Search Results (4,156)

Oxidative stress, caused by an imbalance between the production of reactive oxygen species and endogenous antioxidant capacity, is a key etiological factor in numerous pathologies, including neurodegenerative and cardiovascular diseases. The limited clinical efficacy of conventional antioxidants is primarily due to their insufficient accumulation within the mitochondria, the main site of intracellular ROS generation. This article reviews the design and application of Mitochondria-Targeted Antioxidants, which represent a major advance in precision medicine. The design of these compounds involves linking an antioxidant “payload” to a lipophilic cation, such as the triphenylphosphonium group. This positive charge leverages the negative electrochemical gradient across the inner mitochondrial membrane to drive the antioxidant into the organelle. This mechanism allows the drug to reach concentrations over 100 times higher than non-targeted alternatives. The discussion encompasses the structure-activity analysis of the carrier, the payload (e.g., quinone derivatives), and the linker, which determine optimal subcellular partitioning and scavenging efficiency. Preclinical data highlight the therapeutic potential of this approach, showing strong neuroprotection in models of Parkinson’s and Alzheimer’s diseases, as well as improved outcomes in cardiovascular and ocular health. By restoring redox balance specifically within the mitochondria, these targeted therapies offer a more effective way to treat chronic oxidative damage. Full article

Carbon dots (CDs) have emerged as a distinct class of fluorescent nanomaterials distinguished by their tunable physicochemical properties, ultrasmall size, exceptional photoluminescence, versatile surface chemistry, high biocompatibility, and chemical stability, positioning them as promising candidates for biomedical applications ranging from sensing and imaging to drug delivery and theranostics. As CDs increasingly transition toward biological and clinical use, a fundamental understanding of their interactions with biological membranes becomes essential, as cellular membranes govern nanoparticle uptake, intracellular transport, and therapeutic performance. Model membrane systems, such as phospholipid vesicles and liposomes, offer controllable platforms to elucidate CD-membrane interactions by isolating key physicochemical variables otherwise obscured in complex biological environments. Recent studies demonstrate that CD surface chemistry, charge, heteroatom doping, size, and hydrophobicity, together with membrane composition, packing density, and phase behavior, dictate nanoparticle adsorption, insertion, diffusion, and membrane perturbation. In addition, CD-liposome hybrid systems have gained momentum as multifunctional nanoplatforms that couple the fluorescence and traceability of CDs with the encapsulation capacity and biocompatibility of lipid vesicles, enabling imaging-guided drug delivery and responsive theranostic systems. This review consolidates current insights into the mechanistic principles governing CD interactions with model membranes and highlights advances in CD-liposome hybrid nanostructures. By bridging fundamental nanoscale interactions with translational nanomedicine strategies, this work provides a framework for the rational design of next-generation CD-based biointerfaces with optimized structural, optical, and biological performance. Full article

Copper slag was introduced as a second phase into Cr₃C₂–NiCr coating to improve corrosion resistance and reduce material cost. Composite coatings with different copper slag/Cr₃C₂–NiCr ratios were prepared by high-velocity oxygen fuel (HVOF) spraying. The corrosion behavior was evaluated through electrochemical tests and immersion experiments, and the effect of coating composition on corrosion resistance was elucidated by microstructural and compositional analysis. To increase the addition of copper slag, the open-circuit potential of the coatings shifted positively, the corrosion current density decreased significantly, and both the polarization resistance and charge-transfer resistance increased markedly, leading to a notable reduction in corrosion rate. The coating with a copper slag-to-Cr₃C₂–NiCr mass ratio of 3:7 exhibited the best corrosion resistance. The improvement can be attributed to the reduced porosity and more compact structure resulting from the copper slag addition, as well as the homogeneous distribution of copper slag, which enhances the stability of the surface passivation layer. Full article

Equinin B (GQCQRKCLGHCSKKCPKHPQCRKRCIRRCFGYCL), a marine peptide from Actinia equina exhibits antibacterial activity against both Gram-positive and Gram-negative bacteria. To identify a smaller active region and explore tunable properties, three peptide fragments were synthesized: GQCQRKCLGHCS (EB1), KKCPKHPQCRK (EB2), and RCIRRCFGYCL (EB3), yielding peptides with key AMP-like properties, including the most positively charged and most hydrophobic regions. Only the 11-residue C-terminal fragment showed selective activity against Gram-positive bacteria, including Staphylococcus epidermidis, Bacillus subtilis, and Enterococcus hirae, while remaining inactive against Escherichia coli. Peptide modifications, achieved by replacing cysteine residues with arginine, generally did not enhance activity, but in the C-terminal fragment EB3 they reduced hemolytic activity and increased bacterial specificity. Membrane depolarization assays confirmed that the unmodified fragment EB3 strongly disrupts bacterial membranes, whereas the modified variant showed minimal depolarization, highlighting its markedly reduced membrane-disruptive potential. In silico modelling revealed that the EB3 can adopt multiple membrane-disruption modes, from transient shallow pores to carpet-like mechanisms, while the cysteine-to-arginine variant interacts mainly via partial insertion anchored by arginine residues. Phenylalanine appears to interact with the membrane, and reducing hydrophobicity by its removal abolished antibacterial activity. These findings highlight the 11-residue C-terminal fragment as a tunable, membrane-targeting motif with mechanistic novelty, offering a blueprint for developing safer, selective antimicrobial peptides with reduced cytotoxicity. Full article

The current–voltage characteristics (IVCs) of anodic TiO₂ films in a thin-film structure (Carbon paste/TiO₂/Ti/Al) were investigated in the temperature range of T = 80–300 K with bias voltages from −0.5 V to +0.5 V. Anodic oxide film, with a thickness of 14 nm, was obtained by electrochemical oxidation of Ti at a voltage of 10 V. The obtained data for various temperatures showed that the IVCs in the forward (negative on the Ti electrode) and reverse (positive on the Ti electrode) bias of the thin film structure are not symmetrical. Based on the analysis, three temperature ranges (sections) were identified in which the IVCs differ in their behavior. Examination of the IVCs revealed that the conductivity mechanism in Section I (temperature range from 298 to 263 K) is determined by the Space Charge Limited Current (SCLC). Section II, in the temperature range from 243 to 203 K, is characterized by the onset of conductivity involving donor centers, in the case where the concentration of electrons on traps is significantly higher than the concentration of electrons in the conduction band. In Section III, within the temperature range from 183 to 90 K, the conduction mechanism is the Poole–Frenkel process involving donor centers. These donor centers are located below the level of traps in the forbidden band. The results obtained indicate that anodic TiO₂ is an n-type semiconductor, in the bandgap of which there are both electron traps and donor centers formed by anionic (oxygen) vacancies. The different behavior of the characteristic energy with different sample biasing in the case of the Poole–Frenkel mechanism indicates a two-layer structure of anodic TiO₂. Full article

Ions in liquid helium exist in their simplest form in two configurations, as negatively charged “electron bubbles” (electrons in a void of about 35 Å in diameter) and as positive “snowballs” (He⁺ ions surrounded by a sphere of solid helium, about 14 Å in diameter). Here, we give an overview of studies with these ions when they are trapped at interfaces between different helium phases, i.e., the “free” surface between liquid and vapor, but also the interfaces between liquid and solid helium at high pressure and between phase-separated ³He-⁴He mixtures below the tricritical point. Three cases are discussed: (i) if the energy barrier provided by the interface is of the order of the thermal energy k_BT, the ions can pass from one phase to the other with characteristic trapping times at the interface, which are in qualitative agreement with the existing theories; (ii) if the energy barrier is sufficiently high, the ions are trapped at the interface for extended periods of time, forming 2D Coulomb systems with intriguing properties; and (iii) at high electric fields and high ion densities, an electrohydrodynamic instability takes place, which is a model for critical phenomena. Full article

Polypropylene (PP) nonwovens are widely used as filtration layers in surgical face masks, but their hydrophobic, inert surfaces limit their ability to attach functional coatings that adjust pore size and improve mechanical filtration. Herein, we exploit cellulose derived from sugarcane debris to construct nanocellulose coatings that modify the surface properties of PP mask nonwovens without altering the underlying fibre architecture. Cellulose pulp was fibrillated to cellulose nanofibres (CNFs) and functionalised to yield TEMPO-oxidised nanofibres (TCNFs) and cationic nanofibres (CCNFs). All these nanofibres retain a cellulose I structure with a thermal stability of well above an 80–100 °C drying window. The three nanocelluloses exhibit distinct combinations of surface charge and wettability (ζ ≈ −9, −73, and +76 mV), with various hydrophobicity. Dip coating produces nanocellulose coating layers on PP, with uniform coverage at 1 wt% for TCNF and CCNF. CCNF inverts the negative surface charge of PP and maintains the positive charge at 86% relative humidity. Ethanol pretreatment of PP increases CCNF coating adhesion and preserves a continuous nanoporous CCNF film on the PP surface under humid conditions. Cytotoxicity assays indicate no detectable cytotoxicity for coated or uncoated nonwovens. This work establishes sugarcane-derived nanocellulose, particularly CCNF and TCNF, as a potential biocompatible surface coating for PP mask nonwovens. Full article

Energy-efficient driving is essential for reducing the environmental impacts of road transport, especially for electric passenger vehicles. This research aims to build a data-driven behavioral analysis and energy-consumption evaluation model. The model relies on sensor data from the vehicle’s on-board communication network, primarily the CAN (Controller Area Network) bus. We analyze patterns of key powertrain and battery parameters—such as current, voltage, state of charge (SoC), and power—in relation to driver inputs, such as the accelerator pedal position. In the first stage, we review the literature with a focus on machine learning and clustering methods used in behavioral and energy analysis. We also examine the role of on-board telemetry systems. Next, we develop a controlled measurement architecture. It defines reference consumption maps from dynamometer data across operating points and environmental variables, including SoC, temperature, and load. The longer-term goal is a multidimensional behavioral map and profiling framework that can predict energy efficiency from real-time driver inputs. This work lays the foundation for a future system with adaptive, feedback-based driver support. Such a system can promote intelligent, sustainable, and behavior-oriented mobility solutions. Full article

This study presents a statistically robust quality-engineering evaluation of an industrial cathodic electrodeposition (CED) process applied to large electric-charging station components. In contrast to predominantly laboratory-scale studies, the analysis is based on 1250 thickness measurements, enabling reliable assessment of process uniformity, positional effects, and long-term stability under real production conditions. The mean coating thickness was specified at 21.84 µm with a standard deviation of 3.14 µm, fully within the specified tolerance window of 15–30 µm. One-way ANOVA revealed statistically significant but technologically small inter-station differences (F(49, 1200) = 3.49, p < 0.001), with an effect size of η² ≈ 12.5%, indicating that most variability originates from inherent within-station common causes. Shewhart X^¯–R–S control charts confirmed process stability, with all subgroup means and dispersions well inside the control limits and no evidence of special-cause variation. Distribution tests (χ², Kolmogorov–Smirnov, Shapiro–Wilk, Anderson–Darling) detected deviations from perfect normality, primarily in the tails, attributable to the superposition of slightly heterogeneous station-specific distributions rather than fundamental non-Gaussian behaviour. Capability and performance indices were evaluated using Statistica and PalstatCAQ according to ISO 22514; the results (Cp = 0.878, Cpk = 0.808, Pp = 0.797, Ppk = 0.726) classify the process as conditionally capable, with improvement potential mainly linked to reducing positional effects and centering the mean closer to the target thickness. To complement the statistical findings, an AIAG–VDA FMEA was conducted across the entire value stream. The highest-risk failure modes—surface contamination, incorrect bath chemistry, and improper hanging—corresponded to the same mechanisms identified by SPC and ANOVA as contributors to thickness variability. Proposed corrective actions reduced RPN values by 50–62.5%, demonstrating strong potential for capability improvement. A predictive machine-learning model was implemented to estimate layer thickness and successfully reproduced the global trend while filtering process-related noise, offering a practical tool for future predictive quality control. Full article

Silicon carbide (SiC) MOSFETs, as one of the representative power electronic devices, have faced reliability challenges due to threshold voltage (V_th) instability under dynamic gate stress. To explore the underlying mechanisms, this work investigates 4H-SiC MOS structures (P-MOS and N-MOS) under AC bias temperature instability (AC BTI) stress, utilizing a laser to generate minority carriers and simulate realistic switching conditions. Through combined capacitance–voltage (C-V) and gate current–voltage (J_g-V_g) characterizations on P-MOS and N-MOS devices before and after degradation at different temperatures, we reveal a critical temperature dependence in defect interactions. At room temperature, degradation is dominated by electron trapping in shallow interface states and near-interface traps (NITs). In contrast, high-temperature stress activates charge exchange with deep-level, slow states. Notably, a positive V_FB shift is consistently observed in both N-MOS and P-MOS devices under AC stress, confirming that electron trapping is the dominant cause of the commonly observed positive V_th shift in SiC MOSFETs. These findings clarify the distinct defect-mediated mechanisms governing dynamic V_th instability in SiC devices, providing fundamental insights for interface engineering and reliability assessment. Full article

This study reports the effect of pH (2, 7, 10) and heat treatment (80 °C for 30 min) on the oil–water (o/w) interfacial behavior of hemp seed protein isolate (HPI) aqueous dispersions. The physicochemical, interfacial adsorption, rheology, and emulsifying properties of protein dispersions were evaluated. HPI dispersions at pH 10 exhibited the highest water solubility (60%), the greatest net charge (−27 mV), and the lowest hydrophobicity (~5 a.u.), promoting o/w interfacial pressure (π) and interfacial viscoelasticity. Strong interfacial viscoelastic protein layers (E^* = 25 mN/m) were also observed under acidic conditions (pH 2), where proteins exhibited high solubility (40%), a high positive net charge (21 mV), and increased hydrophobicity (46 a.u.). HPI dispersions in their neutral state (pH 7) were not able to form stable o/w emulsions due to their poor physicochemical properties such as low solubility (18%), low surface charge (−18 mV), and hydrophobicity (~5 a.u.). Heat treatment significantly increased the charge and hydrophobicity of both neutral and alkaline proteins (~30 mV and ~10 a.u., respectively), increasing their particle size distribution and ultimately reducing their interfacial protein layer elasticity (E^* = 20 and 13 nM/m, respectively). While particles at acidic conditions showed high thermal resistance, heat treatment improved the emulsifying stability in alkaline conditions while further reducing it in the neutral state. Overall, HPI dispersions demonstrated the ability to form stable emulsions at both alkaline and acid pHs, with those formed at pH 2 exhibiting a lower droplet size and superior stability. Full article

Hydrogen is frequently incorporated in alkaline-earth oxides during crystal growth or post-deposition annealing. For MgO, several studies in the past showed that interstitial monatomic hydrogen can also favourably bind with oxygen vacancies to form stable substitutional defect complexes (substitutional hydrogen or U-defect centers). The present study reports first-principles density-functional calculations of the formation energies of both interstitial and substitutional forms of the hydrogen impurity in MgO. Determination of the site-resolved densities of electronic states allowed for a detailed identification of the nature of the impurity-induced levels, both in the valence-energy region and inside the band gap of the host. The stability and diffusion mechanisms of both hydrogen defects was also studied with the aid of nudged elastic-band (NEB) calculations. Interstitial hydrogen was found to be an amphoteric defect with the lower formation energy for any realistic environment conditions (temperature and oxygen partial pressure). The NEB calculations showed that it is a fast-diffusing species when it is thermodynamically stable as a positively-charged state (bare proton). In contrast, the hydrogen-vacancy complex is a shallow donor, extremely stable against dissociation and virtually immobile as an isolated defect. Its formation is found to be favoured for a range of mid-gap Fermi-level positions where positively-charged interstitial hydrogen and neutral oxygen vacancies (F centers) are both thermodynamically stable low-energy defects. The present findings are consistent with the established consensus on the electrical activity of hydrogen in MgO as well as with experimental observations reporting the remarkable thermal stability of substitutional hydrogen defects and their ability to act as electron traps. Full article

Smart packaging is an alternative that may not only replace plastic containers, but also enable food quality monitoring. In this study, an innovative packaging system was developed using a starch-chitosan polymer matrix, infused with rosemary essential oil (REO) as an antimicrobial agent, and betalain extract as a food quality indicator. Betalain extract, derived from beet waste, can change color with pH, making it a useful natural indicator for monitoring food freshness. This packaging system is beneficial for foods that produce metabolites related to degradation, which alter pH and allow for the visual detection of changes in product quality. The objective of this work was to develop a smart packaging system with betalains and rosemary essential oil (REO) to extend food shelf life and monitor quality during storage. REO demonstrated antimicrobial activity, but its effect did not differ significantly among the microorganisms tested. On the other hand, the betalain extract (35.75% BE v/v) completely inhibited the growth of Listeria innocua and Salmonella spp. at concentrations of 50% (v/v; 0.82 ± 0.04 mg betalain/g), showing its potential as an antimicrobial agent. The interactions between chitosan and betalains were primarily associated with electrostatic interactions between the positively charged amino groups of chitosan and the negatively charged carboxyl groups of betalains. In contrast to starch, these interactions could result from interactions between the C=O groups of betalain carboxyls and water, which, in turn, interact with the hydroxyl groups of starch through hydrogen bonding. Despite the results obtained in this study, certain limitations need to be addressed in future research, such as the variability in antimicrobial activity among different bacterial strains, which could reveal differences in the efficacy of betalains and essential oils against other pathogens. Full article

Quantum anomalies are traditionally understood as classical symmetries that fail to survive quantization, while experimental “anomalies” denote deviations between theoretical predictions and measured values. In this work, we develop a unified framework in which both phenomena can be interpreted through the lens of algebraic quantum field theory (AQFT). Building on the renormalization group viewed as an extension problem, we show that renormalization ambiguities correspond to nontrivial elements of Hochschild cohomology, giving rise to a deformation of the observable algebra $A\ast B=AB+\epsilon \omega (A,B)$, where $\omega$ is a Hochschild 2-cocycle. We interpret $\omega$ as an intrinsic algebraic curvature of the net of local algebras, namely the (local) Hochschild class that measures the obstruction to trivializing infinitesimal scheme changes by inner redefinitions under locality and covariance constraints. The transported product is associative; its first-order expansion is associative up to $\mathcal{O}\left({\epsilon }^2\right)$ while preserving the ∗-structure and Ward identities to the first order. We prove the existence of nontrivial cocycles in the perturbative AQFT setting, derive the conditions under which the deformed product respects positivity and locality, and establish the compatibility with current conservation. The construction provides a direct algebraic bridge to standard cohomological anomalies (chiral, trace, and gravitational) and yields correlated deformations of physical amplitudes. Fixing the small deformation parameter $\epsilon$ from the muon $(g-2)$ discrepancy, we propagate the framework to predictions for the electron $(g-2)$, charged lepton EDMs, and other low-energy observables. This approach reduces reliance on ad hoc form-factor parametrizations by organizing first-order scheme-induced deformations into correlation laws among low-energy observables. We argue that interpreting quantum anomalies as manifestations of algebraic curvature opens a pathway to a unified, testable account of renormalization ambiguities and their phenomenological consequences. We emphasize that the framework does not eliminate renormalization or quantum anomalies; rather, it repackages the finite renormalization freedom of pAQFT into cohomological data and relates it functorially to standard anomaly classes. Full article

The electrification of transport is vital to achieving global climate targets, with electric vehicles (EVs) positioned as a sustainable alternative to fossil fuel–based mobility. However, the scalability of EV adoption hinges on the accessibility, reliability, and user experience of public charging infrastructure. As China leads the world in EV adoption, Shanghai represents a critical case for evaluating user satisfaction in a megacity context where infrastructure density, urban planning, and consumer behavior intersect. Despite significant investments in expanding charging facilities, limited empirical research has examined how users perceive and interact with Shanghai’s public EV charging network. This study addresses that gap through a quantitative, user-centered analysis of responses from 197 EV users using the QUESS-PAC framework (Quantitative User Experience Survey Strategy for Public EV Charging Analysis in Cities). A structured questionnaire assessed satisfaction across multiple dimensions: infrastructure layout, convenience, pricing, ease of use, safety, and lighting. Using SPSS (v28), descriptive analysis and multiple regression were conducted to identify key determinants of satisfaction. The findings indicate low overall user satisfaction, with critical weaknesses in location planning, cost transparency, and interface usability. Regression analysis highlights four significant predictors of satisfaction—layout, ease of use, pricing, and lighting—with charging price emerging as the most influential factor. This study’s unique contribution lies in the development and application of the QUESS-PAC framework, which integrates quantitative UX metrics with behavioral and spatial dimensions to provide a more systematic assessment than prior descriptive studies. It emphasizes the need for integrated planning that combines spatial equity, service design, and behavioral insights. Based on the analysis, policy recommendations are proposed to enhance satisfaction and encourage adoption. These findings offer transferable insights for global cities navigating the electrification of transport. Full article