PSTD and polySia was characterized by broadening NMR signals that appeared in most amino acid residues except V251, V273, I275, K276, and R277 (Figure 4b and Table 1). This suggests a very slow conformational exchange or slow motion during the PSTD-polySia interaction. It is reasonable to expect that a decrease in the rate of tumbling occurs when a significantly larger ligand, such as the polydisperse polySia chains are bound to a protein or peptide [57,58,59,60,61]. The polySia-PSTD interaction is particularly evident, as seen in both the large chemical-shift perturbations, and the significant decrease in cross-peak intensity of amides that are observed in the 4 amino acid residues, V264, Y267, W268 and L269, consistent with the occurrence of both a conformational change and a slower motion in the C-terminus of the long H2 helix.
Because neither Sia nor oligo-polySia exists free in the Golgi [28,29], there is no interaction between either of these two sugars and the polySTs. Therefore, CMP-Sia in the Golgi must interact first with PSTD region within the polySTs to initiate polysialylation on the N-glycan chains covalently linked to NCAM [12,13,22,25]. We determined this is evident by the slowing of the chemical exchange seen for the interaction between PSTD-CMP-Sia, which is slowed as elongation of the polySia chains occurs while remaining covalently linked to the N-glycan chains on the NCAM glycoprotein. This elongation reaction continues until polySia chains with DP’s exceeding 400 Sia chains is completed [56].
The level of CMP-Neu5Ac in the Golgi has been estimated to be ~0.03–0.05 mM [62]. But importantly, this level is dynamic, and will change depending on the extent of sialylated glycans that are being synthesized at any given time. In our studies, we found no difference in the NMR chemical shift and peak intensities using 0.1 and 1 mM CMP-Sia for the interaction studies of PSTD with CMP-Sia, Sia, DP 3.
2.5. Functional Importance of the Degree of Polymerization (DP) of α2,8-linked PolySia Chains Covalently Modifying NCAM Proteins Related to Present Studies
The polySia-NCAM proteins are best understood as structurally unique, oncodevelopmental, tumor-associated antigen that plays a key role in modulating cell-cell interactions, principally during embryonic neuronal development, neural plasticity and tumor metastasis [5,13,25,33]. As such, the DP of polySia on N-CAM is a key structural feature hypothesized to be of critical importance in regulating N-CAM associated functions. For example, as an anti-adhesive glycotope, re-expression of the polySia glycan on several human cancers is postulated to attenuate the adhesive property of NCAM, thus facilitating cell detachment and tumor metastasis. It was, therefore, of key importance to be able to accurately determine the DP of polySia on human cancer cells, as described below.
Several significant structural studies have been published providing insight into the importance of the DP of polySia in biochemical, physiological and molecular neurobiological processes. Among others, these studies include the dependency of the DP of polySia binding to neurotrophic factors, their interactions with lactoferrin, their regulation of fibroblast growth factor 2 (FGF) to modulate cell growth, and the cytotoxicity of histones [63,64,65,66,67,68,69,70].
While one study showed the interaction of oligoSia with a protein was as uniquely short as DP 5 for binding to endo-N-acylneuraminidase (endo-NF) [69], others studies have shown that the DP of polySia on human cancer cells and leukocytes are longer, extending to DP’s ~40 and considerably higher [23,56].
DP studies confirming these considerably higher DP values were only made possible following the development of a new experimental strategy to accurately determine the DP of polySia chains that avoided acid catalyzed hydrolysis of the chemically labile, internal α2,8-linked polySia chains that covalently modify the NCAM protein [56].
Unexpectedly, significant new information that emerged from the development of this contemporary experimental method was two-fold. First, expression of the polySia chains expressed on the cell surface of the human Neuro2a tumor cells were extremely polydisperse, with sub-populations in the DP range 150–180, and even extending to DP’s ~430 [56].
Second, while polySia is well known to modulated neuronal development [6,13,21,25], the first demonstration that polySia was expressed on primary human natural killer (NK) cells and murine leukocytes, and could modulate immune responses, was shown by Drake et al. [23]. Specifically, these studies revealed two significant new findings: (1) the DP of polySia chains on human NK cells was responsive to their activations state by interleukin 2 (IL-2) and; (2) IL-2 activation resulted in an increase expression of a polydisperse subpopulation of polySia chains (DP 11-140) and an even higher subpopulation of polySia chains with DP’s ranging from 141 to more than 400 [23].
It is, therefore, evident from these two unanticipated findings showing significant polydispersity in the length of polySia on relevant human cancer cells (Neuro2A) [56], and human NK cells [23], that the DP of the polySia chains are not restricted to only short chains (DP ~40), which was reported, as noted above, but can be markedly and extensively longer. Furthermore, of significance, is the new finding that the DP of polySia can be modulated, as in the case of NK cells, by their state of activation by IL-2.
Importantly, these new findings thus raise the fundamentally important question: “Is it the polydispersity in the length of the polySia moiety on the NCAM protein that helps explain how polySia can modulate such a surprisingly myriad of cell-cell adhesive and cell migration interactions and functions?” [6,8,13,21,24,25,31,33,67,68].
Accordingly, until this question is resolved, an incomplete understanding of crucial cellular processes in glyco-neurobiobiology, immune regulation and cancer metastasis will remain. These molecular events also include other polySia-NCAM related functions, including axon path finding, synaptogenesis, neural plasticity, cell signaling/cytokine responses, myelination, immune responses, neural stem cell (NSC) proliferations and differentiations, and neurocognitive function including learning and memory.
3. Materials and Methods
3.1. Preparations of Samples for NMR Studies
To determine the 3-D structure of PSTD using NMR spectroscopy, we synthesized a 35 amino acid peptide (L245-S279 from the gene sequence encoding the human CMP-N-acetylneuraminate-α-2,8-polysialyltransferase, ST8Sia IV, containing the 32-amino acid PSTD (from residue K246 to R277) sequence. The sequence of the 35-amino acid-PSTD peptide (L245-S279) is as follows: 245LKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKR277PS279.
The 35 amino acid-PSTD from ST8Sia IV was chemically synthesized by DG Peptides (Hangzhou City, Zhejiang Province, China). Its molecular weight was determined to be 4117.95 and its purity established to be 99.36%.
CMP-Sialic acid (CMP-Sia: C20H29N4O16P2Na), sialic acid (Sia: C11H19NO9), DP 3: C33H50N3O25Na3), and polySia were purchased from Santa Cruz Biotechnology. The molecular weight of CMP-Sia, Sia and DP3, are 636.43, 309.11, and 957.73, respectively.
The DP of polySia, when accurately determined in the absence of acidic conditions, which occurs in the DMB method for determining the chain length of polySia, is polydisperse, with DP’s ranging from ~ 5 to > 400 Sia residues [56]. The molecular weight of the sodium salt of the polySia/”Colominic acid” (Cat. No. CAS 70431-34-4: sc-239576, purified from E. coli K1) used in this study, while polydisperse, is ~31 KDa, with the average DP of ~ 95. In the present study, this sample is designated as “polySia” [56].
For both the 1-D and 2-D NMR experiments, the concentration of the 35 amino acid-PSTD peptide was 2.0 mM. The concentration of CMP-Sia, Sia and DP3 was 1 mM. For all of the NMR studies, the concentration of polySia was (0.1 mM), which was dissolved in 25%TFE (v/v), 10% D2O (v/v), and 65% (v/v) 20 mM phosphate buffer (pH 6.7). Following this, 2-Dimethyl-2-silapentane-5-sulfonic acid (DSS) was added to all samples to serve as a reference standard.
3.2. Circular Dichroism (CD) Spectroscopic Studies
All CD spectra were recorded in the far-UV region (190–260 nm) at 25 °C in a 0.02 cm path-length quartz cell on a Chirascan spectropolarimeter, Beverly, MA, USA.
The concentrations of CMP-Sia, polySia and the 35 amino acid-PSTD were 40 µM, 4 µM and 80 µM, respectively and were dissolved in 20 mM 25%TFE/75% 20 mM phosphate buffer (pH 6.7), respectively.
3.3. NMR Spectroscopy
All NMR spectra were recorded at 298 K using an Agilent DD2 800 MHz spectrometer equipped with a cold-probe in the NMR laboratory at the Guangxi Academy of Sciences. Water resonance was suppressed using pre-saturation. NOESY mixing times were set at 300 msec while the TOCSY experiments were recorded with mixing times of 80 msec. All chemical shifts were referenced to the internal DSS signal set at 0.00 ppm for proton and indirectly for carbon and nitrogen [71,72]. Data were typically apodized with a shifted sine bell window function and zero-filled to double the date points in F1 prior to Fourier transformed. NMRPipe [72] and CcpNmr (www.ccpn.ac.uk/v2-software/analysis) were used for data processing and spectral analysis, respectively. Spin system identification and sequential assignment of individual resonances were carried out using a combination of TOCSY and NOESY spectra, as previously described [72,73], and coupled with an analysis of 1H-15N and 1H-13C HSQC for overlapping resonances. In order to identify specificity of the PSTD-ligand binding, the chemical shift perturbation (CSP) of each amino acid in the PSTD was calculated using the formula:
where ΔδN and ΔδNH represent the changes in 15N and 1H chemical shifts, respectively, upon ligand binding [34,55].
CSP = [(Δδ2NH + (ΔδN/5)2)/2]1/2
3.4. Structural Calculation and Analysis of the PSTD from ST8Sia IV
Structural calculations and NOE assignments were carried out simultaneously using the CNS program [55,72] and ARIA2 [47]. Backbone dihedral angle restraints (Φ and Ψ angles) were derived using the DANGLE program incorporated in the CcpNmr suite [72]. A total of 100 structures were calculated and the 20 structures with the lowest total energy were selected to carry out a refinement procedure in water. The atomic coordinates of the peptides have been deposited in the Protein Data Bank with the accession code of 6AHZ, and the chemical shift assignments were deposited in the Biological Magnetic Resonance Data Bank with the accession number of 36,207 (http://www.bmrb.wisc.edu). The protein structure ensemble was displayed and analyzed with the Pymol software (http://www.pymol.org/) and Discovery Studio Visualizer (Accelrys, Inc., San Diego, CA, USA).
3.5. Structural Predictions of ST8Sia II and ST8Sia IV
For the structural calculations of the wild type and mutants of ST8Sia II and ST8Sia IV, the crystal structure of ST8Sia III was selected as the template (code: c5bo6B) based on Server Phyre2 server [31]. The predicted structures are based on heuristics to maximize confidence (100%), and the sequence identity was 26%. All structural models were displayed by PyMol software (https://pymol.org/2/).
4. Conclusions
Volkers et al. [61] proposed that PSTD and PBR together form an extended basic groove for substrate recognition for the processive synthesis of the growing polySia chain. Bhide et al. [30] further suggested that a possible PBR-PSTD interaction might relate to the basic surface of the polySTs for substrate recognition and/or polySia chain elongation. In our recent molecular modeling study, we found that the PBR and PSTD domains are remarkably close, the shortest distance between them being 4–6 Å (Figure 1) [27]. This finding is in accord with the previous report of Colley and colleagues [30]. Therefore, it is a reasonable supposition that an intramolecular interaction exists between PBR and PSTD in ST8Sia IV, based on the short distance between PBR and PSTD. This intramolecular interaction may thus stabilize the conformation of ST8Sia IV, and modulate polysialylation and autopolysialylation, catalyzed by ST8Sia II and ST8Sia IV [74,75].
In an impressive series of studies, Colley and colleagues among others, have provided evidence that neuropilin-2 (NRP2) and E-Selectin Ligand-1 (ESL-1) were identified as targets for polysialylation in murine microglia and human THP-1 macrophages, showing a striking convergence in the regulation of these two polysialylated acceptors during an inflammatory activation [76,77]. In addition, polySia-SynCAM 1 was identified in a subpopulation of NG2 cells, and the presence of polySia-NRP2 was established in microglia. Further, the dynamic rearrangement of polySia from retention in the Golgi compartment towards recruitment to the cell surface in response to relevant stimuli in the onset of myelination, and in the regulation of microglia activation, were also determined [76]. These findings clearly establish there are multiple targets for polysialylation catalyzed by ST8Sia II and ST8Sia IV other than NCAM proteins alone. The molecular interactions between the polySTs and these additional targets will require further studies to understand the molecular significance and biological consequences of their polysialylation.
In summary, results from our current NMR studies, and previous findings on the DP of polySia chains and the cooperative interactions between PSTD-CMP-Sia, PSTD-polySia, PBR-NCAM, and PBR-PSTD [26,27,28,29,30,63,78] now provide greater insight into key molecular processes regulating the importance of these interactions in modulating NCAM polysialylation, which underlie many of the neuronal and immune system development and cancer metastatic events in human health and disease.
Author Contributions
The manuscript was written by contributions of all authors. Conceptualization, G.-P.Z. and F.A.T.II; methodology, B.L., X.-H.L. S.-J.L. and G.-P.Z.; formal analysis, X.-H.L.; investigation, B.L.; original draft preparation, G.-P.Z. and F.A.T.II; review and editing, G.-P.Z. and F.A.T.II; visualization, Z.-L.L.; supervision, G.-P.Z. and R.-B.H.; project administration, D.C.; funding acquisition, S.-M.L., B.L. and Z.-L.L. All authors have read and agreed to the published version of the manuscript.
Funding
This research was supported by National Science Foundation of China (31560251), Guangxi Major Science and Technology Innovation Base Construction Project (2018-15-Z03-1203), Central Government Directs Special Funds for Local Science and Technology Development Projects (Guangxi Science ZY1949015), the Basic Research Program of Guangxi Academy of Sciences (2017YJJ23004), and Guangxi Natural Science Foundation (2017GXNSFBA198008).
Acknowledgments
We thank Cheng Jin and Chu-Ping Luo for their valuable discussions, our thanks also go to Li-Xin Peng, Feng Zhou and Ji-Min Huang for helping greatly.
Conflicts of Interest
The authors declare no conflicts of interest.
Abbreviations
| polySia | α2,8-linked polysialic acid |
| Sia | sialic acid (Neu5Ac; N-acetylneuraminic acid) |
| DP3 | TriSia |
| CMP-Sia | cytidine monophosphate-sialic acid |
| NCAM | neural cell adhesion molecule proteins |
| polySTs | polysialyltransferases (ST8Sia II (STX) & ST8Sia IV (PST) |
| PSTD | polysialyltransferase domain |
| PBR | polybasic region |
| DP | degree of polymerization |
| E. coli | Escherichia coli |
Appendix A
Figure A1.
The overlaid 1H-15N HSQC spectra of PSTD of ST8Sia IV in the absence (black) and presence (red) of 1 mM (a) and 1mM DP3 (b).
Figure A1.
The overlaid 1H-15N HSQC spectra of PSTD of ST8Sia IV in the absence (black) and presence (red) of 1 mM (a) and 1mM DP3 (b).

Figure A2.
Comparison of the CSPs for binding of PSTD-CMP-Sia (blue), PSTD-Sia (yellow), and PSTD-DP 3 (black) based on the overlaid 1H-15N HSQC spectra of their interactions.
Figure A2.
Comparison of the CSPs for binding of PSTD-CMP-Sia (blue), PSTD-Sia (yellow), and PSTD-DP 3 (black) based on the overlaid 1H-15N HSQC spectra of their interactions.

References
- Lepers, A.H.; Petit, D.; Mollicone, R.; Delannoy, P.; Petit, J.M.; Oriol, R. Evolutionary history of the alpha2,8-sialyltransferase (ST8Sia) gene family: Tandem duplications in early deuterostomes explain most of the diversity found in the vertebrate ST8Sia genes. BMC Evol. Biol. 2008, 8, 258. [Google Scholar]
- Jeanneau, C.; Chazalet, V.; Auge, C.; Soumpasis, D.M.; Harduin-Lepers, A.; Delannoy, P.; Imberty, A.; Breton, C. Structure-function analysis of the human sialyltransferase ST3Gal I: Role of N-glycosylation and a novel conserved sialylmotif. J. Biol. Chem. 2004, 279, 13461–13468. [Google Scholar] [CrossRef] [PubMed]
- Sasaki, K.; Kurata, K.; Kojima, N.; Kurosawa, N.; Ohta, S.; Hanai, N.; Tsuji, S.; Nishi, T. Expression cloning of a GM3-specific alpha-2,8-sialyltransferase (GD3 synthase). J. Biol. Chem. 1994, 269, 15950–15956. [Google Scholar]
- Nakayama, J.; Fukuda, M.N.; Hirabayashi, Y.; Kanamori, A.; Sasaki, K.; Nishi, T.; Fukuda, M. Expression cloning of a human GT3 synthase. GD3 and GT3 are synthesized by a single enzyme. J. Biol. Chem. 1996, 271, 3684–3691. [Google Scholar] [CrossRef] [PubMed]
- Fang, F.; Xie, B.; Wang, B.; Troy, F.A., II. LC-MS/MS Glycomic Analyses of Free and Conjugated Forms of the Sialic Acids, Neu5Ac, Neu5Gc and KDN in Human Throat Cancers. Glycobiology 2015, 25, 1362–1374. [Google Scholar]
- Chen, Y.; Ren, H.; Zhang, N.; Troy, F.A., II; Wang, B. Biochemical Characterization and Analyses of Polysialic Acid-Associated Carrier Proteins and Genes in Piglets During Neonatal Brain Development. ChemBioChem 2017, 18, 1270–1278. [Google Scholar] [CrossRef] [PubMed]
- Yang, C.; Zhang, P.; Fang, W.; Chen, Y.; Zhang, N.; Qiao, Z.; Troy, F.A., II; Wang, B. Molecular Mechanisms Underlying How Sialyllactose Intervention Promotes Intestinal Maturity by Up-regulating GDNF Through a CREB-dependent Pathway in Neonatal Piglets. J. Mol. Neurobiol. 2019. [Google Scholar] [CrossRef] [PubMed]
- Gluer, S.; Schelp, C.; Gerardy-Schahn, R.; von Schweinitz, D. Polysialylated neural cell adhesion molecule as a marker for differential diagnosis in pediatric tumors. J. Pediatr. Surg. 1998, 33, 1516. [Google Scholar] [CrossRef]
- Angata, K.; Suzuki, M.; McAuliffe, J.; Ding, Y.; Hindsgaul, O.; Fukuda, M. Differential biosynthesis of polysialic acid on neural cell adhesion molecule (NCAM) and oligosaccharide acceptors by three distinct alpha 2,8-sialyltransferases, ST8Sia IV (PST), ST8Sia II (STX), and ST8Sia III. J. Biol. Chem. 2000, 275, 18594–18601. [Google Scholar] [CrossRef] [PubMed]
- Takashima1, S.; Matsumoto, T.; Tsujimoto, M.; Tsuji, S. Effects of amino acid substitutions in the sialylmotifs on molecular expression and enzymatic activities of α2,8-sialyltransferases ST8Sia-I and ST8Sia-VI. Glycobiology 2013, 23, 603–612. [Google Scholar] [CrossRef][Green Version]
- Petit, D.; Teppa, E.; Mir, A.M.; Vicogne, D.; Thisse, C.; Thisse, B.; Filloux, C.; Harduin-Lepers, A. Integrative View of α2,3-Sialyltransferases (ST3Gal) Molecular and Functional Evolution in Deuterostomes: Significance of Lineage-Specific Losses. Mol. Biol. Evol. 2015, 32, 906–927. [Google Scholar] [CrossRef]
- Harduin-Lepers, A. Comprehensive analysis of sialyltransferases in vertebrate genomes. Glycobiol Insights 2010, 2, 29–61. [Google Scholar] [CrossRef]
- Troy, F.A., II. Polysialylation: From bacteria to brains. Glycobiology 1992, 2, 5–23. [Google Scholar] [CrossRef] [PubMed]
- Kauskot, A.; Pascreau, T.; Adam, F.; Bruneel, A.; Reperant, C.; Lourenco-Rodrigues, M.D.; Rosa, J.P.; Petermann, R.; Maurey, H.; Auditeau, C.; et al. A mutation in the gene coding for the sialic acid transporter SLC35A1 is required for platelet life span but not proplatelet formation. Haematologica 2018, 103, e613–e617. [Google Scholar] [CrossRef] [PubMed]
- Parker, J.L.; Newstead, S. Gateway to the Golgi:molecular mechanisms of nucleotide sugar transporters. Curr. Opin. Struct. Biol. 2019, 57, 127–134. [Google Scholar] [CrossRef]
- Parker, J.L.; Newstead, S. Structural basis of nucleotide sugar transport across the Golgi membrane. Nature 2017, 551, 521–524. [Google Scholar] [CrossRef]
- Eckhardt, M.; Gotza, B.; Gerardy-Schahn, R. Mutants of the CMP- sialic acid transporter causing the Lec2 phenotype. J. Biol. Chem. 1998, 273, 20189–20195. [Google Scholar] [CrossRef] [PubMed]
- Aoki, K.; Ishida, N.; Kawakita, M. Substrate recognition by nucleotide sugar transporters: Further characterization of substrate recognition regions by analyses of UDP-galactose/CMP-sialic acid transporter chimeras and biochemical analysis of the substrate specificity of parental and chimeric transporters. J. Biol. Chem. 2003, 278, 22887–22893. [Google Scholar] [PubMed]
- Aoki, K.; Ishida, N.; Kawakita, M. Substrate recognition by UDP- galactose and CMP-sialic acid transporters. Different sets of transmembrane helices are utilized for the specific recognition of UDP-galactose and CMP-sialic acid. J. Biol. Chem. 2001, 276, 21555–21561. [Google Scholar] [CrossRef] [PubMed]
- Rosenberg, A. The Beginnings of Sialic Acid. Biology of the Sialic Acids; Springer: Berlin, Germany, 1995; pp. 1–5. [Google Scholar]
- Varki, A.; Cummings, R.D.; Esko, J.D.; Freeze, H.H.; Stanley, P.; Bertozzi, C.R.; Hart, G.W.; Etzler, M.E. Essentials of Glycobiology, 2nd ed.; Cold Spring Harbor Laboratory Press: Cold Spring Harbor, NY, USA, 2009; pp. 199–216. [Google Scholar]
- McCoy, R.D.; Vimr, E.R.; Troy, F.A., II. CMP-NeuNAc:Poly-α,8-Sialosyl Sialyltransferase and the Biosynthesis of Polysialosyl Units in Neural Cell Adhesion Molecules. J. Biol. Chem. 1985, 260, 12695–12699. [Google Scholar]
- Drake, P.; Nathan, J.; Stock, C.; Chang, P.; Muench, M.; Nakata, D.; Reader, R.; Gip, P.; Golden, K.; Weinhold, B.; et al. The Highly Restricted Glycan, Polysialic Acid, is Differentially Expressed on Human and Murine Leukocytes and Modulated Immune Response. J. Immunol. 2008, 181, 6850–6858. [Google Scholar] [CrossRef] [PubMed]
- Sevigny, M.B.; Ye, J.; Kitazume-Kawaguchi, S.; Troy, F.A., II. Developmental Expression and Characterization of the α2,8 Polysialyltransferase Activity in Embryonic Chick Brain. Glycobiology 1998, 8, 857–867. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Troy, F.A., II. Polysialic Acid in Molecular Medicine. Encycl. Biol. Chem. 2004, 3, 407–414. [Google Scholar]
- Zhou, G.P.; Huang, R.B.; Troy, F.A., II. 3D Structural Conformation and Functional Domains of Polysialyltransferase ST8Sia IV Required for Polysialylation of Neural Cell Adhesion Molecules. Protein Pept. Lett. 2015, 22, 137–148. [Google Scholar] [CrossRef]
- Huang, R.B.; Chen, D.; Liao, S.M.; Lu, B.; Wang, Q.Y.; Xie, N.Z.; Troy, F.A., II; Zhou, G.P. The Intrinsic Relationship Between Structure and Function of the Sialyltransferase ST8Sia Family Members. Curr. Top. Med. Chem. 2017, 17, 2465–2475. [Google Scholar] [CrossRef]
- Nakata, D.; Zhang, L.; Troy, F.A. Molecular basis for polysialylation: A novel polybasic polysialyltransferase domain (PSTD) of 32 amino acids unique to the α2,8-polysialyltransferases is essential for polysialylation. Glycoconj. J. 2006, 23, 423–436. [Google Scholar] [CrossRef]
- Foley, D.A.; Swartzentruber, K.G.; Colley, K.J. Identification of Sequences in the Polysialyltransferases ST8Sia II and ST8Sia IV That Are Required for the Protein-specific Polysialylation of the Neural Cell Adhesion Molecule, NCAM. J. Biol. Chem. 2009, 204, 15505–15516. [Google Scholar] [CrossRef]
- Bhide, G.P.; Prehna, G.; Ramirez, B.E.; Colley, K.J. The Polybasic Region of the Polysialyltransferase ST8Sia-IV Binds Directly to the Neural Cell Adhesion Molecule, NCAM. Biochemistry 2017, 56, 1504. [Google Scholar] [CrossRef]
- Kelley, L.A.; Sternberg, M.J.E. Protein structure prediction on web: A case study using Phyre server. Nat. Protoc. 2009, 4, 363–371. [Google Scholar] [CrossRef]
- Werneburg, S.; Muhlenhoff, M.; Stangel, M.; Hildebrandt, H. Polysialic acid on SynCAM 1 in NG2 cells and on neuropilin-2 in microglia is confined to intracellular pools that are rapidly depleted upon stimulation. GLIA 2015, 63, 1240–1255. [Google Scholar] [CrossRef]
- Roger, S.; Heike, S.; Konrad, S. Gangliosides in Health and Disease. In Progress in Molecular Biology and Translational Science; Schnaar, R.L., Lopez, P.H.H., Eds.; Elsevier: Amsterdam, The Netherlands, 2018; pp. 1–462. [Google Scholar]
- Prem Raj, B.J.; Krishna Mohan, P.; Krishna Mohan, S.; Krishna, R. Characterizing protein-glycosaminoglycan interactions using solution NMR Spectroscopy. Methods Mol. Biol. 2015, 1229, 325–333. [Google Scholar] [CrossRef]
- Vaynberg, J.; Qin, J. Weak protein—Protein interactions as probed by NMR spectroscopy. Trends Biotechnol. 2006, 24, 22–27. [Google Scholar] [CrossRef] [PubMed]
- Sharma, A.K.; Zhou, G.P.; Kupferman, J.; Surks, H.K.; Christensen, E.N.; Chou, J.J.; Mendelsohn, M.E.; Rigby, A.C. Probing the interaction between the coiled coil leucine zipper of cGMP-dependent protein kinase I alpha and the C terminus of the myosin binding subunit of the myosin light chain phosphatase. J. Biol. Chem. 2008, 283, 32860–32869. [Google Scholar] [CrossRef] [PubMed]
- Wüthrich, K. NMR of Proteins and Nucleic Acids; Wiley: Hoboken, NJ, USA, 1996; ISBN: 978-0-471-82893-8; Available online: https://www.wiley.com/en-us/NMR+of+Proteins+and+Nucleic+Acids-p-9780471828938 (accessed on 15 January 2020).
- Zhou, G.P.; Troy, F.A., II. NMR studies on how the binding complex of polyisoprenol recognition sequence peptides and polyisoprenols can modulate membrane structure. Curr. Protein Pept. 2005, 6, 399–411. [Google Scholar] [CrossRef]
- Oxenoid, K.; Dong, Y.; Cao, C.; Cui, T.; Sancak, Y.; Markhard, A.L.; Grabarek, Z.; Kong, L.; Liu, Z.; Ouyang, B.; et al. Architecture of the mitochondrial calcium uniporter. Nature 2016, 533, 269–273. [Google Scholar] [CrossRef]
- Van Horn, W.D.; Kim, H.J.; Ellis, C.D.; Hadziselimovic, A.; Sulistijo, E.S.; Karra, M.D.; Tian, C.; Sonnichsen, F.D.; Sanders, C.R. Solution nuclear magnetic resonance structure of membrane-integral diacylglycerol kinase. Science 2009, 324, 1726–1729. [Google Scholar] [CrossRef]
- Kang, C.; Tian, C.; Sonnichsen, F.D.; Smith, J.A.; Meiler, J.; George, A.L., Jr.; Vanoye, C.G.; Kim, H.J.; Sanders, C.R. Structure of KCNE1 and implications for how it modulates the KCNQ1 potassium channel. Biochemistry 2008, 47, 7999–8006. [Google Scholar] [CrossRef]
- Zhou, G.P.; Surks, H.K.; Schnell, J.R.; Chou, J.J.; Mendelsohn, M.E.; Rigby, A.C. The Three-Dimensional Structure of the cGMP-Dependent Protein Kinase I - α Leucine Zipper Domain and Its Interaction with the Myosin Binding Subunit. Blood 2004, 104, 3539. [Google Scholar] [CrossRef]
- Chou, J.J.; Li, S.; Klee, C.B.; Bax, A. Solution structure of Ca(2+)-calmodulin reveals flexible hand-like properties of its domains. Nat. Struct. Biol. 2001, 8, 990–997. [Google Scholar] [CrossRef]
- Chou, J.J.; Li, H.; Salvesen, G.S.; Yuan, J.; Wagner, G. Solution structure of BID, an intracellular amplifier of apoptotic signaling. Cell 1999, 96, 615–624. [Google Scholar] [CrossRef]
- Fu, Q.; Fu, T.M.; Cruz, A.C.; Sengupta, P.; Thomas, S.K.; Wang, S.; Siegel, R.M.; Wu, H.; Chou, J.J. Structural Basis and Functional Role of Intramembrane Trimerization of the Fas/CD95 Death Receptor. Mol. Cell 2016, 61, 602–613. [Google Scholar] [CrossRef]
- Pielak, R.M.; Schnell, J.R.; Chou, J.J. Mechanism of drug inhibition and drug resistance of influenza A M2 channel. Proc. Natl. Acad. Sci. USA 2009, 106, 7379–7384. [Google Scholar] [CrossRef]
- Dev, J.; Park, D.; Fu, Q.; Chen, J.; Ha, H.J.; Ghantous, F.; Herrmann, T.; Chang, W.; Liu, Z.; Frey, G.; et al. Structural basis for membrane anchoring of HIV-1 envelope spike. Science 2016, 353, 172–175. [Google Scholar] [CrossRef] [PubMed]
- Chou, J.J.; Matsuo, H.; Duan, H.; Wagner, G. Solution structure of the RAIDD CARD and model for CARD/CARD interaction in caspase-2 and caspase-9 recruitment. Cell 1998, 94, 171–180. [Google Scholar] [CrossRef]
- Xu, C.; Gagnon, E.; Call, M.E.; Schnell, J.R.; Schwieters, C.D.; Carman, C.V.; Chou, J.J.; Wucherpfennig, K.W. Regulation of T cell receptor activation by dynamic membrane binding of the CD3epsilon cytoplasmic tyrosine-based motif. Cell 2008, 135, 702–713. [Google Scholar] [CrossRef] [PubMed]
- Gagnon, E.; Xu, C.; Yang, W.; Chu, H.H.; Call, M.E.; Chou, J.J.; Wucherpfennig, K.W. Response multilayered control of T cell receptor phosphorylation. Cell 2010, 142, 669–671. [Google Scholar] [CrossRef]
- Pielak, R.M.; Chou, J.J. Flu channel drug resistance: A tale of two sites. Protein Cell 2010, 1, 246–258. [Google Scholar]
- Berardi, M.J.; Chou, J.J. Fatty acid flippase activity of UCP2 is essential for its proton transport in mitochondria. Cell Metab. 2014, 20, 541–552. [Google Scholar] [CrossRef]
- Mantsyzov, A.B.; Shen, Y.; Lee, J.H.; Hummer, G.; Bax, A. MERA: A webserver for evaluating backbone torsion angle distributions in dynamic and disordered proteins from NMR data. J. Biomol. NMR 2015, 63, 85–95. [Google Scholar] [CrossRef]
- Shen, Y.; Bax, A. Protein structural information derived from NMR chemical shift with the neural network program TALOS-N. Methods Mol. Biol. 2015, 1260, 17–32. [Google Scholar]
- Bjorndahl, T.C.; Zhou, G.P.; Liu, X.H.; Pineiro, R.P.; Semenchenko, V.; Saleem, F.; Acharya, S.; Bujold, A.; Sobsey, C.A.; Wishart, D.S. Detailed Biophysical Characterization of the Acid-Induced PrPc to PrPβConversion Process. Biochemistry 2011, 50, 1162–1173. [Google Scholar] [CrossRef] [PubMed]
- Nakata, D.; Troy, F.A., II. Degree of Polymerization (DP) of Polysialic Acid (PolySia) on Neural Cell Adhesion Molecules (N-CAMs): Development and Application of a New Strategy to Accurately Determine the DP of PolySia Chains on NCAMs. J. Biol. Chem. 2006, 280, 38305–38316. [Google Scholar] [CrossRef]
- Mike, P.; Williamson, M.P. Using chemical shift perturbation to characterise ligand binding. Prog. Nucl. Magn. Reson. Spectrosc. 2013, 73, 1–16. [Google Scholar]
- Rao, B.D.N. Nuclear magnetic resonance line-shape analysis and determination of exchange rates. Meth. Enzymol. 1989, 176, 279–311. [Google Scholar] [PubMed]
- Sandstrm, J. Dynamic NMR Spectroscopy; Academic Press: London, UK, 1982; X, 226 S., geb. [Google Scholar]
- Peng, L.X.; Liu, X.H.; Lu, B.; Liao, S.M.; Huang, J.M.; Zhou, F.; Chen, D.; Troy, F.A., II; Huang, R.B.; Zhou, G.P. The Inhibition of polysialyltransferase ST8SiaIV through heparin binding to polysialyltransferase domain (PSTD). Med. Chem. 2019, 14, 1–10. [Google Scholar] [CrossRef] [PubMed]
- Volkers, G.; Worrall, L.J.; Kwan, D.H.; Yu, C.C.; Baumann, L.; Lameignere, E.; Wasney, G.A.; Scott, N.E.; Wakarchuk, W.; Foster, L.J.; et al. Structure of human ST8Sia III sialyltransferase provides insight into cell-surface polysialylation. Nat. Struct. Mol. Biol. 2015, 22, 627–635. [Google Scholar]
- Castilho, A.; Pabst, M.; Leonard, R.; Veit, C.; Altmann, F.; Mach, L.; Glossl, J.; Strasser, R.; Steinkellner, H. Construction of a Functional CMP-Sialic Acid Biosynthesis Pathway in Arabidopsis. Plant Physiol. 2008, 147, 331–339. [Google Scholar] [CrossRef]
- Nagae, M.; Ikeda, A.; Hane, M.; Hanashima, S.; Kitajima, K.; Sato, C.; Yamaguchi, Y. Crystal structure of anti-polysialic acid antibody single chain Fv fragment complexed with octasialic acid: Insight into the binding preference for polysialic acid. J. Biol. Chem. 2013, 288, 33784–33796. [Google Scholar] [CrossRef]
- Ono, S.; Hane, M.; Kitajima, K.; Sato, C. Novel regulation of fibroblast growth factor 2 (FGF2)-mediated cell growth by polysialic acid. J. Biol. Chem. 2012, 287, 3710–3722. [Google Scholar] [CrossRef]
- Kanato, Y.; Kitajima, K.; Sato, C. Direct binding of polysialic acid to a brain-derived neurotrophic factor depends on the degree of polymerization. Glycobiology 2008, 18, 1044–1053. [Google Scholar] [CrossRef]
- Kuhnle, A.; Veelken, R.; Galuska, C.E.; Saftenberger, M.; Verleih, M.; Schuppe, H.C.; Rudloff, S.; Kunz, C.; Galuska, S.P. Polysialic acid interacts with lactoferrin and supports its activity to inhibit the release of neutrophil extracellular traps. Carbohydr. Polym. 2019, 208, 32–41. [Google Scholar] [CrossRef] [PubMed]
- Zlatina, K.; Lütteke, T.; Galuska, S.P. Individual Impact of Distinct Polysialic Acid Chain Lengths on the Cytotoxicity of Histone H1, H2A, H2B, H3 and H4. Polymers 2017, 9, 720. [Google Scholar] [CrossRef]
- Galuska, C.E.; Dambon, J.A.; Kühnle, A.; Bornhöfft, K.F.; Prem, G.; Zlatina, K.; Lütteke, T.; Galuska, S.P. Artificial Polysialic Acid Chains as Sialidase-Resistant Molecular-Anchors to Accumulate Particles on Neutrophil Extracellular Traps. Front. Immunol. 2017, 8, 1229. [Google Scholar] [CrossRef]
- Haselhorst, T.; Stummeyer, K.; Muhlenhoff, M.; Schaper, W.; Gerardy-Schahn, R.; von Itzstein, M. Endosialidase NF appears to bind polySia DP5 in a helical conformation. Chembiochem 2006, 7, 1875–1877. [Google Scholar] [CrossRef]
- Schnaar, R.L.; Gerardy-Schahn, R.; Hildebrandt, H. Sialic acids in the brain: Gangliosides and polysialic Acid in nervous system development, stability, disease, and regeneration. Physiol. Rev. 2014, 94, 461–518. [Google Scholar] [CrossRef]
- Zhou, G.P. Current Advances of Drug Target Research in Medicinal Chemistry. CTMC 2019, 19, 2269–2270. [Google Scholar] [CrossRef] [PubMed]
- Schnell, J.R.; Zhou, G.P.; Zweckstetter, M.; Rigby, A.C.; Chou, J.J. Rapid and accurate structure determination of coiled-coil domains using NMR dipolar couplings: Application to cGMP-dependent protein kinase Iα. Protein Sci. 2005, 14, 2421–2428. [Google Scholar] [CrossRef] [PubMed]
- Krajewski, M.; Ozdowy, P.; D’Silva, L.; Rothweiler, U.; Holak, T.A. NMR indicates that the small molecule RITA does not block p53-MDM2 binding in vitro. Nat. Med. 2005, 11, 1135–1136. [Google Scholar] [CrossRef] [PubMed]
- Zhou, G.P.; Troy, F.A., II. NMR study of the preferred membrane orientation of polyisoprenols (dolichol) and the impact of their complex with polyisoprenyl recognition sequence peptides on membrane structure. Glycobiology 2005, 15, 347–359. [Google Scholar] [CrossRef][Green Version]
- Close, B.E.; Colley, K.J. In vivo autopolysialylation and localization of the polysialyltransferases PST and STX. J. Biol. Chem. 1998, 273, 34586–34593. [Google Scholar] [CrossRef]
- Bhide, G.P.; Zapater, J.L.; Colley, K.J. Autopolysialylation of polysialyltransferases is required for polysialylation and polysialic acid chain elongation on select glycoprotein substrates. J. Biol. Chem. 2018, 293, 701–716. [Google Scholar] [CrossRef] [PubMed]
- Werneburg, S.; Buettner, F.F.; Erben, L.; Mathews, M.; Neumann, H.; Muhlenhoff, M.; Hildebrandt, H. Polysialylation and lipopolysaccharide-induced shedding of E-selectin ligand-1 and neuropilin-2 by microglia and THP-1 macrophages. Glia 2016, 64, 1314–1330. [Google Scholar] [CrossRef] [PubMed]
- Zhou, G.P.; Liao, S.M.; Chen, D.; Huang, R.B. The Cooperative Effect between Polybasic Region (PBR) and Polysialyltransferase Domain (PSTD) within Tumor-Target Polysialyltranseferase ST8Sia II. CTMC 2019, 19. [Google Scholar] [CrossRef] [PubMed]
© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).



