Abstract
Cell proliferation plays a pivotal role in multiple physiological processes, including osteoporosis alleviation, wound healing, and immune enhancement. Numerous novel peptides with cell proliferation-promoting activity have been identified. These peptides exert their functions by modulating key cellular signaling pathways, thereby regulating diverse biological processes related to cell proliferation. This work summarizes peptides derived from animals and plants that stimulate cell proliferation, focusing on their amino acid composition, physicochemical properties, and preparation techniques. Furthermore, we highlight the major signaling pathways—such as the PI3K/Akt, MAPK/ERK, and Wnt/β-catenin pathways—that have been implicated in the mechanistic studies of food-derived peptides. Through the analysis and summary of previous studies, we observe a notable lack of in vivo animal models and clinical trials, indicating that these may represent promising directions for future research on food-derived bioactive peptides. Meanwhile, the potential safety concerns of proliferation-enhancing peptides—such as immunogenicity, appropriate dosage, and gastrointestinal stability—warrant greater attention. In summary, this review provides a comprehensive overview of the sources and mechanisms of cell proliferation-promoting peptides and addresses the challenges in industrializing bioactive peptide-based functional foods; therefore, further research in this area is encouraged.
1. Introduction
In recent years, it has been widely recognized that food proteins provide a variety of bioactive peptides. These peptides are known for their functional and nutritional benefits. These peptides could be released by enzymatic hydrolysis, solid-phase peptide synthesis, fermentation, and other methods. Apart from providing essential amino acids and repairing tissue, these peptides were shown to exhibit diverse functions, including the promotion of cell proliferation [1,2]. Cell proliferation is a fundamental process that plays a crucial role in tissue and organ growth, development, repair, osteoporosis prevention, wound healing, and immune enhancement. In eukaryotic organisms, cell division occurs either when they attain a specific size or in response to external signals such as growth factors or hormones [3]. This process involves an intricate regulatory mechanism wherein the activation of crucial pathways and the involvement of pivotal functional genes are essential.
Osteoporosis has become a significant health concern for middle-aged and elderly individuals. According to the Chinese Osteoporosis Epidemiological Survey, osteoporosis affects more than 200 million individuals worldwide, and the projected expenditure for managing osteoporotic fractures is anticipated to exceed USD 25 billion by 2025 [4]. Osteoporosis primarily results from decreased osteoblast activity, leading to reduced bone mass [5] and the deterioration of bone structure [6], which increases the risk of fractures in middle-aged and elderly individuals. Osteoblasts are critical for bone development, remodeling, and repair [7]. Peptides from food sources could promote osteoblast proliferation and differentiation via the phosphoinositide 3-kinase (PI3K)/protein kinase B (AKT) signaling pathway [8], mitogen-activated protein kinase (MAPK) signaling pathway [9], and Wnt/β-catenin signaling pathway [7]. Therefore, a feasible approach to prevent osteoporosis is to stimulate osteoblast activity through the supplementation of food-derived peptides.
Cell proliferation is essential for wound healing. The skin serves as a barrier, protecting internal organs and tissues against external damage, such as mechanical injuries and metabolic dysfunction [10,11]. Skin injuries need effective healing to ensure health and survival. Skin wound healing has four stages: hemostasis, inflammation, proliferation, and tissue remodeling [12].
Cell proliferation is a key stage. Neovascularization, tissue regeneration, and remodeling depend on the proliferation and migration of fibroblasts and endothelial cells. These processes are essential for forming the extracellular matrix (ECM) and promoting angiogenesis [13]. Thus, enhancing the proliferation of fibroblasts and endothelial cells facilitates the regeneration of damaged skin [12]. Numerous bioactive peptides from food sources have been found to possess the ability to facilitate human skin fibroblast (HSF) and human umbilical vein endothelial cell (HUVEC) proliferation to promote wound healing via the MAPK [3], AKT [12], and nuclear factor κ-B (NF-κB) signaling pathways [14].
Cell proliferation is also essential in boosting immunity. The immune system protects the body from pathogens, toxic antigens, and tumor cells [15]. An abnormal immune response can lead to excessive inflammation and tissue damage [16]. Lymphocytes play a crucial role in fighting infections and monitoring cellular mutations [17]. Activated macrophages help eliminate pathogens, dead cells, and foreign bodies through phagocytosis [18]. Peptides from food sources promote the proliferation of macrophages and lymphocytes via the NF-κB and MAPK signaling pathways. These peptides also reduce the secretion of pro-inflammatory cytokines like TNF-α, IL-6, NO, and PGE2, thereby offering anti-inflammatory and immunomodulatory effects [19,20,21].
Peptides promoting cell proliferation have gained significant attention in recent research. The literature search in this study was retrieved from the Web of Science database (time frame: 1900 to 31 December 2024) and screened based on preset inclusion and exclusion criteria. Ultimately, 97 studies were included. Furthermore, this work summarizes peptides from food that promote cell proliferation, focusing on their mechanisms, safety risks, and comparison of their abilities. These findings provide a foundation for further research on functional foods and nutritional health products in humans.
2. Source and Preparation of Cell Proliferation-Promoting Peptides
2.1. Cell Proliferation-Promoting Peptides Derived from Aquatic Animals
In recent years, many studies have focused on peptides in aquatic products. Marine bioactive peptides are a rich source of diverse bioactive compounds. Studies over the past decades have provided sufficient evidence on their production, optimization, characterization, composition, and sequence. Many peptides from aquatic animals promote osteocyte proliferation and alleviate osteoporosis. Peptides from sea cucumbers have the strongest cell proliferation capacity [3]. Most of these peptides are derived from deep-sea fish and shellfish, with sea cucumbers having the most robust cell proliferation capacity [12]. However, the cell proliferation capacity of peptides extracted from the scales of Mozambique tilapia is weak [22].
Among the peptides derived from aquatic animals (Table 1), the longest peptide is the peptide NINECFSSPCENOGICODEIDGYNCVCOPGFTGTHCE from sea cucumber [3], while the shortest peptide is KSA from fish bone [23]. Most peptides have 4 to 20 amino acid residues, indicating that the length of peptides may significantly affect cell proliferation. Peptides promoting bone development often contain glutamic acid, glutamine, aspartic acid, glycine, arginine, and leucine, which support osteoblast metabolism and bone growth [24]. The activation of the ERK1/2, AKT, PI3K/AKT, MAPK, and SMAD pathways in osteoblasts is triggered by receptors like LRP1, IGF-1R, and TGF-β in response to peptides [25]. These signaling cascades are crucial for osteoblast proliferation, migration, survival, differentiation, and matrix formation [26].
The peptide extraction process from aquatic animals involves several steps: pre-treatment, enzymatic disintegration, purification, and identification. Different pre-treatments are used for various foods. For example, collagen peptides extracted from sturgeon cartilage, such as Coryphaena hippurus and Nibea japonica, require the removal of non-collagen with NaOH and fat with orthopedic methods [14,27]. Tissues obtained from oysters and Johnius belengerii were first crushed [9,23]. The main enzymes used in the enzymatic disintegration process include pepsin, alcalase, neutral protease, papain, and trypsin [9,28]. Peptides are purified by ultra-performance liquid chromatography separations [9,29], and filtration and ultra-centrifugation [27]. Amino acid composition is analyzed using an amino acid analyzer. For example, to obtain peptides from Johnius belengerii bone, the fish bone powder is digested with pepsin in a 5% acetic acid solution (pH 2.0) for 48 h, followed by filtration, centrifugation, and purification using fast protein liquid chromatography. The molecular mass and sequence of the purified peptide are determined with a quadrupole time-of-flight (TOF) mass spectrometer coupled with electrospray ionization [23].
In short, about 48% peptides derived from aquatic animals can promote osteoblast growth and differentiation, especially short peptides with high activity [30]. Compared to other protein sources, peptides derived from aquatic animals have a higher essential amino acid content and are easily digestible. Enzymatic hydrolysis is the main method for extracting these peptides. Before hydrolysis, non-collagen components and lipids must be removed. The peptides are then purified and identified using filtration, centrifugation, and HPLC-MS/MS for further study. Aquatic animals are rich in nutrients, and their peptides show strong potential to promote cell proliferation. This potential deserves more research.
Table 1.
Cell proliferation-promoting peptides derived from aquatic animals.
Table 1.
Cell proliferation-promoting peptides derived from aquatic animals.
| Sequence | Source | Cell/Animal Model | Amount Added | Action Pathway | Cell Performance | Animal Performance | References |
|---|---|---|---|---|---|---|---|
| YRGDVVPK | Oyster | Mouse embryo osteoblast precursor cell (MC3T3-E1) | 100 nM | MAPK signaling pathway | Cell proliferation and differentiation ↑ | Osteoporosis ↓ | [9] |
| TPERYY | Tilapia scale | MC3T3-E1 cell | 109 μg/mL | Wnt/β-catenin signaling pathway | Cell proliferation, differentiation, and mineralization ↑ | Bone health ↑ Osteoporosis ↓ | [7] |
| KSA | Johnius belengerii | MC3T1-E1 cell | — | MAPK signaling pathway | Cell proliferation and differentiation ↑ | Osteoporosis ↓ bone formation ↑ | [23] |
| YPRKDETGAERT | Mytilus edulis | MC3T3-E1 cell | Bone morphogenetic protein type 2 (BMP-2) signaling pathway | Cell proliferation and differentiation ↑ | Femoral ↑, osteoporosis ↓ | [31] | |
| SCIH (28 peptides) | Sea Cucumber Intestine | MC3T3-E1 cell | 25 μg/mL | Wnt/β-catenin signaling pathway | Cell proliferation and differentiation ↑ | Bone growth ↑ | [29] |
| RPQYPQYPS, LSFSPY | Sea cucumber | MC3T3-E1 cell | 100 μg/mL | — | Proliferation and mineralization ↑ | Osteoporosis ↓ | [32] |
| FDNEGKGKLPEEY, FWDGRDGEVDGFK VLQTDNDALGKAK IVLDSGDGVTH, MVAPEEHP | Pinctada martensii | MC3T3-E1 cell | 2 μg/mL | — | Cell proliferation and differentiation ↑ | Osteoporosis ↓ | [33] |
| WSMP | Oyster shells | MC3T3-E1 cell | 100 μg/mL | BMP-2 signaling pathway | Cell proliferation and differentiation ↑ | Osteoporosis ↓ | [34] |
| MNKKREAEFQ | Gadus morhua | MC3T3-E1 cell | 100 μg/mL | BMP/WNT signaling pathway | Cell proliferation and differentiation ↑ | Osteoporosis ↓ | [35] |
| — | Chanos chanos | Human osteosarcoma cell (MG-63) | 100 μg/mL | — | Cell proliferation and differentiation ↑ | Osteoporosis ↓ | [36] |
| — | Mytilus coruscus | Mouse Mononuclear Macrophage cell (RAW264.7) | 100 μg/mL | MAPK signaling pathway | Cell proliferation ↑, the phagocytosis of cells ↑ | Immunomodulation ↑ | |
| — | Nibea japonica | Mouse Embryonic Fibroblast cell (NIH-3T3) | 25 μg/mL | NF-κB signaling pathway | Cell proliferation and migration ↑ | Wound healing ↑ | [14] |
| — | Sipunculus nudus | HUVEC, Human immortalized epidermal cells (HaCaT), HSF cell | — | — | Cell proliferation ↑ | Wound healing ↑, scar formation ↓ | [28] |
| VTPY, VLLY | Sea cucumber | HSF cell and HUVEC cell | 1000 nmol/mL | ERK/AKT signaling pathway | Cell proliferation ↑ | Wound healing ↑ | [12] |
| NINECFSSPCEN OGICODEIDGYN CVCOPGFTGTHCE | Sea cucumber | Human melanoma cell | 10 nM | MAPK and AKT signaling pathway | Cell proliferation ↑ | Wound healing ↑ | [3] |
| QIGFIW, IGIGPSGAS | Bigbelly seahorse | Mouse myoblast cell (C2C12) | 100 μg/mL | P38MAPK/AKT signaling pathway | Cell proliferation and differentiation ↑ | Skeletal muscle differentiation and endurance ↑ | [37] |
| VGRTNSH | Oyster | Human normal breast cell (MCF-10A) | 50 μg/mL | PRL/AKT/STAT5 and Mammalian target of rapamycin (mTOR)/Ribosomal protein S6 kinase B1 (S6KB1) signaling pathway | Cell proliferation ↑ | Lactation ↓ | [38] |
| — | Coryphaena hippurus | bone marrow-derived macrophage cell (BMMS) | 50 ng/mL | MAPK signaling pathway | Cell proliferation and differentiation ↑ | Osteoporosis ↓ | [27] |
| — | Mozambique tilapia | Human dermal papilla cells (hDPC) | 62.5 ppm | Wnt/β-catenin signaling pathway | Cell proliferation ↑ | Hair growth in the back skin tissue ↑ | [22] |
| MGLAGPR, MGDVLNF, EAPLMHV, TEAPLMHV, TEAPLMHV | Octopus | Mouse mammary epithelial cell (HC11) | 25 μg/mL | — | Cell proliferation ↑ | The synthesis of β-casein ↑ | [39] |
↑: increase; ↓: decrease; —: reported but not fully confirmed.
2.2. Cell Proliferation-Promoting Peptides Derived from Plants
Some plant-derived peptides have been found to promote cell proliferation. These peptides primarily originate from dicotyledons, and approximately 90% contain 6 to 12 amino acid residues (Table 2). The longest peptide identified is the peptide SKWQHQQDSCRKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD from seeds [40], while the shortest is LRW from pea [8]. Hydrophobic amino acids in these peptides may help them interact with cell membranes and reduce inflammation [41]. Sequence analysis shows that most peptides contain polar uncharged amino acids, except for di- and tripeptides. Glycine and glutamine are the most common, while cystine and threonine are rare. Peptides with alkaline or hydrophobic amino acids at the N-terminal are linked to immune-regulating effects [42].
Peptides are prepared using various methods, including alkali extraction, acid precipitation, and ultra-sound-assisted acid or enzyme extraction. The main enzymes are pepsin, alcalase, neutral protease, papain, and trypsin [20,43]. The peptides in Porphyra haitanensis are extracted using a chemical method [44]. The peptides are purified and identified using reversed-phase high-performance liquid chromatography [21], gel permeation chromatography [45], and ultra-performance liquid chromatography with tandem mass spectrometry [20]. Most plant peptides promote immune cell proliferation and regulate immunity. The peptide from rice bran protein shows the strongest effect, significantly increasing HUVEC cell proliferation at 1 μM after 72 h. It also reduces wound area in a concentration-dependent manner below 10 μM. [46]. Mung bean hydrolysates have the weakest effect. They exhibit activity only at 200 mg/mL, but can still reduce the release of inflammatory factors and regulate inflammation in vitro [47].
In summary, the amino acid composition of the peptide has a great impact on its anti-inflammatory effect, especially the presence of hydrophobic amino acids. Enzymatic hydrolysis and ultra-sound-assisted extraction are the main methods for extracting peptides from plants. After extraction, the peptides are purified and identified using various chromatography techniques. It provides candidate materials for the development of trauma repair drugs.
Table 2.
Cell proliferation-promoting peptides derived from plants.
Table 2.
Cell proliferation-promoting peptides derived from plants.
| Sequence | Source | Cell/Animal Model | Amount Added | Action Pathway | Cell Performance | Animal Performance | References |
|---|---|---|---|---|---|---|---|
| IQDKEGIPPDQQR | Extruded Lupin | RAW 264.7 cell | 1 μg/mL | MARK signaling pathway | Cell proliferation ↑ | Inflammatory response ↓ | [20] |
| — | Mung bean | RAW264.7 cell | 200 mg/mL | — | Cell proliferation ↑, phagocytosis ↑ | Immunomodulation ↑ and anti-inflammation | [47] |
| YGPSSYGYG | Pseudostellaria heterophylla | RAW264.7 cell | 200 μg/mL | Toll-like receptors (TLR)/NF-κB/TNF-αsignaling pathway | Cell proliferation ↑, the endocytosis of macrophages ↑ | Immunomodulation ↑ | [21] |
| SSFSKGVQRAAF | Rice bran | HUVEC cell | 1 μM | — | Cell proliferation and migration ↑ | Wound healing ↑ | [46] |
| DIGGL | Ulva prolifera | HUVECs cell | 100 μM | — | Cell proliferation ↑ | Immunomodulation ↑ blood pressure ↓ | [43] |
| LRW | Pea | MC3T3-E1 cell | 50 μM | PI3K/AKT, AKT/Runx2 signal pathway | Cell proliferation, migration, differentiation, and mineralization ↑ | Osteoclast formation and the prevention of osteoporosis ↓ | [8] |
| DEDEQIPSHPPR | Soybean | MC3T3-E1 cell | 70 μM | MAPK signaling pathway | Cell proliferation, differentiation, and mineralization ↑ | Osteoporosis ↓ | [48] |
| — | Zein peptides | C2C12 cells | 200 μg/mL | Mechanistic Target of Rapamycin Complex 1/2 (mTORC1/mTORC2) signaling pathway | Cell proliferation and cell cycle progression ↑ | Sarcopenia ↓ | [49] |
| NQLDQMPR, PVNKPGRFE and the other 52 peptides | Soybean | Rat small intestine crypt epithelial cell (IEC-6) | 1 mg/mL | — | Cell proliferation ↑ | Intestinal inflammation ↓ | [45] |
| — | Porphyra haitanensis | IEC-6 cell | 100 μg/mL | — | Cell proliferation and migration ↑ | Intestinal epithelial wound healing ↑ | [44] |
| — | Cornus officinalis | Chicken Embryonic Fibroblasts (CEF) | 0.4 mg/mL | — | Cell proliferation ↑ | Free radicals ↓, anti-oxidation | [50] |
| SKWQHQQDSCRKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | Seed peptide | Male C57BL/6Jnarl mice, EL-4 T cell | — | — | Cell proliferation ↑, cytokines ↑ | Anti-inflammatory, antioxidant ↑ | [40] |
↑: increase; ↓: decrease; —: reported but not fully confirmed.
2.3. Cell Proliferation-Promoting Peptides Derived from Livestock Products
Peptides that promote cell proliferation have been identified from livestock products, mainly from milk proteins and collagen (Table 3). Peptides from bovine lactoferrin show the strongest activity [51]. Peptides from duck and chicken meat are 3–4 amino acids long [6,52], while the length of peptides that are derived from porcine bones and milk is between 8 and 10 [18,53]. The longest peptide is HHGDQGAPGAVGPAGPRGPAGPSGPAGKDGR from bovine bone collagen hydrolysates [54], and the shortest peptide is the peptide EF, from black-bone silky fowl [52]. These peptides usually contain hydrophobic and acidic amino acids, but cysteine and glutamine are rare. Their preparation methods are similar to those used for aquatic peptides. Raw materials are crushed and hydrolyzed using enzymes like trypsin, pepsin, papain, and bromelain [55]. After centrifugation and filtration, the peptides are purified using molecular exclusion chromatography [52] and reversed-phase high-performance liquid chromatography [56]. The purified peptides are identified with HPLC-MS/MS [51,52,55]. In short, most peptides from animal products are medium-sized and mainly extracted from collagen-rich bones. The raw materials are crushed and then hydrolyzed with enzymes. After centrifugation and filtration, peptides are purified using molecular exclusion chromatography and UPLC. Peptide composition is identified by HPLC-MS/MS, which helps discover more effective peptide sequences.
Table 3.
Cell proliferation-promoting peptides derived from livestock products.
Seafood-derived peptides mainly promote osteoblast proliferation and help relieve osteoporosis. Plant-derived peptides mainly stimulate immune cell proliferation, showing anti-inflammatory and immune-regulating effects. Cell proliferation is the basis of these functions. In the following section, we discuss the mechanisms by which peptides promote cell proliferation.
3. Cell Proliferation-Promoting Mechanism of Peptides
3.1. Signal Pathway
The proliferative function of peptides has been investigated in various cell types, including MC3T3-E1, NIH-3T3, RAW264.7, HaCaT, human colonic epithelial, lymphocytes, and fibroblasts. The signal pathways in MC3T3-E1, NIH-3T3, RAW264.7, and HaCaT cells have been extensively studied. Here, we provide a summary of these pathways (Figure 1).
Figure 1.
The main pathways for peptides promote cell proliferation.
3.1.1. MAPK Signaling Pathway
The MAPK signaling pathway is the most extensively explored among the studies of peptides that promote cell proliferation. This pathway plays a crucial role in mediating various physiological functions in the body. MAPK is a cytoplasmic protein kinase that activates transcription factors through a conserved cascade (MAPKKK-MAPKK-MAPKMAPK) when stimulated [59]. The MAPK signaling pathway has been identified as crucial for the regulation of pro-inflammatory mediators, cytokines, and the expression of inflammatory proteins [60]. It is known that MAPKs, including the p38 MAPK signaling pathway, c-Jun N-terminal kinase (JNK) signaling pathway, and the ERK signaling pathway, serve as important mediators in controlling bone formation [61]. The p38 and ERK1/2 MAPK signaling pathways enhance osteoblast differentiation and proliferation via phosphorylating Runx2, while the JNK signaling pathway exerts its function through other critical factors such as activator protein 1 (AP-1) and β-catenin [26]. Peptide KSA, derived from fish bone peptide, stimulates the phosphorylation of all MAPK members, including the p38 MAPK signaling pathway, ERK signaling pathway, and JNK signaling pathway. It promotes the proliferation and differentiation of osteoblasts [23].
The MAPK signaling pathway plays a role in promoting wound healing. Peptides QIGFIW and IGIGPSGAS have a potential effect of upregulating key myogenic regulatory proteins, including myogenic differentiation antigen (MyoD), myogenin (MyoG), and myosin heavy chain (MyHC) at concentrations of 100 μg/mL and 50 μg/mL, respectively, in the pot-bellied hippocampus. Additionally, P38 MAPK, the main MAPK signaling pathway, could activate MyoD gene expression [37].
3.1.2. Wnt/β-Catenin Signaling Pathway
The Wnt pathway is critical in regulating skeletal development and homeostasis [62]. Specifically, the Wnt/β-catenin signaling pathway is vital for controlling the proliferation and differentiation of osteoblasts [63]. Activation of this pathway involves binding Wnt protein to Frizzled receptors on the cell surface, which in turn bind to low-density lipoprotein receptor-related protein 5/6 (LRP5/6) receptors. The binding inhibits the activity of glycogen synthase kinase 3 beta (GSK-3β), preventing the phosphorylation of β-catenin and ensuring its stability [64]. Unphosphorylated β-catenin is transported into the nucleus, where it enhances the transcriptional activity of T cell factor/lymphoid enhancer factor family (TCF/LEF) and increases the expression of osteogenic genes [7]. Peptide GPAGPPGPIGNV, which is derived from yak bone collagen, has been found to stimulate the upregulation of β-catenin mRNA and its protein levels. It also activates transcriptional markers such as β-catenin, Wnt5a, and Frizzled-5, which play a significant role in the Wnt/β-catenin signaling pathway, thereby promoting the proliferation and differentiation of osteoblasts [56]. The peptide VSEE, extracted from desalted duck egg white, has been demonstrated to enhance osteoblast proliferation through the activation of the Wnt/β-catenin pathway [6].
3.1.3. NF-κB Signaling Pathway
NF-κB is essential for normal immune and cellular functions. In resting macrophages, NF-κB dimers are bound to the inhibitor IκB and remain inactive in the cytoplasm. Upon stimulation, IκB is phosphorylated, allowing NF-κB to enter the nucleus and activate gene transcription [65]. The NF-κB protein serves as a significant regulator in both innate and adaptive immune responses [66], accelerating cell proliferation, preventing apoptosis, promoting cell migration, invasion, and inducing angiogenesis and metastasis [67]. Furthermore, the activation of NF-κB swiftly and briefly responds to viral and bacterial infections, necrotic cell debris, oxidative stress, DNA damage, and pro-inflammatory cytokines [68]. The peptide YGPSSYGYG activates RAW264.7 cells by increasing NO secretion, enhancing pinocytosis, and raising ROS and TNF-α levels [21]. Earlier investigations have shown a strong correlation between wound healing and the NF-κB signaling pathway [14]. Nibea japonica collagen peptides promote the proliferation of fibroblasts through the NF-κB pathway, highlighting their potential role in enhancing wound healing. After treatment with different concentrations of Nibea japonica collagen peptides, the levels of NF-κB p65, IκB kinase α (IKKα), and IκB kinase β (IKKβ) in cells exhibited a notable dose-dependent increase. Additionally, protein levels of specific growth factors (such as epidermal growth factor (EGF), fibroblast growth factor (FGF), and vascular endothelial growth factor A (VEGF)) were elevated in NIH-3T3 cells [14].
3.1.4. PI3K/AKT Signaling Pathway
The PI3K/AKT signaling pathway is essential for regulating bone metabolism in osteoblasts and osteoclasts. It is closely linked to the MAPK, MEK/ERK, and NF-κB pathways [69]. It plays a significant role in maintaining human bone homeostasis. However, when the PI3K/AKT pathway is activated, it can lead to an increase in the expression of the genes associated with inflammation through various downstream targets, with NF-κB being identified as a principal regulator [70]. Upon stimulation by receptors, particularly cytokine receptors, the membrane protein PI3K can induce AKT phosphorylation directly or indirectly, leading to the subsequent activation of NF-κB [71]. The classic PI3K signaling pathway consists primarily of components such as the PI3K family, phosphatidylinositol-3,4,5-trisphosphate (PIP3) gene, phosphatase and tensin homolog (PTEN) gene, and AKT gene. PIP3, as an important second messenger in this pathway, plays a role in activating the pathway [72]. The PTEN gene triggers the dephosphorylation of PIP3, which is produced by PI3K signaling. By reducing the level of activated AKT, it prevents the downstream signaling of AKT, thereby inhibiting the activation of the PI3K signaling pathway [73]. PTEN serves as an important antagonistic gene in this pathway. AKT binds to PIP3, gets activated, and regulates cell function by phosphorylating various downstream kinases [74]. Collagen peptides sourced from porcine bone have been shown to enhance proliferation and prevent apoptosis in osteoblasts through the activation of the PI3K/AKT pathway [55]. The peptide NINECFSSPCENOGICODEIDGYNCVCOPGFTGTHCE extracted from sea cucumber can induce protein docking through GRB2-associated binder 1 (GAB1) to activate PI3K, which converts phosphatidylinositol 4,5-bisphosphate (PIP2) to PIP3, allowing AKT phosphorylation before activating pyruvate dehydrogenase kinase 1 (PDK1). An increase in AKT gene expression may lead to the phosphorylation of NF-κB, which is crucial for cell survival. Additionally, AKT can phosphorylate other substrates, such as glycogen synthase kinase-3 (GSK-3), contributing to the inhibition of cyclin D production when its levels are sufficiently elevated [3].
3.1.5. BMP Signaling Pathway
The bone morphogenetic protein (BMP) signaling pathway is involved in inducing the differentiation of mesenchymal stem cells (MSCs) in the bone marrow into osteocytes, as well as promoting the proliferation of osteoblasts and chondrocytes. BMPs are a well-explored category of functional proteins that can be utilized to delay or treat osteoporosis [75]. These proteins are crucial for maintaining bone density and can stimulate the differentiation of bone marrow-derived mesenchymal stem cells (BMSCs) into osteoblasts, thus increasing the number of mature osteoblasts and enhancing their differentiation capabilities [76]. BMP exerts its effect on osteoblasts by activating BMP membrane receptors and their signaling pathways [77]. Antioxidant peptides derived from blue mussels, specifically PIISVYWK and FSVVPSPK, are known to enhance the proliferation of osteoblasts as well as the expression of bone morphogenetic proteins-2/4 (BMP-2/4). These peptides lead to the upregulation of mothers against decapentaplegic homolog 1/5 (Smad1/5) phosphorylation and various transcription factors such as Runx2 and osterix [33]. The levels of bone morphogenetic protein 2/4 (BMP-2/4) expression in osteoblasts significantly increased when treated with the peptide YPRKDETGAERT derived from Mytilus edulis. This peptide also upregulates type I collagen, p-Smad1/5, and transcription factors, including osterix and Runx2, in mesenchymal bone marrow-derived MSCs, promoting osteoblast proliferation and alleviating osteoporosis [31].
We have identified and summarized five signaling pathways through which peptides facilitate cell proliferation. These pathways are crucial in promoting the growth and differentiation of osteoblasts and can also modulate downstream signaling pathways to alleviate osteoporosis. The MAPK signaling pathway and NF-κB signaling pathway contribute to wound healing by promoting fibroblast proliferation and the expression of related proteins. The NF-κB signaling pathway also plays a significant role in reducing inflammation and enhancing immunity. Peptides stimulate the proliferation of macrophages and lymphocytes through the NF-κB signaling pathway, thereby contributing to reducing inflammation and improving immunity. It is important to note that the mechanism by which peptides promote cell proliferation is not limited to signaling pathways. Next, we will explore the energy supply and proliferation cycle of cell proliferation, as well as the role of growth factors in promoting cell proliferation.
3.2. Regulation of Energy Metabolism
Cellular metabolism is responsible for providing energy for various life processes, including cell proliferation and movement during wound healing. It is crucial to maintain an adequate supply of adenosine triphosphate (ATP) for cellular restructuring, which relies on fluctuations in cellular energy demands [12]. Previous studies have demonstrated that the ATP/adenosine diphosphate (ADP) ratio serves as a reliable measure of intracellular energy consumption [78].
The oxygen consumption rate (OCR) was utilized to assess the impact of components on the mitochondrial respiratory chain through measures like ATP production, proton leak, maximal respiration, spare respiration, and basal respiration [12]. Cell proliferation-promoting peptide treatments may increase the mRNA expression levels of cyclooxygenase-2 (COX2), nuclear respiratory factor 1 (NRF-1), and mitochondrial transcription factor A (TFAM) to promote mitochondrial biogenesis [79].
3.3. Cell Cycle Regulation
Cell cycle regulation involves three dynamic biochemical processes known as G0/G1, S, and G2/M phases. The G0/G1 phases represent quiescent and early DNA synthesis stages, while the G2/M phases signify late DNA synthesis and mitosis stages. The DNA synthesis phase, S phase, represents active cell proliferation [80]. Studies have indicated that various signaling pathways and molecules are involved in regulating cell proliferation through mechanisms related to the cell cycle [81]. Sea cucumber-derived tetrapeptides VTPY and VLLY significantly increased the percentage of the S phase in the cell cycle of HUVEC via the upregulation of ERK and AKT signaling pathways. The VTPY and VLLY treatments effectively increased Cyclin D1 protein levels [12]. VGRTNSH derived from Crassostrea hongkongensis elevated the gene expression levels of the cell cycle protein CCND1. Treatment with peptide VGRTNSH induced significant progression from the G1 phase to the S phase in MCF-10A cells [38].
3.4. Regulation of Cytokines and Growth Factors
The principal cytokines and growth factors, such as insulin-like growth factor-1 (IGF-1); transforming growth factor-α (TGF-α); and TGF-β, EGF, and fibroblast growth factor (FGF), play critical roles in skeletal development [9] and wound healing [82]. EGF has been shown to significantly enhance the migration and proliferation of both fibroblasts [83] and osteoblasts [7]. FGF promotes angiogenesis, as well as cell migration and proliferation, thereby facilitating wound healing [84]. TGF-β can induce the secretion of extracellular matrix proteins and promote proliferation, migration, and angiogenesis [85]. Pilose antler peptides promote osteoblast proliferation and differentiation, accelerating bone formation. In MC3T3-E1 cells, EGF, heme oxygenase-1 (HO-1), epidermal growth factor receptor (EGFR), and nuclear factor erythroid 2-related factor 2 (Nrf-2) expression were obviously increased after the pilose antler peptide treatment [86]. Marine collagen peptides (MCPs) from the skin of Nibea japonica have also been found to promote the migration and proliferation of NIH-3T3 cells through the NF-κB signaling pathway. MCPs further increased the protein levels of specific growth factors, including FGF, TGF-β, VEGF, and EGF in NIH-3T3 cells [14].
Currently, peptides have been found to promote cell proliferation through the above five signaling pathways, which are now recognized as clear pathways that promote cell proliferation. Mitochondrial respiration provides enough energy for cell proliferation and differentiation [12]. Alteration of cell-cycle progression and increased expression of cyclins offer favorable conditions for cell proliferation [51]. Peptides involved in wound healing possess anti-inflammatory properties and scavenge free radicals and oxidative enzymes. Furthermore, peptides stimulate the secretion of various cytokines and growth factors, indirectly promoting cell proliferation [84]. However, the mechanism remains unclear. Whether other potential pathways affect cell proliferation remains to be further studied.
4. Safety and Regulatory Framework for Promoting Cell Proliferation Peptides
Despite growing health awareness and a booming nutraceutical market, the peptide industry still faces major challenges. For peptides that promote cell proliferation, animal studies are needed to assess safety before clinical trials. These studies help decide whether human testing is appropriate and guide clinical trial design [87]. However, it is crucial to emphasize that the primary evidence of safety must ultimately come from human clinical trials [88]. This is due to the limitations of animal models in accurately representing factors such as drug pharmacokinetics and pharmacology. When planning animal studies, factors like administration route, dose, duration, and species must be carefully chosen [89]. In addition, the effects of long-term peptide intake on different body systems require more research. It is also important to study how processing and storage affect peptide activity and availability during product development [90]. Due to the complex enzymes of the human digestive system, these peptides are likely to be degraded in the digestive tract [91]. Therefore, further clinical research is imperative for gaining a deeper understanding of their safety concerns, interactions with food matrices, bioavailability, and gastrointestinal stability before contemplating their utilization as functional foods or potential pharmaceuticals for prevention and treatment.
Regulatory concerns: the utilization of peptides that stimulate cell growth in food or other applications may require regulatory approval, which can be a time-consuming and expensive procedure [92]. With the growing popularity of health foods, misleading or false claims have become increasingly prevalent in the media. Therefore, establishing a clear regulatory framework for foods with bioactive peptides is essential to protect consumers from potential risks [93]. Different countries have varying regulatory systems. In China, all health food products must be registered and pre-approved by the CFDA. CFDA-authorized labs conduct tests on safety, function, stability, efficacy, and hygiene. The Health Food Expert Committee grants approval based on scientific data [88]. Approved products can be sold with the Blue Hat logo [94].
It is a long process, from discovering peptides that promote cell proliferation to their application in humans. Currently, peptides that promote cell proliferation have only been tested in vitro; further evaluations using animal models and clinical trials are necessary. The impact of food peptides on drug levels, allergenicity, processing, storage, and digestion requires further investigation [90]. Due to the limitations of animal models, clinical trials in humans are the only way to obtain reliable evidence. If food peptides are transformed into nutraceuticals or clinical medicinal products, their commercialization must adhere to market regulations and relevant laws. Registration and pre-approval by the CFDA are necessary before marketing and selling these products [88].
5. Discussion
Most peptides that promote cell proliferation from food sources are short or medium in size. Short peptides often show higher biological activity. They have various effects, such as relieving osteoporosis, promoting wound healing, and providing anti-inflammatory and antioxidant benefits. Cell proliferation is the foundation of these effects. Most peptides are extracted from aquatic animals, and many of them exhibit anti-osteoporotic activity. This is because osteoblast proliferation and differentiation help improve bone health and relieve osteoporosis. Notably, most peptides are extracted from aquatic animals. The peptides extracted from aquatic animals exhibit anti-osteoporotic effects. The proliferation and differentiation of osteoblasts play an important role in alleviating osteoporosis and promoting bone growth.
It should be noted that the unavailability of specific sequence information for certain source peptides, due to their exact sequences, has not been thoroughly characterized in the existing studies. While this limitation prevents a detailed structure-activity analysis, the observed results can still be interpreted as a composite effect of multiple peptide factors. Future studies should prioritize the sequencing and precise characterization of such peptides to enable more mechanistic insights. Until then, the conclusions drawn in their reports should be contextualized within these acknowledged constraints.
The functional activity of cell proliferation-promoting peptides depends not only on their sequence but also on factors such as digestion, processing, storage, and interactions with other components in the food matrix. Processing and storage methods contribute to product variability, which may alter the bioactivity of peptides. Moreover, other food substances may influence peptide function, a question that requires further investigation [90]. Once ingested, peptides undergo enzymatic digestion in the gastrointestinal tract, breaking down into smaller fragments. These smaller peptides may exhibit enhanced bioavailability, but their biological functions could also be weakened or lost [2]. Therefore, it is necessary to study how digestion affects peptide sequences and to identify bioactive peptides in diverse food sources [93]. Despite these challenges, peptides that promote cell proliferation show promising potential. Many peptide fragments exhibit unique functions not found in native proteins and can supplement essential amino acids while supporting tissue growth, repair, and immune regulation. Thus, continued efforts in functional food research and product development are important for transforming these peptides into beneficial health products [95].
Given the side effects of synthetic drugs, research is shifting toward natural sources. Insects are emerging as a promising protein source, and peptides derived from insect proteins show anti-osteoporotic, anti-inflammatory, and antihypertensive activities. It is therefore expected that insect-derived peptides may also promote cell proliferation. However, this field is still relatively new and underexplored [96]. With the expansion of the insect processing industry, large quantities of by-products (e.g., heads, skins, guts, and bones) are generated. Though often considered inedible, these residues contain up to 60% protein by dry weight and represent a valuable source of bioactive peptides [97]. Thus, exploring peptides from food processing by-products—especially those with cell proliferation-promoting potential—is recommended [96]. Although biosynthesis is less applied compared to natural extraction, with the identification of extracted mixed polypeptide components and the understanding of the functional mechanisms of single-structured polypeptides, the biosynthesis of polypeptides is also a promising method.
Despite challenges in developing functional foods, advances in technology and scientific research are crucial to unlocking this potential. Peptide synthesis methods and dosage may also influence biological activity and should be carefully evaluated during product development. At present, in the studies of food-derived peptides, the focus is mainly on obtaining high-concentration peptides after processing and extraction, while few studies have considered the changes in natural peptide components contained in plant and animal tissues during the extraction process, as well as whether natural peptides still play a role in biological processes such as cell proliferation, antioxidation, and immune response after processing has not received widespread attention. Meanwhile, whether the functions of these natural peptides are directly related to the different functions of peptides from various plant and animal sources requires further in-depth exploration.
At the same time, it is worth noting that not all natural products or substances from food sources are completely harmless to health. Pharmacokinetics would significantly affect the activity and action of peptides. In subsequent research, we also need to conduct comprehensive considerations, including pharmacokinetics and the potential side effects of high-concentration peptides. Additionally, regarding the functions and mechanisms of food-derived peptides and polypeptides, recent research primarily focuses on cells and model animals, while clinical trials on primates and humans are relatively few. Therefore, the key aspects in future studies are that the subsequent safety assessment should focus on the food-derived polypeptides in both live animal potential side effects and human safety assessment clinical research to support practical applications.
Over the past few decades, an increasing effort has been made to identify biopeptides that can promote cell proliferation. However, not all biological peptides can have a promoting effect. Some polypeptides have not shown significant effects in the research subjects, and these studies may not have been widely reported. In addition, the potential pro-tumorigenic risks of promoting cell proliferation should also be considered, which is critical for researchers, producers, and consumers in the field. This work summarizes the cell proliferation-promoting peptides obtained from aquatic animals, livestock products, and plants. It reviews several signaling pathways and the biological processes that peptides may affect in promoting cell proliferation, providing a reference for subsequent research on peptides that promote cell proliferation (Figure 1). Meanwhile, the future development direction of bioactive peptide resarch is speculated. Studies on the amino acid composition and structure of cell proliferation-promoting peptides, along with their function, are still in their early stages. Furthermore, the production of peptides that promote cell proliferation is a significant concern. Currently, the production of these peptides is still at the laboratory scale. The commercialization of food peptides necessitates strict compliance with market regulations and laws. Further advancements are necessary to scale up production to an industrial level.
Author Contributions
Conceptualization, Y.Y. and Y.L.; writing—original draft preparation, Y.Y. and Y.L.; writing—review and editing, X.F.; visualization, X.Z. and L.Z.; supervision, X.F. All authors have read and agreed to the published version of the manuscript.
Funding
This research was funded by the National Natural Science Foundation of China (No. 32101942), Jilin Province Science and Technology Development Plan project (20240404037ZP), National Undergraduate Training Program on Innovation and Entrepreneurship (No. X202510183253) and the Jilin University Lixin Excellent Young Teacher Training Program.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
No new data were created or analyzed in this study.
Conflicts of Interest
The authors declare no conflicts of interest.
Abbreviations
The following abbreviations are used in this manuscript:
| ECM | Extracellular matrix |
| HUVEC | Human umbilical vein endothelial cells |
| TOF | Time-of-flight |
| HPLC-MS/MS | High-performance liquid chromatography-tandem mass spectrometry |
| MSCs | Mesenchymal stem cells |
| BMSCs | Bone marrow-derived mesenchymal stem cells |
| OCR | Oxygen consumption rate |
| COX2 | Cyclooxygenase-2 |
| NRF-1 | Nuclear respiratory factor 1 |
| TFAM | Mitochondrial transcription factor A |
| AKT | Protein kinases (ERK) and protein kinase B |
| TGF-α | Transforming growth factor-α |
| MAPK | Mitogen-activated protein kinase |
| NF-κB | Nuclear factor κ-B |
| IKKα | IκB kinase α |
| FGF | Fibroblast growth factor |
| EGF | Epidermal growth factor |
| VEGF | Vascular endothelial growth factor A |
| MCPs | Marine collagen peptides |
| CFDA | China Food and Drug Administration |
| IGF-1R | Insulin-like growth factor 1 receptor |
| ERK1/2 | Extracellular regulated protein kinases 1/2 |
| SMAD | Mothers against decapentaplegic |
| PI3K | Phosphoinositide 3-kinase |
| LRP1 | LDL receptor-related protein 1 |
| PGE2 | Prostaglandin E2 |
| IL-6 | Interleukin-6 |
| BMP-2 | Bone morphogenetic protein type 2 |
| S6KB1 | Ribosomal protein S6 kinase B1 |
| mTOR | Mammalian target of rapamycin |
| TLR | Toll-like receptors |
| RAW264.7 | Mouse mononuclear macrophage cells |
| MC3T3-E1 | Mouse embryo osteoblast precursor cells |
| mTORC1/mTORC2 | Mechanistic target of rapamycin complex 1/2 |
| HaCaT | Human immortalized epidermal cells |
| JNK | c-Jun N-terminal kinase |
| ERK | Extracellular-regulated protein kinases |
| AP-1 | Activator protein 1 |
| MyoD | Myogenic differentiation antigen |
| MyoG | Myogenin |
| MyHC | Myosin heavy chain |
| GSK3β | Glycogen synthase kinase 3 beta |
| LRP5/6 | Low-density lipoprotein receptor-related proteins 5 and 6 |
| UPLC | Ultra-Performance Liquid Chromatography |
| TCF/LEF | T cell factor/lymphoid enhancer factor family |
| LRP3 | Low-density lipoprotein receptor-related protein 3 |
| IκB | Inhibitor of NF-κB |
| ROS | Reactive oxygen species |
| MEK | Mitogen-activated extracellular signal-regulated kinase |
| PIP3 | Phosphatidylinositol-3,4,5-trisphosphate |
| PTEN | Phosphatase and tensin homolog |
| GAB1 | GRB2-associated binder 1 |
| PDK1 | Pyruvate dehydrogenase kinase 1 |
| GSK-3 | Glycogen synthase kinase-3 |
| BMP | Bone morphogenetic protein |
| ATP | Adenosine triphosphate |
| MCF-10A | Human normal breast cells |
| HO-1 | Heme oxygenase-1 |
| EGFR | Epidermal growth factor receptor |
| Nrf-2 | Nuclear factor erythroid 2-related factor 2 |
| NIH-3T3 | Mouse embryonic fibroblast cells |
| TNF-α | Tumor necrosis factor alpha |
| TGF-β | Transforming growth factor-β |
| MG-63 | Human osteosarcoma cell |
| HSF | human skin fibroblast |
| BMMS | Bone marrow-derived macrophage cell |
| hDPC | Human dermal papilla cells |
| IEC-6 | Intestine crypt epithelial cell |
| CEF | Chicken embryonic fibroblast cell |
| GSK-3β | Glycogen synthase kinase 3 beta |
| IKKβ | IκB kinase β |
| PIP2 | Phosphatidylinositol 4,5-bisphosphate |
| BMP-2/4 | Bone morphogenetic proteins-2/4 |
| SMAD1/5 | Mothers against decapentaplegic homolog 1/5 |
| BMP-2/4 | Bone morphogenetic protein 2/4 |
| ADP | Adenosine diphosphate |
| IGF-1 | Insulin-like growth factor-1 |
References
- Li, M.; Dong, L.; Du, H.; Bao, Z.; Lin, S. Potential mechanisms underlying the protective effects of Tricholoma matsutake singer peptides against LPS-induced inflammation in RAW264.7 macrophages. Food Chem. 2021, 353, 129452. [Google Scholar] [CrossRef]
- Mirzapour-Kouhdasht, A.; Garcia-Vaquero, M. Cardioprotective Peptides from Milk Processing and Dairy Products: From Bioactivity to Final Products including Commercialization and Legislation. Foods 2022, 11, 1270. [Google Scholar] [CrossRef]
- Pilus, N.S.M.; Muhamad, A.; Shahidan, M.A.; Yusof, N.Y.M. Potential of Epidermal Growth Factor-like Peptide from the Sea Cucumber Stichopus horrens to Increase the Growth of Human Cells: In Silico Molecular Docking Approach. Mar. Drugs 2022, 20, 596. [Google Scholar] [CrossRef] [PubMed]
- Gao, Y.G.; Chen, N.; Fu, Z.D.; Zhang, Q. Progress of Wnt Signaling Pathway in Osteoporosis. Biomolecules 2023, 13, 483. [Google Scholar] [CrossRef] [PubMed]
- Xia, A.; Jiang, Y.; Lee, Y.-K.; Liang, D.; Yang, B.; Liu, X.; Zhao, J.; Zhang, H.; Chen, W. Identification and validation of fermented milk-derived osteogenic peptides via molecular docking and osteoblastic cell model. Food Biosci. 2024, 58, 103698. [Google Scholar] [CrossRef]
- Guo, D.; Liu, W.; Zhang, X.; Zhao, M.; Zhu, B.; Hou, T.; He, H. Duck Egg White-Derived Peptide VSEE (Val-Ser-Glu-Glu) Regulates Bone and Lipid Metabolisms by Wnt/beta-Catenin Signaling Pathway and Intestinal Microbiota. Mol. Nutr. Food Res. 2019, 63, e1900525. [Google Scholar] [CrossRef]
- Huang, W.; Yu, K.; Kang, M.; Wang, Q.; Liao, W.; Liang, P.; Liu, G.; Cao, Y.; Miao, J. Identification and functional analysis of three novel osteogenic peptides isolated from tilapia scale collagen hydrolysate. Food Res. Int. 2022, 162, 111993. [Google Scholar] [CrossRef] [PubMed]
- Arora, H.; Shang, N.; Bhullar, K.S.; Wu, J. Pea protein-derived tripeptide LRW shows osteoblastic activity on MC3T3-E1 cells via the activation of the AKT/Runx2 pathway. Food Funct. 2020, 11, 7197–7207. [Google Scholar] [CrossRef]
- Chen, H.; Xu, Z.; Fan, F.; Shi, P.; Tu, M.; Wang, Z.; Du, M. Identification and mechanism evaluation of a novel osteogenesis promoting peptide from Tubulin Alpha-1C chain in Crassostrea gigas. Food Chem. 2019, 272, 751–757. [Google Scholar] [CrossRef]
- Kaplani, K.; Koutsi, S.; Armenis, V.; Skondra, F.G.; Karantzelis, N.; Tsaniras, S.C.; Taraviras, S. Wound healing related agents: Ongoing research and perspectives. Adv. Drug Deliv. Rev. 2018, 129, 242–253. [Google Scholar] [CrossRef]
- Wang, Z.P.; Wang, Y.H.; Bradbury, N.; Bravo, C.G.; Schnabl, B.; Di Nardo, A. Skin wound closure delay in metabolic syndrome correlates with SCF deficiency in keratinocytes. Sci. Rep. 2020, 10, 21732. [Google Scholar] [CrossRef] [PubMed]
- Zheng, Z.; Li, M.; Jiang, P.; Sun, N.; Lin, S. Peptides derived from sea cucumber accelerate cells proliferation and migration for wound healing by promoting energy metabolism and upregulating the ERK/AKT pathway. Eur. J. Pharmacol. 2022, 921, 174885. [Google Scholar] [CrossRef]
- Singer, A.J.; Clark, R.A.F. Cutaneous wound healing. N. Engl. J. Med. 1999, 341, 738–746. [Google Scholar] [CrossRef]
- Yang, F.; Jin, S.; Tang, Y. Marine Collagen Peptides Promote Cell Proliferation of NIH-3T3 Fibroblasts via NF-kappaB Signaling Pathway. Molecules 2019, 24, 4201. [Google Scholar] [CrossRef] [PubMed]
- Li, W.; Ye, S.; Zhang, Z.; Tang, J.; Jin, H.; Huang, F.; Yang, Z.; Tang, Y.; Chen, Y.; Ding, G.; et al. Purification and Characterization of a Novel Pentadecapeptide from Protein Hydrolysates of Cyclina sinensis and Its Immunomodulatory Effects on RAW264. 7 Cells. Mar. Drugs 2019, 17, 30. [Google Scholar] [CrossRef]
- Jia, L.; Wang, L.; Liu, C.; Liang, Y.; Lin, Q. Bioactive peptides from foods: Production, function, and application. Food Funct. 2021, 12, 7108–7125. [Google Scholar] [CrossRef] [PubMed]
- Yuan, Z.; Yang, M.L.; Zhu, D.Y.; Wu, D.; Cheng, S.Z.; Wu, C.; El-Seedi, H.R.; Du, M. Immunomodulatory effect of ethanol-soluble polypeptides from Atlantic cod (Gadus morhua). Food Sci. Hum. Wellness 2023, 12, 1192–1203. [Google Scholar] [CrossRef]
- Soriano-Romani, L.; Nieto, J.A.; Garcia-Benlloch, S. Immunomodulatory role of edible bone collagen peptides on macrophage and lymphocyte cell cultures. Food Agric. Immunol. 2022, 33, 546–562. [Google Scholar] [CrossRef]
- He, K.; Zeng, Y.; Tian, H.; Zhang, Z.; Zhang, H.; Huang, F.; Yu, F. Macrophage immunomodulatory effects of low molecular weight peptides from Mytilus coruscus via NF-κB/MAPK signaling pathways. J. Funct. Foods 2021, 83, 104562. [Google Scholar] [CrossRef]
- Gao, Y.; Zhang, X.; Ren, G.; Wu, C.; Qin, P.; Yao, Y. Peptides from Extruded Lupin (Lupinus albus L.) Regulate Inflammatory Activity via the p38 MAPK Signal Transduction Pathway in RAW 264.7 Cells. J. Agric. Food Chem. 2020, 68, 11702–11709. [Google Scholar] [CrossRef]
- Yang, Q.; Cai, X.; Huang, M.; Chen, X.; Tian, Y.; Chen, G.; Wang, M.; Wang, S.; Xiao, J. Isolation, Identification, and Immunomodulatory Effect of a Peptide from Pseudostellaria heterophylla Protein Hydrolysate. J. Agric. Food Chem. 2020, 68, 12259–12270. [Google Scholar] [CrossRef]
- Hwang, S.B.; Park, H.J.; Lee, B.H. Hair-Growth-Promoting Effects of the Fish Collagen Peptide in Human Dermal Papilla Cells and C57BL/6 Mice Modulating Wnt/beta-Catenin and BMP Signaling Pathways. Int. J. Mol. Sci. 2022, 23, 11904. [Google Scholar] [CrossRef] [PubMed]
- Heo, S.Y.; Ko, S.C.; Nam, S.Y.; Oh, J.; Kim, Y.M.; Kim, J.I.; Kim, N.; Yi, M.; Jung, W.K. Fish bone peptide promotes osteogenic differentiation of MC3T3-E1 pre-osteoblasts through upregulation of MAPKs and Smad pathways activated BMP-2 receptor. Cell Biochem. Funct. 2018, 36, 137–146. [Google Scholar] [CrossRef]
- Yue, H.; Tian, Y.; Feng, X.; Bo, Y.; Leng, Z.; Dong, P.; Xue, C.; Wang, J. Novel peptides from sea cucumber intestinal hydrolysates promote longitudinal bone growth in adolescent mice through accelerating cell cycle progress by regulating glutamine metabolism. Food Funct. 2022, 13, 7730–7739. [Google Scholar] [CrossRef]
- Tian, M.; Han, Y.-b.; Yang, G.-y.; Li, J.-l.; Shi, C.-s.; Tian, D. The role of lactoferrin in bone remodeling: Evaluation of its potential in targeted delivery and treatment of metabolic bone diseases and orthopedic conditions. Front. Endocrinol. 2023, 14, 1218148. [Google Scholar] [CrossRef]
- Han, L.; Mao, X.; Wang, K.; Li, Y.; Zhao, M.; Wang, J.; Xue, C. Phosphorylated peptides from Antarctic krill (Euphausia superba) ameliorated osteoporosis by activation of osteogenesis-related MAPKs and PI3K/AKT/GSK-3β pathways in dexamethasone-treated mice. J. Funct. Foods 2018, 47, 447–456. [Google Scholar] [CrossRef]
- Elango, J.; Robinson, J.; Zhang, J.; Bao, B.; Ma, N.; de Val, J.; Wu, W. Collagen Peptide Upregulates Osteoblastogenesis from Bone Marrow Mesenchymal Stem Cells through MAPK- Runx2. Cells 2019, 8, 446. [Google Scholar] [CrossRef] [PubMed]
- Lin, H.; Zheng, Z.; Yuan, J.; Zhang, C.; Cao, W.; Qin, X. Collagen Peptides Derived from Sipunculus nudus Accelerate Wound Healing. Molecules 2021, 26, 1385. [Google Scholar] [CrossRef]
- Yue, H.; Tian, Y.; Feng, X.; Bo, Y.; Xue, C.; Dong, P.; Wang, J. Novel Peptides Derived from Sea Cucumber Intestine Promotes Osteogenesis by Upregulating Integrin-Mediated Transdifferentiation of Growth Plate Chondrocytes to Osteoblasts. J. Agric. Food Chem. 2022, 70, 13212–13222. [Google Scholar] [CrossRef] [PubMed]
- Wang, J.; Zhang, B.; Lu, W.; Liu, J.; Zhang, W.; Wang, Y.; Ma, M.; Cao, X.; Guo, Y. Cell Proliferation Stimulation Ability and Osteogenic Activity of Low Molecular Weight Peptides Derived from Bovine Gelatin Hydrolysates. J. Agric. Food Chem. 2020, 68, 7630–7640. [Google Scholar] [CrossRef]
- Xu, Z.; Fan, F.; Chen, H.; Shi, P.; Zhu, D.; Yang, M.; Wang, Z.; Ei-Seedi, H.R.; Du, M. Absorption and transport of a Mytilus edulis-derived peptide with the function of preventing osteoporosis. Food Funct. 2021, 12, 2102–2111. [Google Scholar] [CrossRef] [PubMed]
- Wang, M.; Yue, H.; Bo, Y.Y.; Yin, H.W.; Tian, Y.Y.; Zhao, Z.F.; Xue, C.H.; Zhang, T.T.; Wang, Y.M. Purification and identification of novel osteogenic peptides from sea cucumber intestine hydrolysates and their pro-osteogenesis effects on MC3T3-E1 cells. FOOD Biosci. 2024, 61, 104390. [Google Scholar] [CrossRef]
- Tian, Y.; Jiang, P.; Liu, X.; Wei, L.; Bai, Y.; Liu, X.; Li, S. Production and identification of peptides with activity promoting osteoblast proliferation from meat dregs of Pinctada martensii. J. Food Biochem. 2021, 45, e13890. [Google Scholar] [CrossRef] [PubMed]
- Feng, X.; Jiang, S.; Zhang, F.; Wang, R.; Zhao, Y.; Zeng, M. Shell water-soluble matrix protein from oyster shells promoted proliferation, differentiation and mineralization of osteoblasts in vitro and vivo. Int. J. Biol. Macromol. 2022, 201, 288–297. [Google Scholar] [CrossRef]
- Yang, M.; Cheng, S.; Ma, W.; Wu, D.; El-Seedi, H.R.; Wang, Z.; Du, M. Myosin heavy chain-derived peptide of Gadus morhua promotes proliferation and differentiation in osteoblasts and bone formation and maintains bone homeostasis in ovariectomized mice. Food Funct. 2023, 14, 5151–5166. [Google Scholar] [CrossRef]
- Chuu, J.J.; Lu, J.W.; Chang, H.J.; Chu, Y.H.; Peng, Y.J.; Ho, Y.J.; Shen, P.H.; Chen, Y.S.; Chen, C.H.; Liu, Y.C.; et al. Attenuative effects of collagen peptide from milkfish (Chanos chanos) scales on ovariectomy-induced osteoporosis. FOOD Sci. Nutr. 2024, 12, 116–130. [Google Scholar] [CrossRef]
- Muthuramalingam, K.; Kim, S.-Y.; Kim, Y.; Kim, H.-S.; Jeon, Y.-J.; Cho, M. Bigbelly seahorse (Hippocampus abdominalis)-derived peptides enhance skeletal muscle differentiation and endurance performance via activated P38MAPK/AKT signalling pathway: An in vitro and in vivo analysis. J. Funct. Foods 2019, 52, 147–155. [Google Scholar] [CrossRef]
- Chen, S.; Qin, X.; Zhang, C.; Cao, W.; Zheng, H.; Lin, H. Lactation Activity and Mechanism of Milk-Protein Synthesis by Peptides from Oyster Hydrolysates. Nutrients 2022, 14, 1786. [Google Scholar] [CrossRef]
- Cai, B.; Wan, P.; Chen, H.; Chen, X.; Sun, H.; Pan, J. Identification of octopus peptide and its promotion of beta-casein synthesis in a mouse mammary epithelial cell line. J. Food Biochem. 2020, 44, e13467. [Google Scholar] [CrossRef] [PubMed]
- Hsieh, C.C.; Wang, Y.F.; Lin, P.Y.; Peng, S.H.; Chou, M.J. Seed peptide lunasin ameliorates obesity-induced inflammation and regulates immune responses in C57BL/6J mice fed high-fat diet. Food Chem. Toxicol. 2021, 147, 111908. [Google Scholar] [CrossRef]
- Guha, S.; Majumder, K. Structural-features of food-derived bioactive peptides with anti-inflammatory activity: A brief review. J. Food Biochem. 2019, 43, e12531. [Google Scholar] [CrossRef]
- Rivera-Jimenez, J.; Berraquero-Garcia, C.; Perez-Galvez, R.; Garcia-Moreno, P.J.; Espejo-Carpio, F.J.; Guadix, A.; Guadix, E.M. Peptides and protein hydrolysates exhibiting anti-inflammatory activity: Sources, structural features and modulation mechanisms. Food Funct. 2022, 13, 12510–12540. [Google Scholar] [CrossRef]
- Li, Z.; He, Y.; He, H.; Zhou, W.; Li, M.; Lu, A.; Che, T.; Shen, S. Purification identification and function analysis of ACE inhibitory peptide from Ulva prolifera protein. Food Chem. 2023, 401, 134127. [Google Scholar] [CrossRef]
- Qiu, H.M.; Veeraperumal, S.; Lv, J.H.; Wu, T.C.; Zhang, Z.P.; Zeng, Q.K.; Liu, Y.; Chen, X.Q.; Aweya, J.J.; Cheong, K.L. Physicochemical properties and potential beneficial effects of porphyran from Porphyra haitanensis on intestinal epithelial cells. Carbohydr. Polym. 2020, 246, 116626. [Google Scholar] [CrossRef]
- Wen, L.; Bi, H.; Zhou, X.; Jiang, Y.; Zhu, H.; Fu, X.; Yang, B. Structure characterization of soybean peptides and their protective activity against intestinal inflammation. Food Chem. 2022, 387, 132868. [Google Scholar] [CrossRef] [PubMed]
- Taniguchi, M.; Saito, K.; Aida, R.; Ochiai, A.; Saitoh, E.; Tanaka, T. Wound healing activity and mechanism of action of antimicrobial and lipopolysaccharide-neutralizing peptides from enzymatic hydrolysates of rice bran proteins. J. Biosci. Bioeng. 2019, 128, 142–148. [Google Scholar] [CrossRef] [PubMed]
- Diao, J.; Miao, X.; Chen, H. Anti-inflammatory effects of mung bean protein hydrolysate on the lipopolysaccharide- induced RAW264.7 macrophages. Food Sci. Biotechnol. 2022, 31, 849–856. [Google Scholar] [CrossRef]
- Wang, K.; Kong, X.; Du, M.; Yu, W.; Wang, Z.; Xu, B.; Yang, J.; Xu, J.; Liu, Z.; Cheng, Y.; et al. Novel Soy Peptide CBP: Stimulation of Osteoblast Differentiation via TbetaRI-p38-MAPK-Depending RUNX2 Activation. Nutrients 2022, 14, 1940. [Google Scholar] [CrossRef] [PubMed]
- Amin, M.S.; Yu, B.B.; Wu, D.J.; Lu, Y.J.; Wu, W.; Wang, J.; Zhang, Y.H.; Fu, Y. Zein-Derived Peptides from Corn Promote the Proliferation of C2C12 Myoblasts via Crosstalk of mTORC1 and mTORC2 Signaling Pathways. Foods 2024, 13, 919. [Google Scholar] [CrossRef]
- Zhang, X.; Zhang, H.; Jiao, P.; Xia, M.; Tang, B. Preparation and Evaluation of Antioxidant Activities of Bioactive Peptides Obtained from Cornus officinalis. Molecules 2022, 27, 1232. [Google Scholar] [CrossRef]
- Shi, P.; Fan, F.; Chen, H.; Xu, Z.; Cheng, S.; Lu, W.; Du, M. A bovine lactoferrin-derived peptide induced osteogenesis via regulation of osteoblast proliferation and differentiation. J. Dairy Sci. 2020, 103, 3950–3960. [Google Scholar] [CrossRef]
- Zhang, Z.; Li, G.; Wei, Y.; Feng, Z.; Fang, L.; Li, M.; Ren, J.; Liu, W.; Gan, J. In vitro immunomodulatory and antioxidant effects of oligopeptides and four characteristic peptides in black-bone silky fowl (Gallus gallus domesticus Brisson). J. Food Biochem. 2022, 46, e14469. [Google Scholar] [CrossRef]
- Jung, H.; Jung, D.; Lee, J.; Ki, W.; Lee, J.M.; Kim, E.M.; Nam, M.S.; Kim, K.K. Bioactive peptides in the pancreatin-hydrolysates of whey protein support cell proliferation and scavenge reactive oxygen species. Anim. Cells Syst. 2022, 26, 232–242. [Google Scholar] [CrossRef] [PubMed]
- Wang, J.; Liu, J.; Guo, Y. Cell Growth Stimulation, Cell Cycle Alternation, and Anti-Apoptosis Effects of Bovine Bone Collagen Hydrolysates Derived Peptides on MC3T3-E1 Cells Ex Vivo. Molecules 2020, 25, 2305. [Google Scholar] [CrossRef] [PubMed]
- Zhu, L.; Xie, Y.; Wen, B.; Ye, M.; Liu, Y.; Imam, K.M.S.U.; Cai, H.; Zhang, C.; Wang, F.; Xin, F. Porcine bone collagen peptides promote osteoblast proliferation and differentiation by activating the PI3K/AKT signaling pathway. J. Funct. Foods 2020, 64, 103697. [Google Scholar] [CrossRef]
- Ye, M.; Zhang, C.; Zhu, L.; Jia, W.; Shen, Q. Yak (Bos grunniens) bones collagen-derived peptides stimulate osteoblastic proliferation and differentiation via the activation of Wnt/beta-catenin signaling pathway. J. Sci. Food Agric. 2020, 100, 2600–2609. [Google Scholar] [CrossRef] [PubMed]
- Jang, J.H.; Kim, S.; Lee, H.J.; Suh, H.J.; Jo, K. Stimulating effect of whey protein hydrolysate on bone growth in MC3T3-E1 cells and a rat model. Food Funct. 2021, 12, 5109–5117. [Google Scholar] [CrossRef]
- Qiu, Y.; Ying, J.; Yan, F.; Yu, H.; Zhao, Y.; Li, H.; Xia, S.; Chen, J.; Zhu, J. Novel antiosteoporotic peptides purified from protein hydrolysates of taihe black-boned silky fowl: By larval zebrafish model and molecular docking. Food Res. Int. 2023, 169, 112850. [Google Scholar] [CrossRef] [PubMed]
- Wang, J.Y.; Li, Y.H.; Li, A.; Liu, R.H.; Gao, X.; Li, D.; Kou, X.H.; Xue, Z.H. Nutritional constituent and health benefits of chickpea (Cicer arietinum L.): A review. Food Res. Int. 2021, 150, 110790. [Google Scholar] [CrossRef]
- Xu, J.; Xiao, C.; Xu, H.; Yang, S.; Chen, Z.; Wang, H.; Zheng, B.; Mao, B.; Wu, X. Anti-inflammatory effects of Ganoderma lucidum sterols via attenuation of the p38 MAPK and NF-κB pathways in LPS-induced RAW 264.7 macrophages. Food Chem. Toxicol. 2021, 150, 112073. [Google Scholar] [CrossRef]
- Greenblatt, M.B.; Shim, J.H.; Glimcher, L.H. Mitogen-activated protein kinase pathways in osteoblasts. Annu. Rev. Cell Dev. Biol. 2013, 29, 63–79. [Google Scholar] [CrossRef]
- Vlashi, R.; Zhang, X.; Wu, M.; Chen, G. Wnt signaling: Essential roles in osteoblast differentiation, bone metabolism and therapeutic implications for bone and skeletal disorders. Genes Dis. 2023, 10, 1291–1317. [Google Scholar] [CrossRef]
- Guo, D.; He, H.; Zhao, M.; Zhang, G.; Hou, T. Desalted duck egg white peptides promoted osteogenesis via wnt/beta-catenin signal pathway. J. Food Sci. 2020, 85, 834–842. [Google Scholar] [CrossRef]
- Jang, E.; Jin, S.; Cho, K.J.; Kim, D.; Rho, C.R.; Lyu, J. Wnt/β-catenin signaling stimulates the self-renewal of conjunctival stem cells and promotes corneal conjunctivalization. Exp. Mol. Med. 2022, 54, 1156–1164. [Google Scholar] [CrossRef]
- Gao, R.; Shu, W.; Shen, Y.; Sun, Q.; Jin, W.; Li, D.; Li, Y.; Yuan, L. Peptide fraction from sturgeon muscle by pepsin hydrolysis exerts anti-inflammatory effects in LPS-stimulated RAW264.7 macrophages via MAPK and NF-κB pathways. Food Sci. Hum. Wellness 2021, 10, 103–111. [Google Scholar] [CrossRef]
- Li, J.; Chen, J.; Huang, P.; Cai, Z.; Zhang, N.; Wang, Y.; Li, Y. The Anti-Inflammatory Mechanism of Flaxseed Linusorbs on Lipopolysaccharide-Induced RAW 264.7 Macrophages by Modulating TLR4/NF-κB/MAPK Pathway. Foods 2023, 12, 2398. [Google Scholar] [CrossRef]
- Attiq, A.; Yao, L.J.; Afzal, S.; Khan, M.A. The triumvirate of NF-κB, inflammation and cytokine storm in COVID-19. Int. Immunopharmacol. 2021, 101, 108255. [Google Scholar] [CrossRef] [PubMed]
- Taniguchi, K.; Karin, M. NF-κB, inflammation, immunity and cancer: Coming of age. Nat. Rev. Immunol. 2018, 18, 309–324. [Google Scholar] [CrossRef] [PubMed]
- Yu, Y.; Mo, S.R.; Shen, M.Y.; Chen, Y.; Yu, Q.; Li, Z.D.; Xie, J.H. Sulfated modification enhances the immunomodulatory effect of Cyclocarya paliurus polysaccharide on cyclophosphamide-induced immunosuppressed mice through MyD88-dependent MAPK/NF-Kappa B and PI3K-AKT signaling pathways. Food Res. Int. 2021, 150, 110756. [Google Scholar] [CrossRef] [PubMed]
- Chen, J.; Crawford, R.; Xiao, Y. Vertical inhibition of the PI3K/AKT/mTOR pathway for the treatment of osteoarthritis. J. Cell. Biochem. 2012, 114, 245–249. [Google Scholar] [CrossRef]
- Fu, D.; Shang, X.; Ni, Z.; Shi, G. Shikonin inhibits inflammation and chondrocyte apoptosis by regulation of the PI3K/AKT signaling pathway in a rat model of osteoarthritis. Exp. Ther. Med. 2016, 12, 2735–2740. [Google Scholar] [CrossRef]
- Maharati, A.; Moghbeli, M. PI3K/AKT signaling pathway as a critical regulator of epithelial-mesenchymal transition in colorectal tumor cells. Cell Commun. Signal. 2023, 21, 201. [Google Scholar] [CrossRef]
- Yang, Y.; Jia, X.; Qu, M.; Yang, X.; Fang, Y.; Ying, X.; Zhang, M.; Wei, J.; Pan, Y. Exploring the potential of treating chronic liver disease targeting the PI3K/AKT pathway and polarization mechanism of macrophages. Heliyon 2023, 9, e17116. [Google Scholar] [CrossRef]
- Huang, X.Q.; You, L.; Nepovimova, E.; Psotka, M.; Malinak, D.; Valko, M.; Sivak, L.; Korabecny, J.; Heger, Z.; Adam, V.; et al. Inhibitors of phosphoinositide 3-kinase (PI3K) and phosphoinositide 3-kinase-related protein kinase family (PIKK). J. Enzym. Inhib. Med. Chem. 2023, 38, 2237209. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Q.L.; Long, Y.F.; Jin, L.Y.; Li, C.H.; Long, J. Non-coding RNAs regulate the BMP/Smad pathway during osteogenic differentiation of stem cells. Acta Histochem. 2023, 125, 151998. [Google Scholar] [CrossRef] [PubMed]
- Ren, C.; Gong, W.; Li, F.; Xie, M. Pilose antler aqueous extract promotes the proliferation and osteogenic differentiation of bone marrow mesenchymal stem cells by stimulating the BMP-2/Smad1, 5/Runx2 signaling pathway. Chin. J. Nat. Med. 2019, 17, 756–767. [Google Scholar] [CrossRef]
- Ahmadi, A.; Mazloomnejad, R.; Kasravi, M.; Gholamine, B.; Bahrami, S.; Sarzaeem, M.M.; Niknejad, H. Recent advances on small molecules in osteogenic differentiation of stem cells and the underlying signaling pathways. Stem Cell Res. Ther. 2022, 13, 518. [Google Scholar] [CrossRef]
- Wang, X.-H.; Yang, F.; Pan, J.-B.; Kang, B.; Xu, J.-J.; Chen, H.-Y. Quantitative Imaging of pN Intercellular Force and Energetic Costs during Collective Cell Migration in Epithelial Wound Healing. Anal. Chem. 2020, 92, 16180–16187. [Google Scholar] [CrossRef]
- Zhang, T.; Qin, X.; Cao, Y.; Zhang, J.; Zhao, J. Sea buckthorn (Hippophae rhamnoides L.) oil enhances proliferation, adipocytes differentiation and insulin sensitivity in 3T3-L1 cells. Food Sci. Biotechnol. 2020, 29, 1511–1518. [Google Scholar] [CrossRef] [PubMed]
- Veeraperumal, S.; Qiu, H.-M.; Zeng, S.-S.; Yao, W.-Z.; Wang, B.-P.; Liu, Y.; Cheong, K.-L. Polysaccharides from Gracilaria lemaneiformis promote the HaCaT keratinocytes wound healing by polarised and directional cell migration. Carbohydr. Polym. 2020, 241, 116310. [Google Scholar] [CrossRef]
- Zhong, W.; He, J.; Huang, W.; Yin, G.; Liu, G.; Cao, Y.; Miao, J. Effect of the phosphorylation structure in casein phosphopeptides on the proliferation, differentiation, and mineralization of osteoblasts and its mechanism. Food Funct. 2023, 14, 10107–10118. [Google Scholar] [CrossRef] [PubMed]
- Xie, H.; Chen, X.; Shen, X.; He, Y.; Chen, W.; Luo, Q.; Ge, W.; Yuan, W.; Tang, X.; Hou, D.; et al. Preparation of chitosan-collagen-alginate composite dressing and its promoting effects on wound healing. Int. J. Biol. Macromol. 2018, 107, 93–104. [Google Scholar] [CrossRef] [PubMed]
- Kuroyanagi, M.; Yamamoto, A.; Shimizu, N.; Ishihara, E.; Ohno, H.; Takeda, A.; Kuroyanagi, Y. Development of cultured dermal substitute composed of hyaluronic acid and collagen spongy sheet containing fibroblasts and epidermal growth factor. J. Biomater. Sci.-Polym. Ed. 2014, 25, 1133–1143. [Google Scholar] [CrossRef]
- Yoo, Y.; Hyun, H.; Yoon, S.-J.; Kim, S.Y.; Lee, D.-W.; Um, S.; Hong, S.O.; Yang, D.H. Visible light-cured glycol chitosan hydrogel dressing containing endothelial growth factor and basic fibroblast growth factor accelerates wound healing in vivo. J. Ind. Eng. Chem. 2018, 67, 365–372. [Google Scholar] [CrossRef]
- Ning, J.L.; Zhao, H.L.; Chen, B.; Mi, E.Z.L.; Yang, Z.; Qing, W.H.; Lam, K.W.J.; Yi, B.; Chen, Q.; Gu, J.T.; et al. Argon Mitigates Impaired Wound Healing Process and Enhances Wound Healing In Vitro and In Vivo. Theranostics 2019, 9, 477–490. [Google Scholar] [CrossRef]
- Chunhui, Y.; Wenjun, C.; Hui, W.; Liquan, S.; Changwei, Z.; Tianzhu, Z.; Wenhai, Z. Pilose antler peptide protects osteoblasts from inflammatory and oxidative injury through EGF/EGFR signaling. Int. J. Biol. Macromol. 2017, 99, 15–20. [Google Scholar] [CrossRef]
- Moldagaliyeva, D.; Uzakov, Y.; Sarsembayeva, N.; Ibazhanova, A.; Jussipbekova, B.; Nurakhova, A.; Artykbayeva, U.; Baimuratova, M. Functional semi-finished fish product evaluation: Organoleptic and evidence in vivo. Front. Sustain. Food Syst. 2023, 7, 1190340. [Google Scholar] [CrossRef]
- Madhu, M.; Kumar, D.; Sirohi, R.; Tarafdar, A.; Dhewa, T.; Aluko, R.E.; Badgujar, P.C.; Awasthi, M.K. Bioactive peptides from meat: Current status on production, biological activity, safety, and regulatory framework. Chemosphere 2022, 307, 135650. [Google Scholar] [CrossRef]
- Kruger, C.L.; Mann, S.W. Safety evaluation of functional ingredients. Food Chem. Toxicol. 2003, 41, 793–805. [Google Scholar] [CrossRef] [PubMed]
- Gonçalves, A.C.; Nunes, A.R.; Flores-Félix, J.D.; Alves, G.; Silva, L.R. Cherries and Blueberries-Based Beverages: Functional Foods with Antidiabetic and Immune Booster Properties. Molecules 2022, 27, 3294. [Google Scholar] [CrossRef]
- Najafian, L. A review of bioactive peptides as functional food ingredients: Mechanisms of action and their applications in active packaging and food quality improvement. Food Funct. 2023, 14, 5835–5857. [Google Scholar] [CrossRef] [PubMed]
- Zou, F.L.; Tan, C.M.; Shinali, T.S.; Zhang, B.; Zhang, L.L.; Han, Z.X.; Shang, N. Plant antimicrobial peptides: A comprehensive review of their classification, production, mode of action, functions, applications, and challenges. Food Funct. 2023, 14, 5492–5515. [Google Scholar] [CrossRef]
- Cui, P.B.; Li, M.Y.; Yu, M.X.; Liu, Y.F.; Ding, Y.T.; Liu, W.L.; Liu, J.H. Advances in sports food: Sports nutrition, food manufacture, opportunities and challenges. Food Res. Int. 2022, 151, 111258. [Google Scholar] [CrossRef]
- O’Brien, P. Regulation of functional foods in China: A framework in flux. Regul. Rapp. 2016, 12, 15–19. [Google Scholar]
- Yuan, H.; Luo, Z.; Ban, Z.; Reiter, R.J.; Ma, Q.; Liang, Z.; Yang, M.; Li, X.; Li, L. Bioactive peptides of plant origin: Distribution, functionality, and evidence of benefits in food and health. Food Funct. 2022, 13, 3133–3158. [Google Scholar] [CrossRef]
- Jakubczyk, A.; Karaś, M.; Rybczyńska-Tkaczyk, K.; Zielińska, E.; Zieliński, D. Current Trends of Bioactive Peptides—New Sources and Therapeutic Effect. Foods 2020, 9, 846. [Google Scholar] [CrossRef] [PubMed]
- Fang, Z.; Xu, L.; Lin, Y.; Cai, X.; Wang, S. The preservative potential of Octopus scraps peptides−Zinc chelate against Staphylococcus aureus: Its fabrication, antibacterial activity and action mode. Food Control 2019, 98, 24–33. [Google Scholar] [CrossRef]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).