Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study
Abstract
1. Introduction
2. Materials and Methods
2.1. Identification of GT43 Gene Members in Sorghum bicolor
2.2. Phylogenetic Analysis of GT43 Sequences
2.3. Physiochemical Properties and Subcellular Localization Prediction
2.4. Protein–Protein Interaction Network and Co-Expression Prediction
2.5. Prediction of Functional Domain and Family of Proteins
2.6. Motif and Gene Structure Prediction
2.7. Secondary Structure and 3D Model Construction of GT43 Protein Prediction
2.8. Cis-Element in Promotors Regions Prediction
2.9. Sequences Logos Analysis
2.10. Gene Expression Profiles Based on RNA-Seq
2.11. Multiple Sequence Alignment of GT43 Proteins
3. Results
3.1. GT43 Gene Family Identification in Sorghum bicolor
3.2. Phylogenetic Analysis of GT43 Sequences
3.3. Physiochemical Properties and Subcellular Localization Prediction
3.4. Protein–Protein Interaction Network and Co-Expression Prediction
3.5. Prediction of Functional Domain and Family of Proteins
3.6. Detection of Motifs and Gene Structure Prediction
3.7. Prediction of Secondary Structure and 3D Model Construction of GT43 Proteins
3.8. Prediction of Cis-Elements in Promoter Regions
3.9. Sequence Logo Analysis
3.10. Expression Profiles Based on RNA-Seq
3.11. Multiple Sequence Alignment Analysis
4. Discussion
5. Conclusions
Author Contributions
Funding
Data Availability Statement
Conflicts of Interest
References
- Kolozsvári, I.; Kun, Á.; Jancsó, M.; Palágyi, A.; Bozán, C.; Gyuricza, C. Agronomic Performance of Grain Sorghum (Sorghum bicolor). Agronomy 2022, 12, 1185. [Google Scholar] [CrossRef]
- Byrt, C.S.; Grof, C.P.L.; Furbank, R.T. C4 Plants as Biofuel Feedstocks: Optimising Biomass Production and Feedstock Quality from a Lignocellulosic Perspective. J. Integr. Plant Biol. 2011, 53, 120–135. [Google Scholar] [CrossRef]
- Taylor, S.H.; Hulme, S.P.; Rees, M.; Ripley, B.S.; Ian Woodward, F.; Osborne, C.P. Ecophysiological Traits in C3 and C4 Grasses: A Phylogenetically Controlled Screening Experiment. New Phytol. 2010, 185, 780–791. [Google Scholar] [CrossRef] [PubMed]
- Hoang, N.V.; Furtado, A.; Botha, F.C.; Simmons, B.A.; Henry, R.J. Potential for Genetic Improvement of Sugarcane as a Source of Biomass for Biofuels. Front. Bioeng. Biotechnol. 2015, 3, 182. [Google Scholar] [CrossRef] [PubMed]
- Khalil, S.R.A.; Abdelhafez, A.A.; Amer, E.A.M. Evaluation of Bioethanol Production from Juice and Bagasse of Some Sweet Sorghum Varieties. Ann. Agric. Sci. 2015, 2050, 317–324. [Google Scholar] [CrossRef]
- Sharma, R.; Liang, Y.; Lee, M.Y.; Pidatala, V.R.; Mortimer, J.C.; Scheller, H. V Agrobacterium—Mediated Transient Transformation of Sorghum Leaves for Accelerating Functional Genomics and Genome Editing Studies. BMC Res. Notes 2020, 13, 1–7. [Google Scholar] [CrossRef]
- Mnich, E.; Bjarnholt, N.; Eudes, A.; Harholt, J.; Holland, C.; Jørgensen, B.; Larsen, F.H.; Liu, M.; Manat, R.; Meyer, A.S.; et al. Phenolic cross-links: Building and de-constructing of the plant cell wall. Nat. Prod. Rep. 2020, 37, 919–961. [Google Scholar] [CrossRef]
- Wang, X.; Tang, Q.; Zhao, X.; Jia, C.; Yang, X.; He, G.; Wu, A.; Kong, Y.; Hu, R.; Zhou, G. Functional Conservation and Divergence of Miscanthus Lutarioriparius GT43 Gene Family in Xylan Biosynthesis. BMC Plant Biol. 2016, 16, 1–19. [Google Scholar] [CrossRef][Green Version]
- Tvaroška, I. Glycosyltransferases as targets for therapeutic intervention in cancer and inflammation: Molecular modeling insights. Chem. Pap. 2022, 76, 1953–1988. [Google Scholar] [CrossRef]
- Capurro, J.I.B.; Hopkins, C.W.; Sottile, G.P.; González Lebrero, M.C.; Roitberg, A.E.; Marti, M.A. Theoretical Insights into the Reaction and Inhibition Mechanism of Metal-Independent Retaining Glycosyltransferase Responsible for Mycothiol Biosynthesis. J. Phys. Chem. B 2017, 121, 471–478. [Google Scholar] [CrossRef]
- Davies, G.; Gilbert, H.; Henrissat, B.; Svensson, B.; Vocadlo, D.; Williams, S. Ten Years of CAZypedia: A Living Encyclopedia of Carbohydrate-Active Enzymes. Glycobiology 2018, 28, 3–8. [Google Scholar] [CrossRef]
- Xu, H.; Ding, A.; Chen, S.; Marowa, P.; Wang, D.; Chen, M.; Hu, R.; Kong, Y.; O’Neill, M.; Chai, G.; et al. Genome-Wide Analysis of Sorghum GT47 Family Reveals Functional Divergences of MUR3-like Genes. Front. Plant Sci. 2018, 871, 1–13. [Google Scholar] [CrossRef]
- Burton, R.A.; Fincher, G.B. Evolution and Development of Cell Walls in Cereal Grains. Front. Plant Sci. 2014, 5, 456. [Google Scholar] [CrossRef]
- Brown, D.M.; Goubet, F.; Wong, V.W.; Goodacre, R.; Stephens, E.; Dupree, P.; Turner, S.R. Comparison of Five Xylan Synthesis Mutants Reveals New Insight into the Mechanisms of Xylan Synthesis. Plant J. 2007, 52, 1154–1168. [Google Scholar] [CrossRef] [PubMed]
- Paulsen, P.; Lange, H.; Rova, U.; Christakopoulos, P.; Matsakas, L. Bioresource Technology Role and Importance of Solvents for the Fractionation of Lignocellulosic Biomass. Bioresour. Technol. 2023, 369, 128447. [Google Scholar] [CrossRef]
- Yuan, Y.; Teng, Q.; Zhong, R.; Ye, Z.H. Roles of Arabidopsis TBL34 and TBL35 in Xylan Acetylation and Plant Growth. Plant Sci. 2016, 243, 120–130. [Google Scholar] [CrossRef]
- Lee, C.; Zhong, R.; Ye, Z.H. Arabidopsis Family GT43 Members Are Xylan Xylosyltransferases Required for the Elongation of the Xylan Backbone. Plant Cell Physiol. 2012, 53, 135–143. [Google Scholar] [CrossRef] [PubMed]
- Li, L.; Huang, J.; Qin, L.; Huang, Y.; Zeng, W.; Rao, Y.; Li, J.; Li, X.; Xu, W. Two Cotton Fiber-Associated Glycosyltransferases, GhGT43A1 and GhGT43C1, Function in Hemicellulose Glucuronoxylan Biosynthesis during Plant Development. Physiol. Plant. 2014, 152, 367–379. [Google Scholar] [CrossRef]
- Lee, C.; Teng, Q.; Zhong, R.; Yuan, Y.; Ye, Z.H. Functional Roles of Rice Glycosyltransferase Family GT43 in Xylan Biosynthesis. Plant Signal. Behav. 2014, 9, e27809. [Google Scholar] [CrossRef]
- Lee, C.; Teng, Q.; Zhong, R.; Ye, Z.H. Molecular Dissection of Xylan Biosynthesis during Wood Formation in Poplar. Mol. Plant 2011, 4, 730–747. [Google Scholar] [CrossRef]
- Ratke, C.; Pawar, P.M.A.; Balasubramanian, V.K.; Naumann, M.; Duncranz, M.L.; Derba-Maceluch, M.; Gorzsás, A.; Endo, S.; Ezcurra, I.; Mellerowicz, E.J. Populus GT43 Family Members Group into Distinct Sets Required for Primary and Secondary Wall Xylan Biosynthesis and Include Useful Promoters for Wood Modification. Plant Biotechnol. J. 2015, 13, 26–37. [Google Scholar] [CrossRef]
- Zhang, A.; Xu, J.; Xu, X.; Wu, J.; Li, P.; Wang, B.; Fang, H. Genome-Wide Identification and Characterization of the KCS Gene Family in Sorghum (Sorghum bicolor (L.) Moench). PeerJ 2022, 10, e14156. [Google Scholar] [CrossRef]
- Wilson, L.F.L.; Dendooven, T.; Hardwick, S.W.; Echevarría-Poza, A.; Tryfona, T.; Krogh, K.B.R.M.; Chirgadze, D.Y.; Luisi, B.F.; Logan, D.T.; Mani, K.; et al. The Structure of EXTL3 Helps to Explain the Different Roles of Bi-Domain Exostosins in Heparan Sulfate Synthesis. Nat. Commun. 2022, 13, 3314. [Google Scholar] [CrossRef]
- Górecki, K.; McEvoy, M.M. Phylogenetic Analysis Reveals an Ancient Gene Duplication as the Origin of the MdtABC Efflux Pump. PLoS ONE 2020, 15, e0228877. [Google Scholar] [CrossRef] [PubMed]
- Ur Rehman, S.; Nadeem, A.; Javed, M.; Ul Hassan, F.; Luo, X.; Khalid, R.B.; Liu, Q. Genomic Identification, Evolution and Sequence Analysis of the Heat-Shock Protein Gene Family in Buffalo. Genes 2020, 11, 1388. [Google Scholar] [CrossRef]
- Nash, B.; Gregory, W.F.; White, R.R.; Protasio, A.V.; Gygi, S.P.; Selkirk, M.E.; Weekes, M.P.; Artavanis-Tsakonas, K. Large-Scale Proteomic Analysis of T. spiralis Muscle-Stage ESPs Identifies a Novel Upstream Motif for in Silico Prediction of Secreted Products. Front. Parasitol. 2023, 2, 1078443. [Google Scholar] [CrossRef] [PubMed]
- Waiho, K.; Afiqah-Aleng, N.; Iryani, M.T.M.; Fazhan, H. Protein–Protein Interaction Network: An Emerging Tool for Understanding Fish Disease in Aquaculture. Rev. Aquac. 2021, 13, 156–177. [Google Scholar] [CrossRef]
- Ge, H.; Xu, J.; Hua, M.; An, W.; Wu, J.; Wang, B.; Li, P.; Fang, H. Genome-Wide Identification and Analysis of ACP Gene Family in Sorghum bicolor (L.) Moench. BMC Genom. 2022, 23, 538. [Google Scholar] [CrossRef] [PubMed]
- Li, H.; Chapla, D.; Amos, R.A.; Ramiah, A.; Moremen, K.W.; Li, H. Structural Basis for Heparan Sulfate Co-Polymerase Action by the EXT1–2 Complex. Nat. Chem. Biol. 2023, 19. [Google Scholar] [CrossRef]
- Rouka, E.; Gourgoulianni, N.; Lüpold, S.; Hatzoglou, C.; Gourgoulianis, K.; Blanckenhorn, W.U.; Zarogiannis, S.G. The Drosophila Septate Junctions beyond Barrier Function: Review of the Literature, Prediction of Human Orthologs of the SJ-Related Proteins and Identification of Protein Domain Families. Acta Physiol. 2021, 231, e13527. [Google Scholar] [CrossRef]
- Zhu, K.; Wu, Q.; Huang, Y.; Ye, J.; Xu, Q.; Deng, X. Genome-Wide Characterization of Cis-Acting Elements in the Promoters of Key Carotenoid Pathway Genes from the Main Species of Genus Citrus. Hortic. Plant J. 2020, 6, 385–395. [Google Scholar] [CrossRef]
- Wang, S.; Li, R.; Zhou, Y.; Fernie, A.R.; Ding, Z.; Zhou, Q.; Che, Y.; Yao, Y.; Liu, J.; Wang, Y.; et al. Pectin Methylesterase (MePME) Genes to Filter Candidate Gene Responses to Multiple Abiotic Stresses. Plants 2023, 12, 2529. [Google Scholar] [CrossRef]
- Waese, J.; Pasha, A.; Wang, T.T.; Weringh, A.V.; Guttman, D.S.; Provart, N.J. Sequence Analysis Gene Slider: Sequence Logo Interactive Data-Visualization for Education and Research. Bioinformatics 2016, 32, 3670–3672. [Google Scholar] [CrossRef] [PubMed]
- Khodji, H.; Collet, P.; Thompson, J.D.; Jeannin-Girardon, A. De-MISTED: Image-Based Classification of Erroneous Multiple Sequence Alignments Using Convolutional Neural Networks. Appl. Intell. 2023, 53, 18806–18820. [Google Scholar] [CrossRef]
- Waterhouse, A.; Bertoni, M.; Bienert, S.; Studer, G.; Tauriello, G.; Gumienny, R.; Heer, F.T.; De Beer, T.A.P.; Rempfer, C.; Bordoli, L.; et al. SWISS-MODEL: Homology Modelling of Protein Structures and Complexes. Nucleic Acids Res. 2018, 46, W296–W303. [Google Scholar] [CrossRef] [PubMed]
- Sun, L.; Chen, Q.; Lu, H.; Wang, J.; Zhao, J.; Li, P. Electrodialysis with Porous Membrane for Bioproduct Separation: Technology, Features, and Progress. Food Res. Int. 2020, 137, 109343. [Google Scholar] [CrossRef]
- Vuttipongchaikij, S.; Brocklehurst, D.; Steele-King, C.; Ashford, D.A.; Gomez, L.D.; Mcqueen-Mason, S.J. Arabidopsis GT34 Family Contains Five Xyloglucan α-1,6-Xylosyltransferases. New Phytol. 2012, 195, 585–595. [Google Scholar] [CrossRef]
- Zhou, G.K.; Zhong, R.; Richardson, E.A.; Morrison, W.H.; Nairn, C.J.; Wood-Jones, A.; Ye, Z.H. The Poplar Glycosyltransferase GT47C Is Functionally Conserved with Arabidopsis Fragile Fiber8. Plant Cell Physiol. 2006, 47, 1229–1240. [Google Scholar] [CrossRef]
- Huang, F.F.; Chai, C.L.; Zhang, Z.; Liu, Z.H.; Dai, F.Y.; Lu, C.; Xiang, Z.H. The UDP-Glucosyltransferase Multigene Family in Bombyx mori. BMC Genom. 2008, 9, 563. [Google Scholar] [CrossRef]
- Zeng, W.; Jiang, N.; Nadella, R.; Killen, T.L.; Nadella, V.; Faik, A. A Glucurono(Arabino)Xylan Synthase Complex from Wheat Contains Members of the GT43, GT47, and GT75 Families and Functions Cooperatively. Plant Physiol. 2010, 154, 78–97. [Google Scholar] [CrossRef]
- Li, Z.; Wang, X.; Yang, K.; Zhu, C.; Yuan, T.; Wang, J.; Li, Y.; Gao, Z. Identification and Expression Analysis of the Glycosyltransferase GT43 Family Members in Bamboo Reveal Their Potential Function in Xylan Biosynthesis during Rapid Growth. BMC Genom. 2021, 22, 867. [Google Scholar] [CrossRef] [PubMed]
- Kumar Verma, J.; Wardhan, V.; Singh, D.; Chakraborty, S.; Chakraborty, N. Genome-Wide Identification of the Alba Gene Family in Plants and Stress-Responsive Expression of the Rice Alba Genes. Genes 2018, 9, 183. [Google Scholar] [CrossRef]
- Puertollano, R.; Ferguson, S.M.; Brugarolas, J.; Ballabio, A. The Complex Relationship between TFEB Transcription Factor Phosphorylation and Subcellular Localization. EMBO J. 2018, 37, e98804. [Google Scholar] [CrossRef]
- Ma, Y.; Han, Y.; Feng, X.; Gao, H.; Cao, B.; Song, L. Genome-Wide Identification of BAM (β-Amylase) Gene Family in Jujube (Ziziphus Jujuba Mill.) and Expression in Response to Abiotic Stress. BMC Genom. 2022, 23, 438. [Google Scholar] [CrossRef] [PubMed]
- Lotito, Q.F.; Musciotto, F.; Montresor, A.; Battiston, F. Higher-Order Motif Analysis in Hypergraphs. Commun. Phys. 2022, 5, 79. [Google Scholar] [CrossRef]
- Bakhtari, B.; Razi, H.; Alemzadeh, A.; Dadkhodaie, A.; Moghadam, A. Identification and Characterization of the Quinoa AP2/ERF Gene Family and Their Expression Patterns in Response to Salt Stress. Sci. Rep. 2024, 14, 29529. [Google Scholar] [CrossRef]
- Wang, Q.; McArdle, P.; Wang, S.L.; Wilmington, R.L.; Xing, Z.; Greenwood, A.; Cotten, M.L.; Qazilbash, M.M.; Schniepp, H.C. Protein Secondary Structure in Spider Silk Nanofibrils. Nat. Commun. 2022, 13, 4329. [Google Scholar] [CrossRef]
Gene ID | Gene Name |
---|---|
Sobic.010G238800 | Sb-GT43-01 |
Sobic.010G136250 | Sb-GT43-02 |
Sobic.003G129400 | Sb-GT43-03 |
Sobic.003G254700 | Sb-GT43-04 |
Sobic.003G063400 | Sb-GT43-05 |
Sobic.009G026101 | Sb-GT43-06 |
Sobic.009G229300 | Sb-GT43-07 |
Sobic.001G409100 | Sb-GT43-08 |
Sobic.006G002600 | Sb-GT43-09 |
Sobic.006G242100 | Sb-GT43-10 |
Sobic.002G430700 | Sb-GT43-11 |
Gene ID | Gene Name | Gene ID | Gene Name |
---|---|---|---|
AT2G32750 | AT-GT43-01 | LOC_Os10g32110 | LOC-GT43-01 |
AT2G32740 | AT-GT43-02 | LOC_Os10g10080 | LOC-GT43-02 |
AT2G28110 | AT-GT43-03 | LOC_Os10g40559 | LOC-GT43-03 |
AT4G32790 | AT-GT43-04 | LOC_Os10g32170 | LOC-GT43-04 |
AT4G13990 | AT-GT43-05 | LOC_Os10g32160 | LOC-GT43-05 |
AT4G16745 | AT-GT43-06 | LOC_Os08g34020 | LOC-GT43-06 |
AT4G38040 | AT-GT43-07 | LOC_Os04g48480 | LOC-GT43-07 |
AT1G74680 | AT-GT43-08 | LOC_Os04g57510 | LOC-GT43-08 |
AT1G21480 | AT-GT43-09 | LOC_Os07g37960 | LOC-GT43-09 |
AT1G34270 | AT-GT43-10 | LOC_Os01g69220 | LOC-GT43-10 |
AT1G63450 | AT-GT43-11 | LOC_Os01g70200 | LOC-GT43-11 |
AT1G67410 | AT-GT43-12 | LOC_Os01g70190 | LOC-GT43-12 |
AT3G45400 | AT-GT43-13 | LOC_Os01g59630 | LOC-GT43-13 |
AT3G07620 | AT-GT43-14 | LOC_Os01g45350 | LOC-GT43-14 |
AT3G42180 | AT-GT43-15 | LOC_Os01g01780 | LOC-GT43-15 |
AT3G57630 | AT-GT43-16 | LOC_Os03g20850 | LOC-GT43-16 |
AT3G03650 | AT-GT43-17 | LOC_Os03g05110 | LOC-GT43-17 |
AT5G20260 | AT-GT43-18 | LOC_Os03g07820 | LOC-GT43-18 |
AT5G11130 | AT-GT43-19 | LOC_Os03g08420 | LOC-GT43-19 |
AT5G25310 | AT-GT43-20 | LOC_Os03g05060 | LOC-GT43-20 |
AT5G03795 | AT-GT43-21 | LOC_Os03g05070 | LOC-GT43-21 |
AT5G19670 | AT-GT43-22 | LOC_Os03g01760 | LOC-GT43-22 |
AT5G44930 | AT-GT43-23 | LOC_Os02g32110 | LOC-GT43-23 |
AT5G11610 | AT-GT43-24 | LOC_Os06g43160 | LOC-GT43-24 |
AT5G16890 | AT-GT43-25 | LOC_Os06g23420 | LOC-GT43-25 |
AT5G33290 | AT-GT43-26 | LOC_Os12g38450 | LOC-GT43-26 |
AT5G25820 | AT-GT43-27 | LOC_Os12g03100 | LOC-GT43-27 |
LOC_Os12g12290 | LOC-GT43-28 | ||
LOC_Os11g03410 | LOC-GT43-29 |
Gene Name | Chr | Start Point | End Point | Genomic Sequence | Transcript Sequence | CDS Sequence | Peptide Sequence | Intron | Exon | Charge | Residues | PI | Molecular Weight, kDa |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Sb-GT43-01 | 10 | 58082263 | 58086285 | 4022 | 2036 | 1602 | 534 | 2 | 3 | 12 | 533 | 8.8274 | 58.254 |
Sb-GT43-02 | 10 | 20623249 | 20624115 | 866 | 330 | 330 | 110 | 1 | 2 | 5 | 109 | 8.5566 | 12.2031 |
Sb-GT43-03 | 3 | 12102872 | 12107826 | 4954 | 3718 | 1023 | 341 | 3 | 4 | 14.5 | 340 | 8.6399 | 38.455 |
Sb-GT43-04 | 3 | 59293098 | 59297511 | 4413 | 2555 | 1347 | 449 | 3 | 4 | 5.5 | 448 | 7.3209 | 50.884 |
Sb-GT43-05 | 3 | 5506774 | 5508239 | 1465 | 1200 | 855 | 285 | 2 | 3 | −12.5 | 284 | 4.6664 | 32.439 |
Sb-GT43-06 | 9 | 2315660 | 2321140 | 5480 | 1134 | 585 | 195 | 2 | 3 | −3 | 194 | 5.5736 | 21.390 |
Sb-GT43-07 | 9 | 57013699 | 57017328 | 3629 | 2411 | 1356 | 452 | 4 | 5 | 13.5 | 451 | 9.0447 | 51.452 |
Sb-GT43-08 | 1 | 69274317 | 69279345 | 5028 | 2005 | 1104 | 368 | 2 | 3 | 12 | 367 | 9.5318 | 38.676 |
Sb-GT43-09 | 6 | 454824 | 458486 | 3662 | 2050 | 1158 | 386 | 3 | 4 | 20.5 | 385 | 9.7558 | 43.357 |
Sb-GT43-10 | 6 | 58279951 | 58284051 | 4100 | 2580 | 1365 | 455 | 2 | 3 | 2.5 | 454 | 6.7236 | 48.853 |
Sb-GT43-11 | 2 | 0.7765258 | 7305 | 4489 | 1134 | 378 | 206 | 3 | 16.5 | 377 | 109.646 | 41336.58 | 45.345 |
Gene ID | Chlo | Vacu | Mito | Plas | Nucl | E. R | Cyto-Nucl | Cyto | Extr | Golg |
---|---|---|---|---|---|---|---|---|---|---|
Sb-GT43-01 | 6 | 0 | 4 | 1 | 1 | 2 | 0 | 0 | 0 | 0 |
Sb-GT43-02 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 13 | 0 | 0 |
Sb-GT43-03 | 5 | 0 | 4 | 0 | 2 | 0 | 0 | 0 | 2 | 0 |
Sb-GT43-04 | 1 | 2 | 1 | 1 | 0 | 2 | 0 | 4.5 | 0 | 1 |
Sb-GT43-05 | 1 | 0 | 0 | 1 | 11 | 0 | 0 | 0 | 0 | 0 |
Sb-GT43-06 | 1 | 0 | 0 | 0 | 3.5 | 0 | 0 | 9 | 0 | 0 |
Sb-GT43-07 | 4 | 0 | 2 | 2 | 1.5 | 0 | 2.5 | 2.5 | 1 | 1 |
Sb-GT43-08 | 6.5 | 0 | 3.5 | 0 | 0 | 0 | 0 | 4 | 0 | 0 |
Sb-GT43-09 | 4 | 1 | 5 | 1 | 0 | 1 | 0 | 0 | 0 | 1 |
Sb-GT43-10 | 4 | 0 | 6 | 0 | 0 | 0 | 0 | 4 | 0 | 0 |
Sb-GT43-11 | 6 | 0 | 6 | 1 | 0 | 1 | 0 | 0 | 0 | 0 |
Motif. N0 | Sequences of Motifs | Width | Description | Molecular Function | Cellular Component |
---|---|---|---|---|---|
1 | HQRNAALAHIEKHRLDGIVHFADEEGVYDLDLFDZLRKIRRFGAWPVATL | 50 | Homologous superfamily | Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity | Membrane |
2 | QAYYLTRLAHTLRLVPPPLLWJVVEAGKETRETAAJLRRSGLMYRHLTY | 49 | Homologous superfamily | Galactosygalactosylxylosylprotein 3-beta-glucuronosyltransferase activity | Membrane |
3 | QESRFIEKLVEDETQMEGJPDNCSRIMNWNFNLEPPHLNYPKGWQIPKNL | 50 | Homologous superfamily | Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity | Membrane |
Protein | Alpha Helix (%) | Extended Strand (%) | Beta Turn (%) | Random Coil (%) |
---|---|---|---|---|
Sobic.010G238800 | 32.83% | 18.95% | 4.32% | 43.90% |
Sobic.010G136250 | 35.78% | 27.52% | 20.18% | 16.51% |
Sobic.003G129400 | 25.88% | 18.82% | 4.71% | 50.59% |
Sobic.003G254700 | 37.28% | 13.39% | 3.57% | 45.76% |
Sobic.003G063400 | 39.44% | 14.08% | 4.93% | 41.55% |
Sobic.009G026101 | 27.32% | 23.20% | 6.19% | 43.30% |
Sobic.009G229300 | 33.92% | 16.63% | 3.77% | 45.68% |
Sobic.001G409100 | 30.25% | 17.44% | 4.90% | 47.41% |
Sobic.006G002600 | 30.39% | 16.62% | 4.16% | 48.83% |
Sobic.006G242100 | 31.94% | 21.37% | 4.85% | 41.85% |
Sobic.002G430700 | 40.05% | 15.65% | 4.24% | 40.05% |
Cis-Elements | Roles of Cis-Elements |
---|---|
ABA | involved in abscisic acid responsiveness |
IAA | involved in auxin responsiveness |
SA | involved in salicylic acid responsiveness |
GA | involved in gibberellin-responsiveness |
MeJA | involved inter- and intra-plant signaling |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Rehana, R.; Anwar, M.; Arshad, S.F.; Usman, M.; Khan, I.A. Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study. Processes 2025, 13, 709. https://doi.org/10.3390/pr13030709
Rehana R, Anwar M, Arshad SF, Usman M, Khan IA. Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study. Processes. 2025; 13(3):709. https://doi.org/10.3390/pr13030709
Chicago/Turabian StyleRehana, Rehana, Muhammad Anwar, Sarmad Frogh Arshad, Muhammad Usman, and Imran Ahmad Khan. 2025. "Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study" Processes 13, no. 3: 709. https://doi.org/10.3390/pr13030709
APA StyleRehana, R., Anwar, M., Arshad, S. F., Usman, M., & Khan, I. A. (2025). Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study. Processes, 13(3), 709. https://doi.org/10.3390/pr13030709