Next Article in Journal
Effects of Thermal Evolution Degree and Industrial Components on Pore Fracture Distribution Heterogeneity in Deep Coal Reservoirs
Next Article in Special Issue
Optimized Torrefaction of Corn Straw in a Screw Reactor: Energy Balance Analysis and Biochar Production Enhancement
Previous Article in Journal
Ozonation of Bitumen: Characteristics, Characterization, and Applications
 
 
Due to scheduled maintenance work on our database systems, there may be short service disruptions on this website between 10:00 and 11:00 CEST on June 14th.
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study

1
Institute of Plant Breeding & Biotechnology (IPBB), Muhammad Nawaz Shareef University of Agriculture, Multan 60000, Pakistan
2
School of Tropical Agriculture and Forestry (School of Agricultural and Rural Affairs, School of Rural Revitalization), Hainan University, Haikou 570228, China
3
Department of Biochemistry and Biotechnology, Muhammad Nawaz Shareef University of Agriculture, Multan 60000, Pakistan
4
Department of Pharmacy, Muhammad Nawaz Shareef University of Agriculture, Multan 66000, Pakistan
*
Authors to whom correspondence should be addressed.
Processes 2025, 13(3), 709; https://doi.org/10.3390/pr13030709
Submission received: 30 December 2024 / Revised: 13 February 2025 / Accepted: 24 February 2025 / Published: 28 February 2025

Abstract

:
Sorghum (Sorghum bicolor) is an essential bioenergy crop. Cellulosic and non-cellulosic polysaccharides, which can be transformed into biofuels, comprise most of its biomass. Many glycosyltransferases (GT) families, including GT43, are involved in the biosynthesis of xylan in plants’ primary and secondary cells. In this study, the GT43 gene family was identified, and its secondary structure and a three-dimensional (3D) model were constructed. Additionally, subcellular localization, detection of motifs, and analyses of its phylogenetic tree, physiochemical properties, protein–protein interaction network, gene structure, functional domain, gene duplication, Cis-acting elements, sequence logos, multiple sequence alignment, and gene expression profiles were performed based on RNA-sequence analyses. As a result, eleven members of the GT43 gene family were identified, and the phylogenetic tree of the GT43 gene family showed that all GT43 genes had evolutionary relationships with sorghum. Analyses of gene structure, motifs, sequence logos, and multiple sequence alignment showed that all members of the GT43 protein family were highly conserved. Subcellular localization showed all members of the GT43 protein family were localized in different compartments of sorghum. The secondary structure of the GT43 genes comprised different percentages of α-helices, random coils, β-turns, and extended strands. The tertiary structure model showed that all GT43 proteins had similar 3D structures. The results of the current study indicated that members of the GT43 gene family (Sobic.010G238800, Sobic.003G254700, and Sobic.001G409100) were highly expressed in internodes of the sorghum plant, based on RNA-Sequencing. The framework used in this study will be valuable for advancing research aligned with modern technology requirements and for enhancing understanding of the relationships among GT43 genes in Sorghum bicolor.

1. Introduction

Sorghum (Sorghum bicolor) is the most widely grown food crop due to its effective nitrogen use and extraordinary tolerance to poor soil conditions [1,2,3]. Sorghum’s genome is smaller (730 Mb) than the genomes of lignocellulosic biomass crops like switchgrass and Miscanthus [4]. The main components of sorghum biomass are cellulose (24.3–38.2%), non-cellulosic polysaccharides (12.2–22.1%), lignin (17.2–22.1%), and starch (1.2–38.2%) [5]. Sorghum is a major source of biofuel production. Multiple families of glycosyltransferases (GTs), including GT43, are involved in synthesizing non-cellulosic polysaccharides, which help with biomass and biofuel production.
Even though the sorghum genome is already available, functional research has been limited by a lack of a high-efficiency genetic transformation technology [6]. Plant cell walls mainly comprise cellulose, hemicellulose, and pectin [7]. The second most common carbohydrate in nature, xylans are the main hemicellulosic saccharides in grasses’ and dicots’ primary and secondary cell walls [8]. Enzymes named glycosyltransferases (EC 2.4.x.y) move active sugars from one molecule to another, forming glycosidic bonds [9,10]. The Carbohydrate-Active Enzymes (CAZy) database contains information on 105 different GT subfamilies based on expression and sequence similarity [11]. Mutational research in the plant species Arabidopsis thaliana demonstrates that glycosyltransferases (GTs) like GT2, GT8, GT37, GT43, GT34, and GT47 are essential for the synthesis of carbohydrates [12,13,14].
The main type of hemicellulose found in the primary and secondary cell walls of the plant tissue of sorghum is xylan. Because xylan serves as one of the elements that contribute to biomass recalcitrance, knowing how sorghum synthesizes xylan may offer approaches to change the composition of grass biomass in a way that is more favorable for biofuel production. The function of GT43 members in xylan biosynthesis is conserved in both dicots and monocots [8]. IRX9/IRX9 homolog and IRX14/IRX14 homolog, two functionally non-redundant groups of the GT43 glycosyltransferase family, are essential for xylan backbone elongation, according to studies on xylan synthesis in Arabidopsis thaliana [15,16,17]. Ten genes encoding members of the GT43 family are present in the Oryza sativa genome; however, it is not yet known if these genes are all involved in the production of xylan. The genetic material of the poplar (Populus trichocarpa) contains a group of seven GT43 genes, known as PtrGT43A-G. A complementation study revealed that Poplar PtrGT43A/B/E are IRX9 orthologs, and PtrGT43C/D are IRX14 orthologs [18]. Additionally, it has been shown that the GT43 family proteins of poplar and Oryza sativa have evolved to maintain two functionally non-redundant groups involved in manufacturing the xylan backbone [8,19,20,21]. Further, it has been found that two GT43 members from cotton, GhGT43A1 and GhGT43C1, are functional orthologues of Arabidopsis thaliana IRX9 and IRX14, respectively, and that enzymes take part in the production of the xylan backbone during fiber development [8]. Here, we use computational analysis to profile the GT43 gene family in sorghum. This study will help to formulate accurate and precise wet laboratory experiments for future use.

2. Materials and Methods

2.1. Identification of GT43 Gene Members in Sorghum bicolor

The amino acid sequence of the GT43 domain (PF03360) was utilized as a query in BLASTPto identify homologous sequences in Sorghum bicolor, Arabidopsis thaliana, and rice (Oryza sativa), using the Phytozome v13 (https://phytozome-next.jgi.doe.gov/, accessed on 7 March 2024) database [22].

2.2. Phylogenetic Analysis of GT43 Sequences

Firstly, we generated a neighbor-joining phylogenetic tree of GT43 proteins in Sorghum bicolor, and a maximum likelihood tree of GT43 gene members was constructed for Sorghum bicolor, Arabidopsis thaliana, and Oryza sativa using the MEGA 6.0 (https://mega.software.informer.com/6.0/, accessed on 10 April 2024) program [23,24].

2.3. Physiochemical Properties and Subcellular Localization Prediction

The Prot Param ExPASy15 tool (https://web.expasy.org/protparam/, accessed on 20 April 2024), was used to provide heretical estimates for several physicochemical characteristics of the proteins. The protein sequence was used to identify the total protein molecular weight (MW), isoelectric point (PI), chromosomes (Chr), Conserved Domain Sequence (CDS), genomic sequences, and transcript sequences [25]. The subcellular localization was determined using Wolf PSORT v0.2 online tool (https://wolfpsort.hgc.jp/, accessed on 3 May 2024) [26].

2.4. Protein–Protein Interaction Network and Co-Expression Prediction

Protein interactions and Co-expression were determined using the STRING 12.0 Database tool (https://string-db.org/, accessed on 15 May 2024). In this network, by design, all protein interactions with a minimum interaction score of 0.4 are displayed, and a stricter coefficient (0.3) is used to improve the precision of the interactions [27].

2.5. Prediction of Functional Domain and Family of Proteins

The Conserved Domain Database (CDD) (https://www.ncbi.nlm.nih.gov/Structure/cdd/cdd.shtml, accessed on 30 May 2024) was used to identify the functional dome and family of proteins [28].

2.6. Motif and Gene Structure Prediction

The protein motif of the GT43 gene family was predicted by using the MEME 5.5.7 tool (http://meme-suite.org/tools/meme, accessed on 5 June 2024) [29]. Through online GSDS 2.0 tool (https://gsds.gao-lab.org/, accessed on 15 June 2024), using their full-length CDS sequences, the structure of GT43 genes was identified [22].

2.7. Secondary Structure and 3D Model Construction of GT43 Protein Prediction

The secondary structure of GT43 proteins was identified by using Prabi tool (https://npsa-prabi.ibcp.fr/cgi-bin/npsa_automat.pl?page=/NPSA/npsa_sopma.html, accessed on 25 June 2024). The tertiary structure of GT43 proteins was predicted based on the protein sequence, to study the GT43 family’s protein structure further. Then, using the homologous protein modeling technique, 3D models of the GT43 proteins were built using SWISS-MODEL tool (https://swissmodel.expasy.org/interactive/, accessed on 15 July 2024) [30].

2.8. Cis-Element in Promotors Regions Prediction

The 2000bp upstream sequences of the sorghum initiation codon “ATG” of GT43 were downloaded from the Phytozome v13 (https://phytozome-next.jgi.doe.gov, accessed on 3 August 2024) database and analyzed using the Plant CARE online server (https://bioinformatics.psb.ugent.be/webtools/plantcare/html/, accessed on 15 August 2024) [31]. The number of occurrences of each CARE motif in GT43 genes were counted, and the most commonly occurring CAREs were used for prediction in Tbtools 1.6 [32].

2.9. Sequences Logos Analysis

Sequence logos are useful for representing groups of DNA or protein sequences with a conserved characteristic. The GT43 gene sequence logos were built using the TBtool 1.6 computer program [33].

2.10. Gene Expression Profiles Based on RNA-Seq

We used publicly available RNA-seq-based expression data corresponding to four sorghum internodes for studying the expression of the GT43 genes. The expression values for the GT43 genes in sorghum were extracted after the normalized expression (accession number GSE98817) from NCBI-GEO database (https://www.ncbi.nlm.nih.gov/geo/, accessed on 30 August 2024) was downloaded [34]. The TB 1.6 tool was used to generate the expression heatmap [22].

2.11. Multiple Sequence Alignment of GT43 Proteins

The Clustal W in MEGA 7.0 was used to perform the multiple sequence alignment of the 12 discovered GT43 proteins [31]. After that, the data were input into GeneDoc (http://nrbsc.org/gfx/genedoc/, accessed on 15 November 2024) to be analyzed for the conserved regions of the GT43 proteins [23,35].

3. Results

3.1. GT43 Gene Family Identification in Sorghum bicolor

The amino acid sequence of the GT43 domain (PF03360) was utilized as a query in BLASTP searches for possible homologs encoded from the Phytozome v13 (https://phytozome-next.jgi.doe.gov/) database. As a result, in Sorghum bicolor, we identified a total of sixteen GT43 gene family members. These results were then submitted to several levels of filtering, the most important of which was a 90% identity with the query sequence, the presence of a GT43-based domain, and significant -E values. This resulted in eleven putative GT43 genes in Sorghum bicolor (Table 1). We retrieved 27 and 29 GT43 genes in Arabidopsis thaliana and rice (Oryza sativa) from the Phytozome v13 database (Table 2).

3.2. Phylogenetic Analysis of GT43 Sequences

To understand the evolutionary relationships between GT43 genes in sorghum and the GT43 genes of other species, first, we constructed a neighbor-joining phylogenetic tree involving the eleven GT43 genes in Sorghum bicolor using the MEGA 5.0 program (Figure 1a). The phylogenetic tree of the GT43 genes was divided into two district groups, namely, Group I and Group II. The percentage of replicate trees which had an associated taxa cluster in the bootstrap test (1000 replicates) is shown next to branches. Secondly, we constructed a maximum likelihood tree (b) between Arabidopsis thaliana (27), rice (Oryza sativa) (29), and sorghum using the MEGA 5.0 program. All of these GT43 proteins were divided into the following groups: Group I, II, and III (Figure 1b). The results indicate that all genes have an evolutionary relationship with each other.

3.3. Physiochemical Properties and Subcellular Localization Prediction

Understanding the physicochemical properties of proteins is vital in order to classify the characteristics and properties of proteins encoded by genes in various gene families. The chemical and physical properties of the GT43 gene family are shown in (Table 3). The diversity utility of GT43 isoforms can be inferred from the wide array of their possible molecular weights (MWs) (58.254 kDa~32.4959 kDa) and the total number of peptide sequences in different GT43 proteins, which ranging from 534~206 sequences. The pH value at which the molecule has no electrical charge is the isoelectric point (PI). This is an important property of any amino acid, because every amino acid has at least two acid–base (titratable) groups [36]. The results of the present study reveal that the isoelectric point indicates the acidic nature of the members of the GT43 protein family. Various physical and chemical parameters of the GT43 proteins are shown in (Table 3). The predicted subcellular localization results show that the eleven GT43 genes were located in chloroplasts, eight in mitochondria, three in the Golgi and extracellular membrane, five in nuclei, six in the plasma membrane, and four in the endoplasmic reticulum (Table 4). Subcellular localization expression is shown by a heat map in Figure 2.

3.4. Protein–Protein Interaction Network and Co-Expression Prediction

A network was constructed using the STRING database to investigate protein–protein interactions between GT43 proteins (Figure 3). In this network, by design, all protein interactions with a minimum interaction score of 0.4 are displayed, and a stricter coefficient (0.3) is used to improve the precision of the interactions. As a result, a network consisting of 41 nodes and 40 edges was formed to represent the relationships between the GT43 genes in Sorghum bicolor (Figure 3). The cluster is composed of closely connected protein interactions, and the balls indicate an unknown effect in the interaction network. The arrows show a positive action effect. The different colors of nodes show the functional enrichment of the network (Figure 3). Co-expression is observed in Sorghum bicolor and other organisms like O. sativa, P. trichocarpa, and A. thaliana (Figure 4).

3.5. Prediction of Functional Domain and Family of Proteins

The conserved domains and protein families were predicted using the Conserved Domain Database (CDD). As a result, the Glyco-tranf- OTA type superfamily was identified in the sorghum GT43 gene family (Figure 5).

3.6. Detection of Motifs and Gene Structure Prediction

We elucidated the conserved motifs of GT43 genes by using the MEME (Multiple Em for Motif Elicitation) online servers. As a result, three motifs were identified in eleven GT43 genes, and motif 1 was identified in all members of the GT43 gene family (Figure 6). Motif 2 was present in all GT43 gene members, except some members like Sobic.010G136250, Sobic.003G063400, and Sobic.009G026101. Motif 3 was also found in members of the GT43 gene family (Sobic.003G129400, Sobic.003G254700, Sobic.009G229300 and Sobic.006G002600) (Figure 6). These results indicate that these motifs are highly conserved among GT43 genes (Figure 6). The sequences, width, and description of motifs 1–3 is presented in Table 5. The sequence logos for GT43 motifs 1–3 is shown in (Figure 7). Alterations in the structural nature of exons and introns are among the most important contributors to variation between gene families and plant variety. Genes have different functions and expressions because they have different structures [27]. The results show that the Sorghum bicolor GT43 genes Sobic.001G409100, Sobic.002G430700, Sobic.003G063400, Sobic.006G242100, Sobic.010G238800, and Sobic.009G026101 similarly contained three exons and two introns (Figure 8). Meanwhile, the GT43 gene members Sobic.006G002600, Sobic.003G254700, and Sobic.003G129400 included four exons and three introns. GT43 gene family member (Sobic.009G229300) contained five exons and four introns, while the GT43 gene Sobic.010G136250 contained two exons and one intron (Figure 8).

3.7. Prediction of Secondary Structure and 3D Model Construction of GT43 Proteins

As a result of model construction, we could see that the secondary structure of the GT43 proteins consisted mainly of alpha helices, extended strands, beta turns, and random coils, with random coils ranging from 50.59~16.51%, extended strands ranging from 27.52~13.39%, and beta turns ranging from 20.18~3.57% (Table 6). Additionally, we could see that the GT43 proteins had comparable 3D structures, from the tertiary structure generated through homology modeling (Figure 9), and we could also see the secondary structure of the GT43 proteins in terms of their composition and location. The tertiary structure has to be stable for proteins to perform biological activity.

3.8. Prediction of Cis-Elements in Promoter Regions

To better understand the potential regulatory mechanisms of GT43 genes in sorghum regarding abiotic stress responses, phytohormones, and growth and development, the upstream 2000 bp sequences of Sorghum bicolor initiation codons were used to study the promoter regions of eleven GT43 genes using online server Plant CARE. A total of four Cis-elements were discovered to be present in more than one GT43 gene family (Table 7). The results of statistical analysis for the Cis-acting elements show that the phytohormones methyl jasmonate (MeJA), auxin (IAA), gibberellin (GA), abscisic acid (ABA), and salicylic acid (SA) play a major role in the regulation of GT43 genes. (Figure 10). The results show that the GT43 family of genes may be controlled by a variety of phytohormones.

3.9. Sequence Logo Analysis

The Sequence WebLogo Chart is commonly used to analyze and display the conservation of sequence patterns, with the height of each letter representing the relative frequency of the corresponding amino acid residues. Based on the conserved protein sequences of the GT43 gene family members of Sorghum bicolor, Arabidopsis thaliana, and Oryza sativa, the results show that amino acid sequence residues are very similar among species like Sorghum bicolor, Oryza sativa, and Arabidopsis thaliana (Figure 11a–c). Within species, the Glyco-tranf-type superfamily domain of Sorghum bicolor has the most conserved sequences. Many tiny proteins, including putative ligand peptides, are typically not identified by automated annotation programs because to their smaller than 90% of known proteins. This includes the proteins with M, H, R, G, A, H, F, D, N, R, and S repeats. In this study, the distinctive amino acids of each group were identified for certain GT43 proteins.

3.10. Expression Profiles Based on RNA-Seq

For the expression analysis of the GT43 genes, we used publicly accessible RNA-seq-based expression data belonging to four sorghum internodes [22]. After downloading the normalized expression data (accession number (GSE98817) from NCBI-GEO), the expression levels for the GT43 genes in sorghum were extracted. The spatiotemporal expression pattern of GT43s was studied using transcriptome data from four internodes for xylan their formation. Analysis of expression patterns can be utilized to predict the molecular functions of genes. The majority of GT43 genes were expressed in the internodes of the sorghum plant, as shown in (Figure 12). This suggests that GT43s proteins perform variety of biological functions in internodes. In the internodes of the sorghum plant, the GT43 gene family members Sobic.010G238800, Sobic.003G254700, and Sobic.001G409100 were highly expressed. According to the colored ratio displayed by the heat map, all other GT43 gene family members were also expressed in the internodes of sorghum plants (Figure 12).

3.11. Multiple Sequence Alignment Analysis

The results of the differences between the eleven GT43 proteins analyzed using multiple sequence alignment (Figure 13) show that all GT43 transcription factor family members contained a highly conserved Glyco-transfer-type superfamily domain. The results of the study indicate that the major conserved domains belong to specific domains of the Glyco-transfer-type superfamily (Figure 5). The GT43 genes in sorghum are dependent on this domain to function, as evidenced by the observation that its sequences were highly consistent and conserved in both regions. In addition, we identified that these proteins’ C-terminal and intermediate regions were highly conserved, while their N-terminal sections were not (Figure 13).

4. Discussion

The GT43 gene family plays a crucial role in both primary and secondary cell wall biosynthesis, particularly in xylan backbone formation. Compared to diploids, monocots have a larger percentage of xylan in hemicellulose and more GT43 genes [37,38,39,40]. Therefore, one of the variables regulating the manufacturing of xylan may be GT43 [41]. The genome of moso bamboo (Phyllostachys edulis) has 17 GT43 genes in total [38]. This study identified eleven GT43 genes in Sorghum bicolor. Comparative genomics revealed their evolutionary conservation, with homologs in Arabidopsis thaliana and Oryza sativa, indicating their fundamental role in cell wall biosynthesis and plant development [42]. The phylogenetic classification of GT43 genes demonstrated a well-defined grouping pattern, suggesting functional divergence with the family (Figure 1a,b). Predicted subcellular localization in chloroplasts, mitochondria, nuclei, and plasma membranes supports their diverse metabolic roles [43].
Protein–protein interaction networks further support their involvement in secondary cell wall biosynthesis, a critical factor in plant growth, adaptation, and structural integrity [44]. Our study’s conserved domain and motif analysis identified key essential enzyme activity, reinforcing their functional stability across different plant species [45].. Gene structural analysis revealed variations in intron–exon organization, which may show evolutionary adaptations influencing gene expression and regulation [46]. The analysis of the secondary structure of GT43 genes exhibited different compositions of alpha helices, random coils, extended strands, and beta turns in sorghum to in other plants [47]. We analyzed the secondary structure of the GT43 genes and developed a model of all the GT43 proteins’ tertiary structures to understand more clearly how these genes function. The expression analysis showed that SbGT43 genes are differently expressed under abiotic stress conditions, such as salinity and drought, suggesting a role in stress tolerance mechanisms. The present study of the sequence logos indicated that all amino acid sequence residues were very similar between species Sorghum bicolor, Arabidopsis thaliana, and Oryza sativa. The result of multiple sequence alignment indicated that the Glyco-tranf-type superfamily was identified in eleven GT43 genes.
Overall, these findings suggest that GT43 genes in Sorghum bicolor have multifaceted roles in cell wall developmental processes, stress adaptation, and remodeling, making them potential candidates for crop improvement methods.

5. Conclusions

The GT43 gene family in Sorghum bicolor was thoroughly studied in this study, with an emphasis on its structural diversity, functional importance, and evolutionary conservation. We identified functional motifs, conserved domains, and expression patterns, showing these genes’ significance in cell wall biosynthesis and the stress response. A further research direction is to identify candidates for molecular breeding programs, develop gene editing techniques, conduct functional verification and mechanism exploration, and improve crop drought resistance. Since GT43 genes are involved in xylan biosynthesis, they can be manipulated to optimize cell wall composition, making sorghum a better biofuel feedstock, and modifying cell wall properties through target gene expression alterations can improve biomass digestibility, boosting bioethanol production efficiency. This study helps to improve our understanding of the GT43 plant gene family by providing a basis for future functional identification of gaps.

Author Contributions

Formal analysis, M.U. and I.A.K.; Investigation, I.A.K.; Writing—original draft, R.R., M.A. and S.F.A. Writing—review & editing, M.A. and S.F.A.; Supervision, M.A. All authors have read and agreed to the published version of the manuscript.

Funding

This research is supported by the Hainan University Research Initiation Project Fund (XJ2400005264).

Data Availability Statement

The original contributions presented in this study are included in the article. Further inquiries can be directed to the corresponding authors.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Kolozsvári, I.; Kun, Á.; Jancsó, M.; Palágyi, A.; Bozán, C.; Gyuricza, C. Agronomic Performance of Grain Sorghum (Sorghum bicolor). Agronomy 2022, 12, 1185. [Google Scholar] [CrossRef]
  2. Byrt, C.S.; Grof, C.P.L.; Furbank, R.T. C4 Plants as Biofuel Feedstocks: Optimising Biomass Production and Feedstock Quality from a Lignocellulosic Perspective. J. Integr. Plant Biol. 2011, 53, 120–135. [Google Scholar] [CrossRef]
  3. Taylor, S.H.; Hulme, S.P.; Rees, M.; Ripley, B.S.; Ian Woodward, F.; Osborne, C.P. Ecophysiological Traits in C3 and C4 Grasses: A Phylogenetically Controlled Screening Experiment. New Phytol. 2010, 185, 780–791. [Google Scholar] [CrossRef] [PubMed]
  4. Hoang, N.V.; Furtado, A.; Botha, F.C.; Simmons, B.A.; Henry, R.J. Potential for Genetic Improvement of Sugarcane as a Source of Biomass for Biofuels. Front. Bioeng. Biotechnol. 2015, 3, 182. [Google Scholar] [CrossRef] [PubMed]
  5. Khalil, S.R.A.; Abdelhafez, A.A.; Amer, E.A.M. Evaluation of Bioethanol Production from Juice and Bagasse of Some Sweet Sorghum Varieties. Ann. Agric. Sci. 2015, 2050, 317–324. [Google Scholar] [CrossRef]
  6. Sharma, R.; Liang, Y.; Lee, M.Y.; Pidatala, V.R.; Mortimer, J.C.; Scheller, H. V Agrobacterium—Mediated Transient Transformation of Sorghum Leaves for Accelerating Functional Genomics and Genome Editing Studies. BMC Res. Notes 2020, 13, 1–7. [Google Scholar] [CrossRef]
  7. Mnich, E.; Bjarnholt, N.; Eudes, A.; Harholt, J.; Holland, C.; Jørgensen, B.; Larsen, F.H.; Liu, M.; Manat, R.; Meyer, A.S.; et al. Phenolic cross-links: Building and de-constructing of the plant cell wall. Nat. Prod. Rep. 2020, 37, 919–961. [Google Scholar] [CrossRef]
  8. Wang, X.; Tang, Q.; Zhao, X.; Jia, C.; Yang, X.; He, G.; Wu, A.; Kong, Y.; Hu, R.; Zhou, G. Functional Conservation and Divergence of Miscanthus Lutarioriparius GT43 Gene Family in Xylan Biosynthesis. BMC Plant Biol. 2016, 16, 1–19. [Google Scholar] [CrossRef]
  9. Tvaroška, I. Glycosyltransferases as targets for therapeutic intervention in cancer and inflammation: Molecular modeling insights. Chem. Pap. 2022, 76, 1953–1988. [Google Scholar] [CrossRef]
  10. Capurro, J.I.B.; Hopkins, C.W.; Sottile, G.P.; González Lebrero, M.C.; Roitberg, A.E.; Marti, M.A. Theoretical Insights into the Reaction and Inhibition Mechanism of Metal-Independent Retaining Glycosyltransferase Responsible for Mycothiol Biosynthesis. J. Phys. Chem. B 2017, 121, 471–478. [Google Scholar] [CrossRef]
  11. Davies, G.; Gilbert, H.; Henrissat, B.; Svensson, B.; Vocadlo, D.; Williams, S. Ten Years of CAZypedia: A Living Encyclopedia of Carbohydrate-Active Enzymes. Glycobiology 2018, 28, 3–8. [Google Scholar] [CrossRef]
  12. Xu, H.; Ding, A.; Chen, S.; Marowa, P.; Wang, D.; Chen, M.; Hu, R.; Kong, Y.; O’Neill, M.; Chai, G.; et al. Genome-Wide Analysis of Sorghum GT47 Family Reveals Functional Divergences of MUR3-like Genes. Front. Plant Sci. 2018, 871, 1–13. [Google Scholar] [CrossRef]
  13. Burton, R.A.; Fincher, G.B. Evolution and Development of Cell Walls in Cereal Grains. Front. Plant Sci. 2014, 5, 456. [Google Scholar] [CrossRef]
  14. Brown, D.M.; Goubet, F.; Wong, V.W.; Goodacre, R.; Stephens, E.; Dupree, P.; Turner, S.R. Comparison of Five Xylan Synthesis Mutants Reveals New Insight into the Mechanisms of Xylan Synthesis. Plant J. 2007, 52, 1154–1168. [Google Scholar] [CrossRef] [PubMed]
  15. Paulsen, P.; Lange, H.; Rova, U.; Christakopoulos, P.; Matsakas, L. Bioresource Technology Role and Importance of Solvents for the Fractionation of Lignocellulosic Biomass. Bioresour. Technol. 2023, 369, 128447. [Google Scholar] [CrossRef]
  16. Yuan, Y.; Teng, Q.; Zhong, R.; Ye, Z.H. Roles of Arabidopsis TBL34 and TBL35 in Xylan Acetylation and Plant Growth. Plant Sci. 2016, 243, 120–130. [Google Scholar] [CrossRef]
  17. Lee, C.; Zhong, R.; Ye, Z.H. Arabidopsis Family GT43 Members Are Xylan Xylosyltransferases Required for the Elongation of the Xylan Backbone. Plant Cell Physiol. 2012, 53, 135–143. [Google Scholar] [CrossRef] [PubMed]
  18. Li, L.; Huang, J.; Qin, L.; Huang, Y.; Zeng, W.; Rao, Y.; Li, J.; Li, X.; Xu, W. Two Cotton Fiber-Associated Glycosyltransferases, GhGT43A1 and GhGT43C1, Function in Hemicellulose Glucuronoxylan Biosynthesis during Plant Development. Physiol. Plant. 2014, 152, 367–379. [Google Scholar] [CrossRef]
  19. Lee, C.; Teng, Q.; Zhong, R.; Yuan, Y.; Ye, Z.H. Functional Roles of Rice Glycosyltransferase Family GT43 in Xylan Biosynthesis. Plant Signal. Behav. 2014, 9, e27809. [Google Scholar] [CrossRef]
  20. Lee, C.; Teng, Q.; Zhong, R.; Ye, Z.H. Molecular Dissection of Xylan Biosynthesis during Wood Formation in Poplar. Mol. Plant 2011, 4, 730–747. [Google Scholar] [CrossRef]
  21. Ratke, C.; Pawar, P.M.A.; Balasubramanian, V.K.; Naumann, M.; Duncranz, M.L.; Derba-Maceluch, M.; Gorzsás, A.; Endo, S.; Ezcurra, I.; Mellerowicz, E.J. Populus GT43 Family Members Group into Distinct Sets Required for Primary and Secondary Wall Xylan Biosynthesis and Include Useful Promoters for Wood Modification. Plant Biotechnol. J. 2015, 13, 26–37. [Google Scholar] [CrossRef]
  22. Zhang, A.; Xu, J.; Xu, X.; Wu, J.; Li, P.; Wang, B.; Fang, H. Genome-Wide Identification and Characterization of the KCS Gene Family in Sorghum (Sorghum bicolor (L.) Moench). PeerJ 2022, 10, e14156. [Google Scholar] [CrossRef]
  23. Wilson, L.F.L.; Dendooven, T.; Hardwick, S.W.; Echevarría-Poza, A.; Tryfona, T.; Krogh, K.B.R.M.; Chirgadze, D.Y.; Luisi, B.F.; Logan, D.T.; Mani, K.; et al. The Structure of EXTL3 Helps to Explain the Different Roles of Bi-Domain Exostosins in Heparan Sulfate Synthesis. Nat. Commun. 2022, 13, 3314. [Google Scholar] [CrossRef]
  24. Górecki, K.; McEvoy, M.M. Phylogenetic Analysis Reveals an Ancient Gene Duplication as the Origin of the MdtABC Efflux Pump. PLoS ONE 2020, 15, e0228877. [Google Scholar] [CrossRef] [PubMed]
  25. Ur Rehman, S.; Nadeem, A.; Javed, M.; Ul Hassan, F.; Luo, X.; Khalid, R.B.; Liu, Q. Genomic Identification, Evolution and Sequence Analysis of the Heat-Shock Protein Gene Family in Buffalo. Genes 2020, 11, 1388. [Google Scholar] [CrossRef]
  26. Nash, B.; Gregory, W.F.; White, R.R.; Protasio, A.V.; Gygi, S.P.; Selkirk, M.E.; Weekes, M.P.; Artavanis-Tsakonas, K. Large-Scale Proteomic Analysis of T. spiralis Muscle-Stage ESPs Identifies a Novel Upstream Motif for in Silico Prediction of Secreted Products. Front. Parasitol. 2023, 2, 1078443. [Google Scholar] [CrossRef] [PubMed]
  27. Waiho, K.; Afiqah-Aleng, N.; Iryani, M.T.M.; Fazhan, H. Protein–Protein Interaction Network: An Emerging Tool for Understanding Fish Disease in Aquaculture. Rev. Aquac. 2021, 13, 156–177. [Google Scholar] [CrossRef]
  28. Ge, H.; Xu, J.; Hua, M.; An, W.; Wu, J.; Wang, B.; Li, P.; Fang, H. Genome-Wide Identification and Analysis of ACP Gene Family in Sorghum bicolor (L.) Moench. BMC Genom. 2022, 23, 538. [Google Scholar] [CrossRef] [PubMed]
  29. Li, H.; Chapla, D.; Amos, R.A.; Ramiah, A.; Moremen, K.W.; Li, H. Structural Basis for Heparan Sulfate Co-Polymerase Action by the EXT1–2 Complex. Nat. Chem. Biol. 2023, 19. [Google Scholar] [CrossRef]
  30. Rouka, E.; Gourgoulianni, N.; Lüpold, S.; Hatzoglou, C.; Gourgoulianis, K.; Blanckenhorn, W.U.; Zarogiannis, S.G. The Drosophila Septate Junctions beyond Barrier Function: Review of the Literature, Prediction of Human Orthologs of the SJ-Related Proteins and Identification of Protein Domain Families. Acta Physiol. 2021, 231, e13527. [Google Scholar] [CrossRef]
  31. Zhu, K.; Wu, Q.; Huang, Y.; Ye, J.; Xu, Q.; Deng, X. Genome-Wide Characterization of Cis-Acting Elements in the Promoters of Key Carotenoid Pathway Genes from the Main Species of Genus Citrus. Hortic. Plant J. 2020, 6, 385–395. [Google Scholar] [CrossRef]
  32. Wang, S.; Li, R.; Zhou, Y.; Fernie, A.R.; Ding, Z.; Zhou, Q.; Che, Y.; Yao, Y.; Liu, J.; Wang, Y.; et al. Pectin Methylesterase (MePME) Genes to Filter Candidate Gene Responses to Multiple Abiotic Stresses. Plants 2023, 12, 2529. [Google Scholar] [CrossRef]
  33. Waese, J.; Pasha, A.; Wang, T.T.; Weringh, A.V.; Guttman, D.S.; Provart, N.J. Sequence Analysis Gene Slider: Sequence Logo Interactive Data-Visualization for Education and Research. Bioinformatics 2016, 32, 3670–3672. [Google Scholar] [CrossRef] [PubMed]
  34. Khodji, H.; Collet, P.; Thompson, J.D.; Jeannin-Girardon, A. De-MISTED: Image-Based Classification of Erroneous Multiple Sequence Alignments Using Convolutional Neural Networks. Appl. Intell. 2023, 53, 18806–18820. [Google Scholar] [CrossRef]
  35. Waterhouse, A.; Bertoni, M.; Bienert, S.; Studer, G.; Tauriello, G.; Gumienny, R.; Heer, F.T.; De Beer, T.A.P.; Rempfer, C.; Bordoli, L.; et al. SWISS-MODEL: Homology Modelling of Protein Structures and Complexes. Nucleic Acids Res. 2018, 46, W296–W303. [Google Scholar] [CrossRef] [PubMed]
  36. Sun, L.; Chen, Q.; Lu, H.; Wang, J.; Zhao, J.; Li, P. Electrodialysis with Porous Membrane for Bioproduct Separation: Technology, Features, and Progress. Food Res. Int. 2020, 137, 109343. [Google Scholar] [CrossRef]
  37. Vuttipongchaikij, S.; Brocklehurst, D.; Steele-King, C.; Ashford, D.A.; Gomez, L.D.; Mcqueen-Mason, S.J. Arabidopsis GT34 Family Contains Five Xyloglucan α-1,6-Xylosyltransferases. New Phytol. 2012, 195, 585–595. [Google Scholar] [CrossRef]
  38. Zhou, G.K.; Zhong, R.; Richardson, E.A.; Morrison, W.H.; Nairn, C.J.; Wood-Jones, A.; Ye, Z.H. The Poplar Glycosyltransferase GT47C Is Functionally Conserved with Arabidopsis Fragile Fiber8. Plant Cell Physiol. 2006, 47, 1229–1240. [Google Scholar] [CrossRef]
  39. Huang, F.F.; Chai, C.L.; Zhang, Z.; Liu, Z.H.; Dai, F.Y.; Lu, C.; Xiang, Z.H. The UDP-Glucosyltransferase Multigene Family in Bombyx mori. BMC Genom. 2008, 9, 563. [Google Scholar] [CrossRef]
  40. Zeng, W.; Jiang, N.; Nadella, R.; Killen, T.L.; Nadella, V.; Faik, A. A Glucurono(Arabino)Xylan Synthase Complex from Wheat Contains Members of the GT43, GT47, and GT75 Families and Functions Cooperatively. Plant Physiol. 2010, 154, 78–97. [Google Scholar] [CrossRef]
  41. Li, Z.; Wang, X.; Yang, K.; Zhu, C.; Yuan, T.; Wang, J.; Li, Y.; Gao, Z. Identification and Expression Analysis of the Glycosyltransferase GT43 Family Members in Bamboo Reveal Their Potential Function in Xylan Biosynthesis during Rapid Growth. BMC Genom. 2021, 22, 867. [Google Scholar] [CrossRef] [PubMed]
  42. Kumar Verma, J.; Wardhan, V.; Singh, D.; Chakraborty, S.; Chakraborty, N. Genome-Wide Identification of the Alba Gene Family in Plants and Stress-Responsive Expression of the Rice Alba Genes. Genes 2018, 9, 183. [Google Scholar] [CrossRef]
  43. Puertollano, R.; Ferguson, S.M.; Brugarolas, J.; Ballabio, A. The Complex Relationship between TFEB Transcription Factor Phosphorylation and Subcellular Localization. EMBO J. 2018, 37, e98804. [Google Scholar] [CrossRef]
  44. Ma, Y.; Han, Y.; Feng, X.; Gao, H.; Cao, B.; Song, L. Genome-Wide Identification of BAM (β-Amylase) Gene Family in Jujube (Ziziphus Jujuba Mill.) and Expression in Response to Abiotic Stress. BMC Genom. 2022, 23, 438. [Google Scholar] [CrossRef] [PubMed]
  45. Lotito, Q.F.; Musciotto, F.; Montresor, A.; Battiston, F. Higher-Order Motif Analysis in Hypergraphs. Commun. Phys. 2022, 5, 79. [Google Scholar] [CrossRef]
  46. Bakhtari, B.; Razi, H.; Alemzadeh, A.; Dadkhodaie, A.; Moghadam, A. Identification and Characterization of the Quinoa AP2/ERF Gene Family and Their Expression Patterns in Response to Salt Stress. Sci. Rep. 2024, 14, 29529. [Google Scholar] [CrossRef]
  47. Wang, Q.; McArdle, P.; Wang, S.L.; Wilmington, R.L.; Xing, Z.; Greenwood, A.; Cotten, M.L.; Qazilbash, M.M.; Schniepp, H.C. Protein Secondary Structure in Spider Silk Nanofibrils. Nat. Commun. 2022, 13, 4329. [Google Scholar] [CrossRef]
Figure 1. (a) Phylogenetic tree of GT43 proteins in Sorghum bicolor. (b): Maximum likelihood tree was constructed for GT43 genes in Sorghum bicolor, Arabidopsis thaliana, and Oryza sativa using MEGA 6.0 program.
Figure 1. (a) Phylogenetic tree of GT43 proteins in Sorghum bicolor. (b): Maximum likelihood tree was constructed for GT43 genes in Sorghum bicolor, Arabidopsis thaliana, and Oryza sativa using MEGA 6.0 program.
Processes 13 00709 g001
Figure 2. Subcellular localization of GT43 gene family in Sorghum bicolor, shown by heat map.
Figure 2. Subcellular localization of GT43 gene family in Sorghum bicolor, shown by heat map.
Processes 13 00709 g002
Figure 3. Using the STRING database, we built a protein-protein interaction network to study the interactions between the sorghum GT43 genes. The colored nodes show proteins, and the lines between them show the interactions between the proteins, as recorded by the database references for functional enrichment.
Figure 3. Using the STRING database, we built a protein-protein interaction network to study the interactions between the sorghum GT43 genes. The colored nodes show proteins, and the lines between them show the interactions between the proteins, as recorded by the database references for functional enrichment.
Processes 13 00709 g003
Figure 4. Co-expression was observed in Sorghum bicolor and other organisms like O. sativa, P. trichocarpa, and A. thaliana.
Figure 4. Co-expression was observed in Sorghum bicolor and other organisms like O. sativa, P. trichocarpa, and A. thaliana.
Processes 13 00709 g004
Figure 5. Conserved domains of Sorghum bicolor GT43 protein. Colored boxes serve as indicators for each site. Measurement bar represents 600 amino acids.
Figure 5. Conserved domains of Sorghum bicolor GT43 protein. Colored boxes serve as indicators for each site. Measurement bar represents 600 amino acids.
Processes 13 00709 g005
Figure 6. Motif analysis of GT43 gene family.
Figure 6. Motif analysis of GT43 gene family.
Processes 13 00709 g006
Figure 7. Sequence logos of GT43 motifs 1–3 in Sorghum.
Figure 7. Sequence logos of GT43 motifs 1–3 in Sorghum.
Processes 13 00709 g007
Figure 8. Schematic diagram representing structures of GT43 genes of sorghum. Exons are characterized by yellow boxes and introns by black lines. Intron phase numbers 0 and 1 are also displayed at beginning of introns. All dimensions are accurate in this diagram.
Figure 8. Schematic diagram representing structures of GT43 genes of sorghum. Exons are characterized by yellow boxes and introns by black lines. Intron phase numbers 0 and 1 are also displayed at beginning of introns. All dimensions are accurate in this diagram.
Processes 13 00709 g008
Figure 9. The GT43s proteins are represented in three dimensions (3D). A similar protein modeling technique on the SWISS-MODEL website was used to generate the 3D model of the GT43 protein. The bottom of each 3D model displays distinct colored proteins from the various subfamilies.
Figure 9. The GT43s proteins are represented in three dimensions (3D). A similar protein modeling technique on the SWISS-MODEL website was used to generate the 3D model of the GT43 protein. The bottom of each 3D model displays distinct colored proteins from the various subfamilies.
Processes 13 00709 g009
Figure 10. Cis-elements in promotor region. Different colored wedges represent different cis-elements. Length and position of each GT43 gene are drawn to scale. Scale bar indicates DNA sequence length.
Figure 10. Cis-elements in promotor region. Different colored wedges represent different cis-elements. Length and position of each GT43 gene are drawn to scale. Scale bar indicates DNA sequence length.
Processes 13 00709 g010
Figure 11. (a): Conserved region (amino acid residue) sequence logos for (a) Sorghum bicolor, (b) Oryza sativa, and (c) Arabidopsis thaliana.
Figure 11. (a): Conserved region (amino acid residue) sequence logos for (a) Sorghum bicolor, (b) Oryza sativa, and (c) Arabidopsis thaliana.
Processes 13 00709 g011
Figure 12. Expression profiles of GT43 in internodes of Sorghum bicolor. Gene is shown to right, and tissues or treatment are shown at bottom.
Figure 12. Expression profiles of GT43 in internodes of Sorghum bicolor. Gene is shown to right, and tissues or treatment are shown at bottom.
Processes 13 00709 g012
Figure 13. Multiple sequence alignment between GT43 proteins.
Figure 13. Multiple sequence alignment between GT43 proteins.
Processes 13 00709 g013
Table 1. Identified GT43 genes in Sorghum bicolor.
Table 1. Identified GT43 genes in Sorghum bicolor.
Gene ID Gene Name
Sobic.010G238800Sb-GT43-01
Sobic.010G136250Sb-GT43-02
Sobic.003G129400Sb-GT43-03
Sobic.003G254700Sb-GT43-04
Sobic.003G063400Sb-GT43-05
Sobic.009G026101Sb-GT43-06
Sobic.009G229300Sb-GT43-07
Sobic.001G409100Sb-GT43-08
Sobic.006G002600Sb-GT43-09
Sobic.006G242100Sb-GT43-10
Sobic.002G430700Sb-GT43-11
Table 2. Identified GT43 genes in Arabidopsis thaliana and rice (Oryza sativa).
Table 2. Identified GT43 genes in Arabidopsis thaliana and rice (Oryza sativa).
Gene IDGene NameGene IDGene Name
AT2G32750AT-GT43-01LOC_Os10g32110LOC-GT43-01
AT2G32740AT-GT43-02LOC_Os10g10080LOC-GT43-02
AT2G28110AT-GT43-03LOC_Os10g40559LOC-GT43-03
AT4G32790AT-GT43-04LOC_Os10g32170LOC-GT43-04
AT4G13990AT-GT43-05LOC_Os10g32160LOC-GT43-05
AT4G16745AT-GT43-06LOC_Os08g34020LOC-GT43-06
AT4G38040AT-GT43-07LOC_Os04g48480LOC-GT43-07
AT1G74680AT-GT43-08LOC_Os04g57510LOC-GT43-08
AT1G21480AT-GT43-09LOC_Os07g37960LOC-GT43-09
AT1G34270AT-GT43-10LOC_Os01g69220LOC-GT43-10
AT1G63450AT-GT43-11LOC_Os01g70200LOC-GT43-11
AT1G67410AT-GT43-12LOC_Os01g70190LOC-GT43-12
AT3G45400AT-GT43-13LOC_Os01g59630LOC-GT43-13
AT3G07620AT-GT43-14LOC_Os01g45350LOC-GT43-14
AT3G42180AT-GT43-15LOC_Os01g01780LOC-GT43-15
AT3G57630AT-GT43-16LOC_Os03g20850LOC-GT43-16
AT3G03650AT-GT43-17LOC_Os03g05110LOC-GT43-17
AT5G20260AT-GT43-18LOC_Os03g07820LOC-GT43-18
AT5G11130AT-GT43-19LOC_Os03g08420LOC-GT43-19
AT5G25310AT-GT43-20LOC_Os03g05060LOC-GT43-20
AT5G03795AT-GT43-21LOC_Os03g05070LOC-GT43-21
AT5G19670AT-GT43-22LOC_Os03g01760LOC-GT43-22
AT5G44930AT-GT43-23LOC_Os02g32110LOC-GT43-23
AT5G11610AT-GT43-24LOC_Os06g43160LOC-GT43-24
AT5G16890AT-GT43-25LOC_Os06g23420LOC-GT43-25
AT5G33290AT-GT43-26LOC_Os12g38450LOC-GT43-26
AT5G25820AT-GT43-27LOC_Os12g03100LOC-GT43-27
LOC_Os12g12290LOC-GT43-28
LOC_Os11g03410LOC-GT43-29
Table 3. Physiochemical properties of GT43 gene family in Sorghum bicolor.
Table 3. Physiochemical properties of GT43 gene family in Sorghum bicolor.
Gene Name ChrStart Point End Point Genomic SequenceTranscript SequenceCDS SequencePeptide SequenceIntron ExonChargeResiduesPI Molecular Weight, kDa
Sb-GT43-01105808226358086285 40222036160253423125338.827458.254
Sb-GT43-021020623249206241158663303301101251098.556612.2031
Sb-GT43-03312102872121078264954371810233413414.53408.639938.455
Sb-GT43-0435929309859297511441325551347449345.54487.320950.884
Sb-GT43-05355067745508239 1465120085528523−12.52844.666432.439
Sb-GT43-06923156602321140 5480113458519523−31945.573621.390
Sb-GT43-07957013699570173283629241113564524513.54519.044751.452
Sb-GT43-081692743176927934550282005110436823123679.531838.676
Sb-GT43-0964548244584863662205011583863420.53859.755843.357
Sb-GT43-1065827995158284051410025801365455232.54546.723648.853
Sb-GT43-1120.7765258730544891134378206316.5377109.64641336.5845.345
MW—protein molecular weight; PI—isoelectric point (PI); Chr—chromosome; CDS—Conserved Domain Sequence.
Table 4. Subcellular localization of GT43 gene family in sorghum.
Table 4. Subcellular localization of GT43 gene family in sorghum.
Gene IDChloVacuMitoPlasNucl E. RCyto-NuclCytoExtrGolg
Sb-GT43-016041120000
Sb-GT43-0210000001300
Sb-GT43-035040200020
Sb-GT43-0412110204.501
Sb-GT43-0510011100000
Sb-GT43-0610003.500900
Sb-GT43-0740221.502.52.511
Sb-GT43-086.503.50000400
Sb-GT43-094151010001
Sb-GT43-104060000400
Sb-GT43-116061010000
Table 5. Description of motifs found in GT43 gene family of Sorghum bicolor.
Table 5. Description of motifs found in GT43 gene family of Sorghum bicolor.
Motif. N0Sequences of MotifsWidthDescriptionMolecular Function Cellular Component
1HQRNAALAHIEKHRLDGIVHFADEEGVYDLDLFDZLRKIRRFGAWPVATL50Homologous superfamily Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activityMembrane
2QAYYLTRLAHTLRLVPPPLLWJVVEAGKETRETAAJLRRSGLMYRHLTY49Homologous superfamilyGalactosygalactosylxylosylprotein 3-beta-glucuronosyltransferase activityMembrane
3QESRFIEKLVEDETQMEGJPDNCSRIMNWNFNLEPPHLNYPKGWQIPKNL50Homologous superfamilyGalactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activityMembrane
A total of 3 motifs were predicated by the MEME tool. This table shows the sequences, width, and description of motifs 1–3 present in the GT43 gene family of Sorghum bicolor.
Table 6. The secondary structure statistics of the GT43 proteins.
Table 6. The secondary structure statistics of the GT43 proteins.
ProteinAlpha Helix (%)Extended Strand (%)Beta Turn (%)Random Coil (%)
Sobic.010G23880032.83%18.95%4.32%43.90%
Sobic.010G13625035.78%27.52%20.18%16.51%
Sobic.003G12940025.88%18.82%4.71%50.59%
Sobic.003G25470037.28%13.39%3.57%45.76%
Sobic.003G06340039.44%14.08%4.93%41.55%
Sobic.009G02610127.32%23.20%6.19%43.30%
Sobic.009G22930033.92%16.63%3.77%45.68%
Sobic.001G40910030.25%17.44%4.90%47.41%
Sobic.006G00260030.39%16.62%4.16%48.83%
Sobic.006G24210031.94%21.37%4.85%41.85%
Sobic.002G43070040.05%15.65%4.24%40.05%
Table 7. Functional roles of Cis-elements identified in promoter regions of GT43 genes.
Table 7. Functional roles of Cis-elements identified in promoter regions of GT43 genes.
Cis-ElementsRoles of Cis-Elements
ABAinvolved in abscisic acid responsiveness
IAAinvolved in auxin responsiveness
SAinvolved in salicylic acid responsiveness
GAinvolved in gibberellin-responsiveness
MeJAinvolved inter- and intra-plant signaling
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Rehana, R.; Anwar, M.; Arshad, S.F.; Usman, M.; Khan, I.A. Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study. Processes 2025, 13, 709. https://doi.org/10.3390/pr13030709

AMA Style

Rehana R, Anwar M, Arshad SF, Usman M, Khan IA. Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study. Processes. 2025; 13(3):709. https://doi.org/10.3390/pr13030709

Chicago/Turabian Style

Rehana, Rehana, Muhammad Anwar, Sarmad Frogh Arshad, Muhammad Usman, and Imran Ahmad Khan. 2025. "Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study" Processes 13, no. 3: 709. https://doi.org/10.3390/pr13030709

APA Style

Rehana, R., Anwar, M., Arshad, S. F., Usman, M., & Khan, I. A. (2025). Genome-Wide Identification and Functional Characterization of the Glycosyltransferase 43 (GT43) Gene Family in Sorghum bicolor for Biofuel Development: A Comprehensive Study. Processes, 13(3), 709. https://doi.org/10.3390/pr13030709

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop