The Potential Use of Peptides in the Fight against Chagas Disease and Leishmaniasis
Abstract
1. Introduction
2. Leishmaniasis and Chagas Disease
2.1. Life Cycle of Trypanosomatidae
2.1.1. Life Cycle of Leishmania Species
2.1.2. Life Cycle of Trypanosoma cruzi
2.2. Epidemiology of Trypanosomatids
2.3. Clinical Complications and Conditions of Leishmaniasis and Chagas Disease
2.3.1. Leishmaniasis
Cutaneous Leishmaniasis (CL)
Diffuse Cutaneous Leishmaniasis (DCL)
Mucocutaneous Leishmaniasis (ML)
Visceral Leishmaniasis (VL)
Post Kala Azar Dermal Leishmaniasis (PKDL)
2.3.2. Chagas Disease
Acute Chagas Disease
Chronic Chagas Disease
2.4. Pathways Involved in Leishmaniasis and Chagas Disease
3. Drug Discovery Strategies and Insights into Current Therapeutics
3.1. Approaches to Drug Development against Leishmaniasis and Chagas Disease
3.2. Current Drugs for Leishmaniasis and Chagas Disease
3.2.1. Leishmaniasis
3.2.2. Chagas Disease
Disease | Drug | Route | Mechanism of Action | Disadvantages | Toxicity | References |
---|---|---|---|---|---|---|
Leishmaniasis | Miltefosine | Oral 5–100 mg/kg/day for 28 days | An anti-apoptotic agent targeting lipid metabolism, mitochondria, and immune function | Need allometric administration in children | Gastrointestinal complications, teratogenic | [174,175,176] |
Leishmaniasis | Paromomycin | Parenteral (im) 15 mg/kg/day for 21 days | There is little knowledge about this. Several studies show that cationic paromomycin binds negatively charged glycocalyxes and lipophosphoglycans found on the surfaces of leishmania promastigotes, a major component of leishmania promastigotes | Poor results against African VL as monotherapy | Pain in the injection site, hepatotoxicity | [177,178,179] |
Leishmaniasis | Pentamidine | Slow infusion (iv) 4 mg/kg monthly for 12 months | Not known; drug entry through polyamine/arginine transporters | Multiple adverse effects | Insulin-dependent diabetes, myocarditis, nephrotoxicity | [180] |
Leishmaniasis | SbV—paromomycin combination | Parenteral (im) SbV 20 mg/kg/day + paromomycin for 17 days | Currently, there are two models of Sb(V) activity: the prodrug model of conversion to toxic Sb(III) and the intrinsic Sb(V) activity based on complex formation with ribose/inhibition of type I DNA topoisomerase. | Require hospitalization | Problems regarding SbV administration | [174,181] |
Leishmaniasis | Amphotericine B deoxycholate | Slow infusion (iv) 1 mg/kg/day for 30 days | Channel/pore formation on interaction with membrane sterol | Require hospitalization | Nephrotoxicity | [182,183] |
Leishmaniasis | SbV—based drugs | Parenteral (im) 20 mg/kg/day for 28–30 days | Prodrug model conversion of Sb(V) to toxic Sb(III) and intrinsic Sb(V) activity: by inhibiting type I DNA topoisomerase/complex formation with ribose | Drug resistance in Bihar (India), PKDL | Pain in the injection site, cardiotoxicity, pancreatitis | [184,185] |
Leishmaniasis | AmBisome | Slow infusion (iv) 10 mg/kg single dose | Channel/pore formation on interaction with membrane sterol | Costly, chemically unstable | Fever during infusion, back pain, nephrotoxicity | [186,187] |
Chagas disease | Benznidazole (BZL) | Given for 60 days on daily basis at 5–7 mg/kg, and 10 mg/kg for adults and children, respectively | Inhibits the synthesis of DNA, RNA, and proteins within the T. cruzi parasite | Low solubility, toxic, and several side effects | Low bioavailability and drug effectiveness, chronic effects | [86,188,189,190] |
Chagas disease | Nifurtimox (NFX) | 8–10 mg/kg daily in three divided doses for adults, and 15–20 mg/kg daily in four divided doses for children during 60 to 90 days | Metabolism via partial reduction to chemically reactive radicals that cause production of toxic reduced products of oxygen | Toxic and have side effect, causes gastrointestinal, maladies (nausea, vomiting, abdominal pain) effects | Have higher toxicity and adverse effect than BZL, and it affects the pancreases and heart via increasing of oxidative stress | [191,192,193] |
4. Novel Strategies for Leishmaniasis and Chagas Disease Treatments
4.1. Host-Directed Therapy (HDT)
4.2. Multi-Drug or Combination Therapy
4.3. Drug Repurposing
4.4. Promising Natural Products
4.5. Nanotechnology
4.6. Nano Vaccines
5. Peptide Targeting for Leishmaniasis and Chagas Disease Therapies
5.1. Peptide Therapies
5.2. Anti-Microbial Peptides
5.2.1. Anti-Microbial Peptides against Chagas Disease and Leishmaniasis
5.2.2. Structural Analysis of Selected Anti-Microbial Peptide Profiles against Leishmaniasis and Chagas Disease
5.3. Protein–Protein Interactions as Drug Targets in Leishmaniasis and Chagas Disease
6. Conclusions and Future Directions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Stuart, K.; Brun, R.; Croft, S.; Fairlamb, A.; Gürtler, R.E.; McKerrow, J.; Reed, S.; Tarleton, R. Kinetoplastids: Related protozoan pathogens, different diseases. J. Clin. Investig. 2008, 118, 1301–1310. [Google Scholar] [CrossRef] [PubMed]
- Naula, C.; Parsons, M.; Mottram, J.C. Protein kinases as drug targets in trypanosomes and Leishmania. Biochim. Biophys. Acta (BBA)-Proteins Proteom. 2005, 1754, 151–159. [Google Scholar] [CrossRef] [PubMed]
- Abadías-Granado, I.; Diago, A.; Cerro, P.; Palma-Ruiz, A.; Gilaberte, Y. Cutaneous and mucocutaneous leishmaniasis. Actas Dermo-Sifiliográficas 2021, 112, 601–618. [Google Scholar] [CrossRef]
- Singh, R.; Kashif, M.; Srivastava, P.; Manna, P.P. Recent Advances in Chemotherapeutics for Leishmaniasis: Importance of the Cellular Biochemistry of the Parasite and Its Molecular Interaction with the Host. Pathogens 2023, 12, 706. [Google Scholar] [CrossRef] [PubMed]
- Assis, T.S.M.d.; Rosa, D.C.P.; Teixeira, E.d.M.; Cota, G.; Azeredo-da-Silva, A.L.F.; Werneck, G.; Rabello, A. The direct costs of treating human visceral leishmaniasis in Brazil. Rev. Soc. Bras. Med. Trop. 2017, 50, 478–482. [Google Scholar] [CrossRef] [PubMed]
- Lawrence, D.S.; Muthoga, C.; Meya, D.B.; Tugume, L.; Williams, D.; Rajasingham, R.; Boulware, D.R.; Mwandumba, H.C.; Moyo, M.; Dziwani, E.N. Cost-effectiveness of single, high-dose, liposomal amphotericin regimen for HIV-associated cryptococcal meningitis in five countries in sub-Saharan Africa: An economic analysis of the AMBITION-cm trial. Lancet Glob. Health 2022, 10, e1845–e1854. [Google Scholar] [CrossRef] [PubMed]
- Boettiger, D.C.; Lin, T.K. Cost-effectiveness of liposomal amphotericin B for HIV-associated cryptococcal meningitis. Lancet Glob. Health 2022, 10, e1705–e1706. [Google Scholar] [CrossRef] [PubMed]
- Alvar, J.; Arana, B.I. Appraisal of Leishmaniasis Chemotherapy, Current Status and Pipeline Strategies Chapter 1 Leishmaniasis, Impact and Therapeutic Needs 3. Drug Discov. Leishmaniasis 2018, 10, 9781788010177-00001. [Google Scholar]
- Rajao, M.A.; Furtado, C.; Alves, C.L.; Passos-Silva, D.G.; De Moura, M.B.; Schamber-Reis, B.L.; Kunrath-Lima, M.; Zuma, A.A.; Vieira-da-Rocha, J.P.; Garcia, J.B.F. Unveiling benznidazole’s mechanism of action through overexpression of DNA repair proteins in Trypanosoma cruzi. Environ. Mol. Mutagen. 2014, 55, 309–321. [Google Scholar] [CrossRef]
- Sangshetti, J.N.; Khan, F.A.K.; Kulkarni, A.A.; Arote, R.; Patil, R.H. Antileishmanial drug discovery: Comprehensive review of the last 10 years. RSC Adv. 2015, 5, 32376–32415. [Google Scholar] [CrossRef]
- Chappuis, F.; Sundar, S.; Hailu, A.; Ghalib, H.; Rijal, S.; Peeling, R.W.; Alvar, J.; Boelaert, M. Visceral leishmaniasis: What are the needs for diagnosis, treatment and control? Nat. Rev. Microbiol. 2007, 5, 873–882. [Google Scholar] [CrossRef]
- Sundberg, S.A. High-throughput and ultra-high-throughput screening: Solution-and cell-based approaches. Curr. Opin. Biotechnol. 2000, 11, 47–53. [Google Scholar] [CrossRef]
- Mayr, L.M.; Bojanic, D. Novel trends in high-throughput screening. Curr. Opin. Pharmacol. 2009, 9, 580–588. [Google Scholar] [CrossRef]
- Akao, Y.; Canan, S.; Cao, Y.; Condroski, K.; Engkvist, O.; Itono, S.; Kaki, R.; Kimura, C.; Kogej, T.; Nagaoka, K. Collaborative virtual screening to elaborate an imidazo [1, 2-a] pyridine hit series for visceral leishmaniasis. RSC Med. Chem. 2021, 12, 384–393. [Google Scholar] [CrossRef] [PubMed]
- Schaduangrat, N.; Lampa, S.; Simeon, S.; Gleeson, M.P.; Spjuth, O.; Nantasenamat, C. Towards reproducible computational drug discovery. J. Cheminformatics 2020, 12, 9. [Google Scholar] [CrossRef] [PubMed]
- Chatelain, E.; Ioset, J.-R. Phenotypic screening approaches for Chagas disease drug discovery. Expert. Opin. Drug Discov. 2018, 13, 141–153. [Google Scholar] [CrossRef] [PubMed]
- Zahedifard, F.; Rafati, S. Prospects for antimicrobial peptide-based immunotherapy approaches in Leishmania control. Expert. Rev. Anti-Infect. Ther. 2018, 16, 461–469. [Google Scholar] [CrossRef] [PubMed]
- Rafferty, J.; Nagaraj, H.; McCloskey, A.P.; Huwaitat, R.; Porter, S.; Albadr, A.; Laverty, G. Peptide therapeutics and the pharmaceutical industry: Barriers encountered translating from the laboratory to patients. Curr. Med. Chem. 2016, 23, 4231–4259. [Google Scholar] [CrossRef] [PubMed]
- Díaz-Garrido, P.; Cárdenas-Guerra, R.E.; Martínez, I.; Poggio, S.; Rodríguez-Hernández, K.; Rivera-Santiago, L.; Ortega-López, J.; Sánchez-Esquivel, S.; Espinoza, B. Differential activity on trypanosomatid parasites of a novel recombinant defensin type 1 from the insect Triatoma (Meccus) pallidipennis. Insect Biochem. Mol. Biol. 2021, 139, 103673. [Google Scholar] [CrossRef] [PubMed]
- Dostálová, A.; Volf, P. Leishmania development in sand flies: Parasite-vector interactions overview. Parasites Vectors 2012, 5, 276. [Google Scholar] [CrossRef]
- Killick-Kendrick, R. The biology and control of phlebotomine sand flies. Clin. Dermatol. 1999, 17, 279–289. [Google Scholar] [CrossRef]
- Teixeira, D.E.; Benchimol, M.; Rodrigues, J.C.; Crepaldi, P.H.; Pimenta, P.F.; de Souza, W. The cell biology of Leishmania: How to teach using animations. PLoS Pathog. 2013, 9, e1003594. [Google Scholar] [CrossRef]
- Sunter, J.; Gull, K. Shape, form, function and Leishmania pathogenicity: From textbook descriptions to biological understanding. Open Biol. 2017, 7, 170165. [Google Scholar] [CrossRef]
- Saada, E.A.; Kabututu, Z.P.; Lopez, M.; Shimogawa, M.M.; Langousis, G.; Oberholzer, M.; Riestra, A.; Jonsson, Z.O.; Wohlschlegel, J.A.; Hill, K.L. Insect stage-specific receptor adenylate cyclases are localized to distinct subdomains of the Trypanosoma brucei flagellar membrane. Eukaryot. Cell 2014, 13, 1064–1076. [Google Scholar] [CrossRef]
- Secundino, N.; Eger-Mangrich, I.; Braga, E.; Santoro, M.; Pimenta, P. Lutzomyia longipalpis peritrophic matrix: Formation, structure, and chemical composition. J. Med. Entomol. 2005, 42, 928–938. [Google Scholar] [CrossRef]
- Rogers, M.E.; Chance, M.; Bates, P. The role of promastigote secretory gel in the origin and transmission of the infective stage of Leishmania mexicana by the sandfly Lutzomyia longipalpis. Parasitology 2002, 124, 495–507. [Google Scholar] [CrossRef] [PubMed]
- Gossage, S.M.; Rogers, M.E.; Bates, P.A. Two separate growth phases during the development of Leishmania in sand flies: Implications for understanding the life cycle. Int. J. Parasitol. 2003, 33, 1027–1034. [Google Scholar] [CrossRef]
- Bates, P.A. Revising Leishmania’s life cycle. Nat. Microbiol. 2018, 3, 529–530. [Google Scholar] [CrossRef] [PubMed]
- Martín-Escolano, J.; Marín, C.; Rosales, M.J.; Tsaousis, A.D.; Medina-Carmona, E.; Martín-Escolano, R. An updated view of the Trypanosoma cruzi life cycle: Intervention points for an effective treatment. ACS Infect. Dis. 2022, 8, 1107–1115. [Google Scholar] [CrossRef] [PubMed]
- Onyekwelu, K.C. Life Cycle of Trypanosoma cruzi in the Invertebrate and the Vertebrate Hosts. In Biology of Trypanosoma cruzi; BoD—Books on Demand: Norderstedt, Germany, 2019; pp. 1–19. [Google Scholar]
- Rodríguez-Bejarano, O.H.; Avendaño, C.; Patarroyo, M.A. Mechanisms associated with Trypanosoma cruzi host target cell adhesion, recognition and internalization. Life 2021, 11, 534. [Google Scholar] [CrossRef]
- Teixeira, D.E.; Benchimol, M.; Crepaldi, P.H.; de Souza, W. Interactive multimedia to teach the life cycle of Trypanosoma cruzi, the causative agent of Chagas disease. PLoS Neglected Trop. Dis. 2012, 6, e1749. [Google Scholar] [CrossRef]
- Andreoli, W.; Taniwaki, N.; Mortara, R. Survival of Trypanosoma cruzi metacyclic trypomastigotes within Coxiella burnetii vacuoles: Differentiation and replication within an acidic milieu. Microbes Infect. 2006, 8, 172–182. [Google Scholar] [CrossRef]
- Huotari, J.; Helenius, A. Endosome maturation. EMBO J. 2011, 30, 3481–3500. [Google Scholar] [CrossRef]
- Alves, C.R.; Albuquerque-Cunha, J.M.; Mello, C.; Garcia, E.d.S.; Nogueira, N.; Bourguingnon, S.C.; De Souza, W.; Azambuja, P.; Gonzalez, M.S. Trypanosoma cruzi: Attachment to perimicrovillar membrane glycoproteins of Rhodnius prolixus. Exp. Parasitol. 2007, 116, 44–52. [Google Scholar] [CrossRef] [PubMed]
- Garcia, E.S.; Ratcliffe, N.A.; Whitten, M.M.; Gonzalez, M.S.; Azambuja, P. Exploring the role of insect host factors in the dynamics of Trypanosoma cruzi–Rhodnius prolixus interactions. J. Insect Physiol. 2007, 53, 11–21. [Google Scholar] [CrossRef] [PubMed]
- Mendoza-Roldan, J.A.; Votýpka, J.; Bandi, C.; Epis, S.; Modrý, D.; Tichá, L.; Volf, P.; Otranto, D. Leishmania tarentolae: A new frontier in the epidemiology and control of the leishmaniases. Transbound. Emerg. Dis. 2022, 69, e1326–e1337. [Google Scholar] [CrossRef] [PubMed]
- Ferreira, L.C.; Quintella, L.P.; Schubach, A.d.O.; Miranda, L.d.F.C.; Madeira, M.d.F.; Pimentel, M.I.F.; Vasconcellos, É.d.C.F.e.; Lyra, M.R.; Oliveira, R.d.V.C.d.; Menezes, R.C. Comparison between Colorimetric In Situ Hybridization, Histopathology, and Immunohistochemistry for the Diagnosis of New World Cutaneous Leishmaniasis in Human Skin Samples. Trop. Med. Infect. Dis. 2022, 7, 344. [Google Scholar] [CrossRef] [PubMed]
- Hadermann, A.; Heeren, S.; Maes, I.; Dujardin, J.-C.; Domagalska, M.A.; Van den Broeck, F. Genome diversity of Leishmania aethiopica. Front. Cell. Infect. Microbiol. 2023, 13, 406. [Google Scholar] [CrossRef] [PubMed]
- Bezemer, J.M.; Freire-Paspuel, B.P.; Schallig, H.D.; de Vries, H.J.; Calvopiña, M. Leishmania species and clinical characteristics of Pacific and Amazon cutaneous leishmaniasis in Ecuador and determinants of health-seeking delay: A cross-sectional study. BMC Infect. Dis. 2023, 23, 395. [Google Scholar] [CrossRef] [PubMed]
- Preativatanyou, K.; Chinwirunsirisup, K.; Phumee, A.; Khositharattanakool, P.; Sunantaraporn, S.; Depaquit, J.; Siriyasatien, P. Species diversity of phlebotomine sand flies and sympatric occurrence of Leishmania (Mundinia) martiniquensis, Leishmania (Leishmania) donovani complex, and Trypanosoma spp. in the visceral leishmaniasis focus of southern Thailand. Acta Trop. 2023, 244, 106949. [Google Scholar] [CrossRef] [PubMed]
- Dinç, M.; Yalçın, T.; Çavuş, İ.; Özbilgin, A. Comparative proteomic analysis of Leishmania parasites isolated from visceral and cutaneous leishmaniasis patients. Parasitology 2022, 149, 298–305. [Google Scholar] [CrossRef]
- Gramiccia, M.; Gradoni, L. The current status of zoonotic leishmaniases and approaches to disease control. Int. J. Parasitol. 2005, 35, 1169–1180. [Google Scholar] [CrossRef]
- Schriefer, A.; Guimarães, L.H.; Machado, P.R.; Lessa, M.; Lessa, H.A.; Lago, E.; Ritt, G.; Góes-Neto, A.; Schriefer, A.L.; Riley, L.W. Geographic clustering of leishmaniasis in northeastern Brazil. Emerg. Infect. Dis. 2009, 15, 871. [Google Scholar] [CrossRef]
- Montalvo Alvarez, A.M.; Nodarse, J.F.; Goodridge, I.M.; Fidalgo, L.M.; Marin, M.; Van Der Auwera, G.; Dujardin, J.-C.; Velez Bernal, I.D.; Muskus, C. Differentiation of Leishmania (Viannia) panamensis and Leishmania (V.) guyanensis using Bcc I for hsp 70 PCR-RFLP. Trans. R. Soc. Trop. Med. Hyg. 2010, 104, 364–367. [Google Scholar] [CrossRef]
- Ducharme, O.; Simon, S.; Ginouves, M.; Prévot, G.; Couppie, P.; Demar, M.; Blaizot, R. Leishmania naiffi and lainsoni in French Guiana: Clinical features and phylogenetic variability. PLoS Neglected Trop. Dis. 2020, 14, e0008380. [Google Scholar] [CrossRef]
- Espada, C.R.; Ferreira, B.A.; Ortiz, P.A.; Uliana, S.R.; Coelho, A.C. Full nucleotide sequencing of ribosomal DNA internal transcribed spacer of Leishmania species causing cutaneous leishmaniasis in Brazil and its potential for species typing. Acta Trop. 2021, 223, 106093. [Google Scholar] [CrossRef]
- Espinoza-Morales, D.; Rodríguez, A.L.; Silva-Caso, W.; Suarez-Ognio, L.; Pons, M.J.; del Valle Mendoza, J. An atypical case of disseminated cutaneous leishmaniasis due to Leishmania peruviana in the valleys of Ancash-Peru. Asian Pac. J. Trop. Med. 2017, 10, 1101–1103. [Google Scholar] [CrossRef] [PubMed]
- Passero, L.F.D.; Carvalho, A.K.; Bordon, M.L.; Bonfim-Melo, A.; Carvalho, K.; Kallás, E.G.; Santos, B.B.; Toyama, M.H.; Paes-Leme, A.; Corbett, C.E. Proteins of Leishmania (Viannia) shawi confer protection associated with Th1 immune response and memory generation. Parasites Vectors 2012, 5, 64. [Google Scholar] [CrossRef] [PubMed]
- Sukhumavasi, W.; Kaewamatawong, T.; Somboonpoonpol, N.; Jiratanh, M.; Wattanamethanont, J.; Kaewthamasorn, M.; Leelayoova, S.; Tiwananthagorn, S. Liver-and spleen-specific immune responses in experimental leishmania martiniquensis infection in BALB/c mice. Front. Vet. Sci. 2021, 8, 794024. [Google Scholar] [CrossRef] [PubMed]
- Supsrisunjai, C.; Kootiratrakarn, T.; Puangpet, P.; Bunnag, T.; Chaowalit, P.; Wessagowit, V. Case report: Disseminated autochthonous dermal leishmaniasis caused by Leishmania siamensis (PCM2 Trang) in a patient from central Thailand infected with human immunodeficiency virus. Am. J. Trop. Med. Hyg. 2017, 96, 1160. [Google Scholar] [PubMed]
- Ramírez, J.D.; Hernández, C.; León, C.M.; Ayala, M.S.; Flórez, C.; González, C. Taxonomy, diversity, temporal and geographical distribution of Cutaneous Leishmaniasis in Colombia: A retrospective study. Sci. Rep. 2016, 6, 28266. [Google Scholar] [CrossRef] [PubMed]
- Franco, J.R.; Simarro, P.P.; Diarra, A.; Jannin, J.G. Epidemiology of human African trypanosomiasis. Clin. Epidemiol. 2014, 6, 257–275. [Google Scholar]
- Schmunis, G.A.; Yadon, Z.E. Chagas disease: A Latin American health problem becoming a world health problem. Acta Trop. 2010, 115, 14–21. [Google Scholar] [CrossRef] [PubMed]
- Kourbeli, V.; Chontzopoulou, E.; Moschovou, K.; Pavlos, D.; Mavromoustakos, T.; Papanastasiou, I.P. An overview on target-based drug design against kinetoplastid protozoan infections: Human African trypanosomiasis, Chagas disease and leishmaniases. Molecules 2021, 26, 4629. [Google Scholar] [CrossRef] [PubMed]
- Bilgic-Temel, A.; Murrell, D.F.; Uzun, S. Cutaneous leishmaniasis: A neglected disfiguring disease for women. Int. J. Women’s Dermatol. 2019, 5, 158–165. [Google Scholar] [CrossRef]
- Kaluarachchi, T.J.; Campbell, P.M.; Wickremasinghe, R.; Ranasinghe, S.; Yasewardene, S.; De Silva, H.; McBain, A.J.; Weerasekera, M. Possible clinical implications and future directions of managing bacterial biofilms in cutaneous leishmaniasis wounds. Trop. Med. Health 2022, 50, 58. [Google Scholar] [CrossRef]
- Martínez, D.Y.; Verdonck, K.; Kaye, P.M.; Adaui, V.; Polman, K.; Llanos-Cuentas, A.; Dujardin, J.-C.; Boelaert, M. Tegumentary leishmaniasis and coinfections other than HIV. PLoS Neglected Trop. Dis. 2018, 12, e0006125. [Google Scholar] [CrossRef]
- Meireles, C.B.; Maia, L.C.; Soares, G.C.; Teodoro, I.P.P.; Gadelha, M.d.S.V.; da Silva, C.G.L.; de Lima, M.A.P. Atypical presentations of cutaneous leishmaniasis: A systematic review. Acta Trop. 2017, 172, 240–254. [Google Scholar] [CrossRef]
- Torres-Guerrero, E.; Quintanilla-Cedillo, M.R.; Ruiz-Esmenjaud, J.; Arenas, R. Leishmaniasis: A review. F1000Research 2017, 6, 750. [Google Scholar] [CrossRef]
- Sinha, S.; Fernández, G.; Kapila, R.; Lambert, W.C.; Schwartz, R.A. Diffuse cutaneous leishmaniasis associated with the immune reconstitution inflammatory syndrome. Int. J. Dermatol. 2008, 47, 1263–1270. [Google Scholar] [CrossRef]
- Hashiguchi, Y.; Gomez, E.L.; Kato, H.; Martini, L.R.; Velez, L.N.; Uezato, H. Diffuse and disseminated cutaneous leishmaniasis: Clinical cases experienced in Ecuador and a brief review. Trop. Med. Health 2016, 44, 2. [Google Scholar] [CrossRef] [PubMed]
- Goihman-Yahr, M. American mucocutaneous leishmaniasis. Dermatol. Clin. 1994, 12, 703–712. [Google Scholar] [CrossRef] [PubMed]
- Vera-Izaguirre, D.S.; Vega-Memije, E.; Quintanilla-Cedillo, M.R.; Arenas, R. Leishmaniasis. A review. Dermatol. Cosmética Médica Y Quirúrgica 2006, 4, 252–260. [Google Scholar]
- Murray, H.W.; Berman, J.D.; Davies, C.R.; Saravia, N.G. Advances in leishmaniasis. Lancet 2005, 366, 1561–1577. [Google Scholar] [CrossRef] [PubMed]
- CONVIT, J.; REYES, O.; KERDEL, F. Disseminated Anergic American Leishmaniasis: Report of Three Cases of a Type Clinically Resembling Lepromatous Leprosy. AMA Arch. Dermatol. 1957, 76, 213–217. [Google Scholar] [CrossRef]
- Chaudhary, R.G.; Bilimoria, F.E.; Katare, S. Diffuse cutaneous leishmaniasis: Co-infection with human immunodeficiency virus (HIV). Indian J. Dermatol. Venereol. Leprol. 2008, 74, 641. [Google Scholar] [CrossRef]
- David, C.V.; Craft, N. Cutaneous and mucocutaneous leishmaniasis. Dermatol. Ther. 2009, 22, 491–502. [Google Scholar] [CrossRef]
- Garrido-Jareño, M.; Sahuquillo-Torralba, A.; Chouman-Arcas, R.; Castro-Hernández, I.; Molina-Moreno, J.M.; Llavador-Ros, M.; Gómez-Ruiz, M.D.; López-Hontangas, J.L.; Botella-Estrada, R.; Salavert-Lleti, M. Cutaneous and mucocutaneous leishmaniasis: Experience of a Mediterranean hospital. Parasites Vectors 2020, 13, 24. [Google Scholar] [CrossRef]
- Ahluwalia, S.; Lawn, S.D.; Kanagalingam, J.; Grant, H.; Lockwood, D.N. Mucocutaneous leishmaniasis: An imported infection among travellers to central and South America. BMJ 2004, 329, 842–844. [Google Scholar] [CrossRef]
- Marra, F.; Chiappetta, M.C.; Vincenti, V. Ear, nose and throat manifestations of mucocutaneous Leishmaniasis: A literature review. Acta Biomed. 2014, 85, 3–7. [Google Scholar] [PubMed]
- Bern, C. Visceral Leishmaniasis: Clinical Manifestations and Diagnosis. In U: UpToDate, Post TW ur. UpToDate; UpToDate: Waltham, MA, USA, 2021. [Google Scholar]
- Baba, C.S.; Makharia, G.K.; Mathur, P.; Ray, R.; Gupta, S.D.; Samantaray, J. Chronic diarrhea and malabsorption caused by Leishmania donovani. Indian J. Gastroenterol. 2006, 25, 309. [Google Scholar] [PubMed]
- Boukhris, I.; Azzabi, S.; Chérif, E.; Kéchaou, I.; Mahjoub, S.; Kooli, C.; Aoun, K.; Khalfallah, N. Hemophagocytosis and disseminated intravascular coagulation in visceral leishmaniasis in adults: Three new cases. Pan Afr. Med. J. 2015, 22, 96. [Google Scholar] [PubMed]
- Pagliano, P.; Carannante, N.; Rossi, M.; Gramiccia, M.; Gradoni, L.; Faella, F.S.; Gaeta, G.B. Visceral leishmaniasis in pregnancy: A case series and a systematic review of the literature. J. Antimicrob. Chemother. 2005, 55, 229–233. [Google Scholar] [CrossRef] [PubMed]
- Herrero, M.; Orfanos, G.; Argaw, D.; Mulugeta, A.; Aparicio, P.; Parreño, F.; Bernal, O.; Rubens, D.; Pedraza, J.; Lima, M.A. Natural history of a visceral leishmaniasis outbreak in highland Ethiopia. Am. J. Trop. Med. Hyg. 2009, 81, 373–377. [Google Scholar] [CrossRef] [PubMed]
- Mueller, Y.; Mbulamberi, D.B.; Odermatt, P.; Hoffmann, A.; Loutan, L.; Chappuis, F. Risk factors for in-hospital mortality of visceral leishmaniasis patients in eastern Uganda. Trop. Med. Int. Health 2009, 14, 910–917. [Google Scholar] [CrossRef]
- Zijlstra, E.E. Biomarkers in post-kala-azar dermal leishmaniasis. Front. Cell. Infect. Microbiol. 2019, 9, 228. [Google Scholar] [CrossRef]
- Zijlstra, E.E. The immunology of post-kala-azar dermal leishmaniasis (PKDL). Parasites Vectors 2016, 9, 464. [Google Scholar] [CrossRef]
- Zijlstra, E.; Musa, A.; Khalil, E.; El Hassan, I.; El-Hassan, A. Post-kala-azar dermal leishmaniasis. Lancet Infect. Dis. 2003, 3, 87–98. [Google Scholar] [CrossRef]
- Kumar, P.; Chatterjee, M.; Das, N.K. Post kala-azar dermal leishmaniasis: Clinical features and differential diagnosis. Indian J. Dermatol. 2021, 66, 24. [Google Scholar]
- Suárez, C.; Nolder, D.; García-Mingo, A.; Moore, D.A.; Chiodini, P.L. Diagnosis and clinical management of Chagas disease: An increasing challenge in non-endemic areas. Res. Rep. Trop. Med. 2022, 2022, 25–40. [Google Scholar] [CrossRef]
- Nunes, M.C.P.; Dones, W.; Morillo, C.A.; Encina, J.J.; Ribeiro, A.L.; Council on Chagas Disease of the Interamerican Society of Cardiology. Chagas disease: An overview of clinical and epidemiological aspects. J. Am. Coll. Cardiol. 2013, 62, 767–776. [Google Scholar] [CrossRef]
- Hemmige, V.; Tanowitz, H.; Sethi, A. Trypanosoma cruzi infection: A review with emphasis on cutaneous manifestations. Int. J. Dermatol. 2012, 51, 501–508. [Google Scholar] [CrossRef] [PubMed]
- Teixeira, A.; Nitz, N.; Guimaro, M.; Gomes, C.; Santos-Buch, C. Chagas disease. Postgrad. Med. J. 2006, 82, 788–798. [Google Scholar] [CrossRef]
- World Health Organization. Control of Chagas Disease: Second Report of the WHO Expert Committee; World Health Organization: Geneva, Switzerland, 2002; Volume 2. [Google Scholar]
- Malik, L.H.; Singh, G.D.; Amsterdam, E.A. The epidemiology, clinical manifestations, and management of chagas heart disease. Clin. Cardiol. 2015, 38, 565–569. [Google Scholar] [CrossRef]
- de Lourdes Higuchi, M.; Fukasawa, S.; De Brito, T.; Parzianello, L.C.; Bellotti, G.; Ramires, J.A.F. Different microcirculatory and interstitial matrix patterns in idiopathic dilated cardiomyopathy and Chagas’ disease: A three dimensional confocal microscopy study. Heart 1999, 82, 279–285. [Google Scholar] [CrossRef]
- Benvenuti, L.; Roggério, A.; Freitas, H.; Mansur, A.; Fiorelli, A.; Higuchi, M. Chronic American trypanosomiasis: Parasite persistence in endomyocardial biopsies is associated with high-grade myocarditis. Ann. Trop. Med. Parasitol. 2008, 102, 481–487. [Google Scholar] [CrossRef] [PubMed]
- Marin-Neto, J.A.; Cunha-Neto, E.; Maciel, B.C.; Simões, M.V. Pathogenesis of chronic Chagas heart disease. Circulation 2007, 115, 1109–1123. [Google Scholar] [CrossRef] [PubMed]
- Rossi, M.A.; Tanowitz, H.B.; Malvestio, L.M.; Celes, M.R.; Campos, E.C.; Blefari, V.; Prado, C.M. Coronary microvascular disease in chronic Chagas cardiomyopathy including an overview on history, pathology, and other proposed pathogenic mechanisms. PLoS Neglected Trop. Dis. 2010, 4, e674. [Google Scholar] [CrossRef]
- Rocha, M.O.C.; Nunes, M.C.P.; Ribeiro, A.L. Morbidity and prognostic factors in chronic chagasic cardiopathy. Memórias Do Inst. Oswaldo Cruz 2009, 104, 159–166. [Google Scholar] [CrossRef]
- Rassi, A., Jr.; Rassi, S.G.; Rassi, A. Sudden death in Chagas’ disease. Arq. Bras. Cardiol. 2001, 76, 86–96. [Google Scholar] [CrossRef]
- Tripodi, K.E.; Menendez Bravo, S.M.; Cricco, J.A. Role of heme and heme-proteins in trypanosomatid essential metabolic pathways. Enzym. Res. 2011, 2011, 873230. [Google Scholar] [CrossRef]
- Friggeri, L.; Hargrove, T.Y.; Rachakonda, G.; Blobaum, A.L.; Fisher, P.; De Oliveira, G.M.; Da Silva, C.F.; Soeiro, M.d.N.C.; Nes, W.D.; Lindsley, C.W. Sterol 14α-demethylase structure-based optimization of drug candidates for human infections with the protozoan Trypanosomatidae. J. Med. Chem. 2018, 61, 10910–10921. [Google Scholar] [CrossRef] [PubMed]
- de Souza, W.; Rodrigues, J.C.F. Sterol biosynthesis pathway as target for anti-trypanosomatid drugs. Interdiscip. Perspect. Infect. Dis. 2009, 2009, 642502. [Google Scholar] [CrossRef] [PubMed]
- Marathe, C.; Bradley, M.N.; Hong, C.; Lopez, F.; de Galarreta, C.M.R.; Tontonoz, P.; Castrillo, A. The arginase II gene is an anti-inflammatory target of liver X receptor in macrophages. J. Biol. Chem. 2006, 281, 32197–32206. [Google Scholar] [CrossRef]
- Gallardo-Soler, A.; Gómez-Nieto, C.; Campo, M.L.; Marathe, C.; Tontonoz, P.; Castrillo, A.; Corraliza, I. Arginase I induction by modified lipoproteins in macrophages: A peroxisome proliferator-activated receptor-γ/δ-mediated effect that links lipid metabolism and immunity. Mol. Endocrinol. 2008, 22, 1394–1402. [Google Scholar] [CrossRef]
- Silva-Jardim, I.; Thiemann, O.H.; Anibal, F.F. Leishmaniasis and Chagas disease chemotherapy: A critical review. J. Braz. Chem. Soc. 2014, 25, 1810–1823. [Google Scholar] [CrossRef]
- McConville, M.J.; Naderer, T. Metabolic pathways required for the intracellular survival of Leishmania. Annu. Rev. Microbiol. 2011, 6, 543–561. [Google Scholar] [CrossRef]
- Ortiz, D.; Sanchez, M.A.; Pierce, S.; Herrmann, T.; Kimblin, N.; Archie Bouwer, H.; Landfear, S.M. Molecular genetic analysis of purine nucleobase transport in Leishmania major. Mol. Microbiol. 2007, 64, 1228–1243. [Google Scholar] [CrossRef]
- Figueroa-Villar, J.D.; Sales, E.M. The importance of nucleoside hydrolase enzyme (NH) in studies to treatment of Leishmania: A review. Chem-Biol. Interact. 2017, 263, 18–27. [Google Scholar] [CrossRef]
- Majumder, H.K. Drug Targets in Kinetoplastid Parasites; Springer Science & Business Media: Berlin/Heidelberg, Germany, 2008; Volume 625. [Google Scholar]
- Berg, M.; Van der Veken, P.; Goeminne, A.; Haemers, A.; Augustyns, K. Inhibitors of the purine salvage pathway: A valuable approach for antiprotozoal chemotherapy? Curr. Med. Chem. 2010, 17, 2456–2481. [Google Scholar] [CrossRef]
- Ilgoutz, S.C.; Zawadzki, J.L.; Ralton, J.E.; McConville, M.J. Evidence that free GPI glycolipids are essential for growth of Leishmania mexicana. EMBO J. 1999, 18, 2746–2755. [Google Scholar] [CrossRef] [PubMed]
- Menon, A.K.; Mayor, S.; Schwarz, R.T. Biosynthesis of glycosyl-phosphatidylinositol lipids in Trypanosoma brucei: Involvement of mannosyl-phosphoryldolichol as the mannose donor. EMBO J. 1990, 9, 4249–4258. [Google Scholar] [CrossRef] [PubMed]
- Horn, D. Antigenic variation in African trypanosomes. Mol. Biochem. Parasitol. 2014, 195, 123–129. [Google Scholar] [CrossRef] [PubMed]
- Alves, M.J.M.; Colli, W. Role of the gp85/trans-sialidase superfamily of glycoproteins in the interaction of Trypanosoma cruzi with host structures. Mol. Mech. Parasite Invasion Subcell. Biochem. 2008, 47, 58–69. [Google Scholar]
- Giorgi, M.E.; Lederkremer, R.M.d. The glycan structure of T. cruzi mucins depends on the host. Insights on the chameleonic galactose. Molecules 2020, 25, 3913. [Google Scholar] [CrossRef]
- Barreto de Albuquerque, J.; Silva dos Santos, D.; Stein, J.V.; de Meis, J. Oral versus intragastric inoculation: Similar Pathways of Trypanosoma cruzi Experimental infection? From target tissues, parasite evasion, and immune response. Front. Immunol. 2018, 9, 1734. [Google Scholar] [CrossRef]
- Vickers, T.J.; Beverley, S.M. Folate metabolic pathways in Leishmania. Essays Biochem. 2011, 51, 63–80. [Google Scholar]
- Shulpekova, Y.; Nechaev, V.; Kardasheva, S.; Sedova, A.; Kurbatova, A.; Bueverova, E.; Kopylov, A.; Malsagova, K.; Dlamini, J.C.; Ivashkin, V. The concept of folic acid in health and disease. Molecules 2021, 26, 3731. [Google Scholar] [CrossRef]
- Beltran-Hortelano, I.; Alcolea, V.; Font, M.; Pérez-Silanes, S. Examination of multiple Trypanosoma cruzi targets in a new drug discovery approach for Chagas disease. Bioorganic Med. Chem. 2022, 58, 116577. [Google Scholar] [CrossRef]
- Robello, C.; Navarro, P.; Castanys, S.; Gamarro, F. A pteridine reductase gene ptr1 contiguous to a P-glycoprotein confers resistance to antifolates in Trypanosoma cruzi. Mol. Biochem. Parasitol. 1997, 90, 525–535. [Google Scholar] [CrossRef]
- Bello, A.R.; Nare, B.; Freedman, D.; Hardy, L.; Beverley, S.M. PTR1: A reductase mediating salvage of oxidized pteridines and methotrexate resistance in the protozoan parasite Leishmania major. Proc. Natl. Acad. Sci. USA 1994, 91, 11442–11446. [Google Scholar] [CrossRef]
- Krauth-Siegel, R.L.; Comini, M.A. Redox control in trypanosomatids, parasitic protozoa with trypanothione-based thiol metabolism. Biochim. Biophys. Acta (BBA)-Gen. Subj. 2008, 1780, 1236–1248. [Google Scholar] [CrossRef]
- Colotti, G.; Ilari, A. Polyamine metabolism in Leishmania: From arginine to trypanothione. Amino Acids 2011, 40, 269–285. [Google Scholar] [CrossRef]
- Bailey, S.; Smith, K.; Fairlamb, A.H.; Hunter, W.N. Substrate interactions between trypanothione reductase and N1-glutathionylspermidine disulphide at 0.28-nm resolution. Eur. J. Biochem. 1993, 213, 67–75. [Google Scholar] [CrossRef]
- Saitoh, M.; Nishitoh, H.; Fujii, M.; Takeda, K.; Tobiume, K.; Sawada, Y.; Kawabata, M.; Miyazono, K.; Ichijo, H. Mammalian thioredoxin is a direct inhibitor of apoptosis signal-regulating kinase (ASK) 1. EMBO J. 1998, 17, 2596–2606. [Google Scholar] [CrossRef]
- Manta, B.; Comini, M.; Medeiros, A.; Hugo, M.; Trujillo, M.; Radi, R. Trypanothione: A unique bis-glutathionyl derivative in trypanosomatids. Biochim. Biophys. Acta (BBA)-Gen. Subj. 2013, 1830, 3199–3216. [Google Scholar] [CrossRef] [PubMed]
- Jain, S.; Sahu, U.; Kumar, A.; Khare, P. Metabolic pathways of Leishmania parasite: Source of pertinent drug targets and potent drug candidates. Pharmaceutics 2022, 14, 1590. [Google Scholar] [CrossRef] [PubMed]
- Moreira, D.d.S.; Duarte, A.P.; Pais, F.S.M.; Silva-Pereira, R.A.d.; Romanha, A.J.; Schenkman, S.; Murta, S.M.F. Overexpression of eukaryotic initiation factor 5A (eIF5A) affects susceptibility to benznidazole in Trypanosoma cruzi populations. Memórias Inst. Oswaldo Cruz 2018, 113, e180162. [Google Scholar] [CrossRef] [PubMed]
- Nakanishi, S.; Cleveland, J.L. Targeting the polyamine-hypusine circuit for the prevention and treatment of cancer. Amino Acids 2016, 48, 2353–2362. [Google Scholar] [CrossRef] [PubMed]
- Goldman-Pinkovich, A.; Balno, C.; Strasser, R.; Zeituni-Molad, M.; Bendelak, K.; Rentsch, D.; Ephros, M.; Wiese, M.; Jardim, A.; Myler, P.J. An arginine deprivation response pathway is induced in Leishmania during macrophage invasion. PLoS Pathog. 2016, 12, e1005494. [Google Scholar] [CrossRef] [PubMed]
- da Silva, M.F.L.; Floeter-Winter, L.M. Arginase in leishmania. Proteins Proteom. Leishmania Trypanos. 2013, 74, 103–117. [Google Scholar]
- Darlyuk, I.; Goldman, A.; Roberts, S.C.; Ullman, B.; Rentsch, D.; Zilberstein, D. Arginine homeostasis and transport in the human pathogen Leishmania donovani. J. Biol. Chem. 2009, 284, 19800–19807. [Google Scholar] [CrossRef] [PubMed]
- Maddison, J.E.; Page, S.W.; Church, D.B. Small Animal Clinical Pharmacology; Elsevier Health Sciences: Amsterdam, The Netherlands, 2008; Volume 5. [Google Scholar]
- Marchal, B.; Van Dormael, M.; Pirard, M.; Cavalli, A.; Kegels, G.; Polman, K. Neglected tropical disease (NTD) control in health systems: The interface between programmes and general health services. Acta Trop. 2011, 120, S177–S185. [Google Scholar] [CrossRef] [PubMed]
- Moffat, J.G.; Vincent, F.; Lee, J.A.; Eder, J.; Prunotto, M. Opportunities and challenges in phenotypic drug discovery: An industry perspective. Nat. Rev. Drug Discov. 2017, 16, 531–543. [Google Scholar] [CrossRef] [PubMed]
- Myler, P.J. Searching the Tritryp genomes for drug targets. Drug Targets Kinetoplastid Parasites 2008, 625, 133–140. [Google Scholar]
- Paradela, L.S.; Wall, R.J.; Carvalho, S.; Chemi, G.; Corpas-Lopez, V.; Moynihan, E.; Bello, D.; Patterson, S.; Güther, M.L.S.; Fairlamb, A.H. Multiple unbiased approaches identify oxidosqualene cyclase as the molecular target of a promising anti-leishmanial. Cell Chem. Biol. 2021, 28, 711–721.e8. [Google Scholar] [CrossRef] [PubMed]
- D’Souza, S.; Prema, K.; Balaji, S. Machine learning models for drug–target interactions: Current knowledge and future directions. Drug Discov. Today 2020, 25, 748–756. [Google Scholar] [CrossRef] [PubMed]
- DiMasi, J.A.; Grabowski, H.G.; Hansen, R.W. Innovation in the pharmaceutical industry: New estimates of R&D costs. J. Health Econ. 2016, 47, 20–33. [Google Scholar] [PubMed]
- Thomas, D.W. Clinical development success rates 2006–2015. BIO Ind. Anal. 2016, 1, 16. [Google Scholar]
- Surade, S.; Blundell, T.L. Structural biology and drug discovery of difficult targets: The limits of ligandability. Chem. Biol. 2012, 19, 42–50. [Google Scholar] [CrossRef]
- Gamo, F.-J.; Sanz, L.M.; Vidal, J.; De Cozar, C.; Alvarez, E.; Lavandera, J.-L.; Vanderwall, D.E.; Green, D.V.; Kumar, V.; Hasan, S. Thousands of chemical starting points for antimalarial lead identification. Nature 2010, 465, 305–310. [Google Scholar] [CrossRef]
- Don, R.; Ioset, J.-R. Screening strategies to identify new chemical diversity for drug development to treat kinetoplastid infections. Parasitology 2014, 141, 140–146. [Google Scholar] [CrossRef]
- Guiguemde, W.A.; Shelat, A.A.; Bouck, D.; Duffy, S.; Crowther, G.J.; Davis, P.H.; Smithson, D.C.; Connelly, M.; Clark, J.; Zhu, F. Chemical genetics of Plasmodium falciparum. Nature 2010, 465, 311–315. [Google Scholar] [CrossRef]
- De Rycker, M.; Wyllie, S.; Horn, D.; Read, K.D.; Gilbert, I.H. Anti-trypanosomatid drug discovery: Progress and challenges. Nat. Rev. Microbiol. 2023, 21, 35–50. [Google Scholar] [CrossRef]
- Martínez-Peinado, N.; Cortes-Serra, N.; Losada-Galvan, I.; Alonso-Vega, C.; Urbina, J.A.; Rodríguez, A.; VandeBerg, J.L.; Pinazo, M.-J.; Gascon, J.; Alonso-Padilla, J. Emerging agents for the treatment of Chagas disease: What is in the preclinical and clinical development pipeline? Expert. Opin. Investig. Drugs 2020, 29, 947–959. [Google Scholar] [CrossRef]
- Mansoldo, F.R.P.; Carta, F.; Angeli, A.; Cardoso, V.d.S.; Supuran, C.T.; Vermelho, A.B. Chagas disease: Perspectives on the past and present and challenges in drug discovery. Molecules 2020, 25, 5483. [Google Scholar] [CrossRef] [PubMed]
- Francisco, E.C.; de Almeida Junior, J.N.; Queiroz-Telles, F.; Aquino, V.R.; Mendes, A.V.A.; de Oliveira Silva, M.; Castro, P.d.T.O.e.; Guimarães, T.; Ponzio, V.; Hahn, R.C. Correlation of Trichosporon asahii genotypes with anatomical sites and antifungal susceptibility profiles: Data analyses from 284 isolates collected in the last 22 years across 24 medical centers. Antimicrob. Agents Chemother. 2021, 65, 10-1128. [Google Scholar] [CrossRef] [PubMed]
- Schiavuzzo, J.; Teixeira, J.; Melo, B.; Dos Santos, D.d.S.; Jorge, C.; Oliveira-Fusaro, M.; Parada, C. Muscle hyperalgesia induced by peripheral P2X3 receptors is modulated by inflammatory mediators. Neuroscience 2015, 285, 24–33. [Google Scholar] [CrossRef] [PubMed]
- Mackey, T.K.; Liang, B.A.; Cuomo, R.; Hafen, R.; Brouwer, K.C.; Lee, D.E. Emerging and reemerging neglected tropical diseases: A review of key characteristics, risk factors, and the policy and innovation environment. Clin. Microbiol. Rev. 2014, 27, 949–979. [Google Scholar] [CrossRef] [PubMed]
- Pacheco, P.A.; Santos, M.M. Recent progress in the development of indole-based compounds active against malaria, trypanosomiasis and leishmaniasis. Molecules 2022, 27, 319. [Google Scholar] [CrossRef] [PubMed]
- Reimão, J.Q.; Scotti, M.T.; Tempone, A.G. Anti-leishmanial and anti-trypanosomal activities of 1, 4-dihydropyridines: In vitro evaluation and structure–activity relationship study. Bioorganic Med. Chem. 2010, 18, 8044–8053. [Google Scholar] [CrossRef]
- Seo, Y.J.; Shin, H.; Lee, H.W.; Jung, H.R. Causes of necrotic features in fine-needle aspirates from cervical lymph nodes. J. Pathol. Transl. Med. 2021, 55, 60–67. [Google Scholar] [CrossRef]
- Yadav, C.L.; Manar, K.K.; Yadav, M.K.; Tiwari, N.; Singh, R.K.; Drew, M.G.; Singh, N. Synthesis, crystal structures and properties of new homoleptic Ni (II)/Pd (II) β-oxodithioester chelates. J. Mol. Struct. 2018, 1160, 488–496. [Google Scholar] [CrossRef]
- Sahu, A.; Kumar, D.; Agrawal, R.K. Antileishmanial drug discovery: Synthetic methods, chemical characteristics, and biological potential of quinazolines and its derivatives. Anti-Inflamm. Anti-Allergy Agents Med. Chem. (Former. Curr. Med. Chem-Anti-Inflamm. Anti-Allergy Agents) 2017, 16, 3–32. [Google Scholar] [CrossRef]
- Charlton, R.L.; Rossi-Bergmann, B.; Denny, P.W.; Steel, P.G. Repurposing as a strategy for the discovery of new anti-leishmanials: The-state-of-the-art. Parasitology 2018, 145, 219–236. [Google Scholar] [CrossRef] [PubMed]
- Reguera, R.M.; Pérez-Pertejo, Y.; Gutiérrez-Corbo, C.; Domínguez-Asenjo, B.; Ordóñez, C.; García-Estrada, C.; Martínez-Valladares, M.; Balaña-Fouce, R. Current and promising novel drug candidates against visceral leishmaniasis. Pure Appl. Chem. 2019, 91, 1385–1404. [Google Scholar] [CrossRef]
- Sundar, S.; Chakravarty, J. Investigational drugs for visceral leishmaniasis. Expert. Opin. Investig. Drugs 2015, 24, 43–59. [Google Scholar] [CrossRef] [PubMed]
- dos Santos Nogueira, F.; Avino, V.C.; Galvis-Ovallos, F.; Pereira-Chioccola, V.L.; Moreira, M.A.B.; Romariz, A.P.P.L.; Molla, L.M.; Menz, I. Use of miltefosine to treat canine visceral leishmaniasis caused by Leishmania infantum in Brazil. Parasites Vectors 2019, 12, 79. [Google Scholar] [CrossRef] [PubMed]
- Pinto-Martinez, A.K.; Rodriguez-Durán, J.; Serrano-Martin, X.; Hernandez-Rodriguez, V.; Benaim, G. Mechanism of action of miltefosine on Leishmania donovani involves the impairment of acidocalcisome function and the activation of the sphingosine-dependent plasma membrane Ca2+ channel. Antimicrob. Agents Chemother. 2018, 62, 10-1128. [Google Scholar] [CrossRef] [PubMed]
- Ponte-Sucre, A.; Gamarro, F.; Dujardin, J.-C.; Barrett, M.P.; López-Vélez, R.; García-Hernández, R.; Pountain, A.W.; Mwenechanya, R.; Papadopoulou, B. Drug resistance and treatment failure in leishmaniasis: A 21st century challenge. PLoS Neglected Trop. Dis. 2017, 11, e0006052. [Google Scholar] [CrossRef]
- Autmizguine, J.; Guptill, J.T.; Cohen-Wolkowiez, M.; Benjamin Jr, D.K.; Capparelli, E.V. Pharmacokinetics and pharmacodynamics of antifungals in children: Clinical implications. Drugs 2014, 74, 891–909. [Google Scholar] [CrossRef]
- Nagle, A.S.; Khare, S.; Kumar, A.B.; Supek, F.; Buchynskyy, A.; Mathison, C.J.; Chennamaneni, N.K.; Pendem, N.; Buckner, F.S.; Gelb, M.H. Recent developments in drug discovery for leishmaniasis and human African trypanosomiasis. Chem. Rev. 2014, 114, 11305–11347. [Google Scholar] [CrossRef]
- Singh, S.K.; Patwa, D.K.; Tilak, R.; Das, A.; Singh, T.B. In vitro susceptibility of dermatophytes to oral antifungal drugs and amphotericin B in Uttar Pradesh, India. Indian J. Dermatol. Venereol. Leprol. 2019, 85, 388. [Google Scholar] [CrossRef]
- Taslimi, Y.; Zahedifard, F.; Rafati, S. Leishmaniasis and various immunotherapeutic approaches. Parasitology 2018, 145, 497–507. [Google Scholar] [CrossRef] [PubMed]
- Goto, H.; Lindoso, J.A.L. Current diagnosis and treatment of cutaneous and mucocutaneous leishmaniasis. Expert. Rev. Anti-Infect. Ther. 2010, 8, 419–433. [Google Scholar] [CrossRef]
- Mansuri, R.; Singh, J.; Diwan, A. An insight into the current perspective and potential drug targets for visceral leishmaniasis (VL). Curr. Drug Targets 2020, 21, 1105–1129. [Google Scholar] [CrossRef]
- Jha, S.; Singh, N.; Jha, T. Changing response to diamidine compounds in cases of kala-azar unresponsive to antimonial. J. Assoc. Physicians India 1991, 39, 314–316. [Google Scholar] [PubMed]
- Bray, P.G.; Barrett, M.P.; Ward, S.A.; de Koning, H.P. Pentamidine uptake and resistance in pathogenic protozoa: Past, present and future. Trends Parasitol. 2003, 19, 232–239. [Google Scholar] [CrossRef]
- Coelho, A.C.; Beverley, S.M.; Cotrim, P.C. Functional genetic identification of PRP1, an ABC transporter superfamily member conferring pentamidine resistance in Leishmania major. Mol. Biochem. Parasitol. 2003, 130, 83–90. [Google Scholar] [CrossRef]
- Morillo, C.A.; Marin-Neto, J.A.; Avezum, A.; Sosa-Estani, S.; Rassi Jr, A.; Rosas, F.; Villena, E.; Quiroz, R.; Bonilla, R.; Britto, C. Randomized trial of benznidazole for chronic Chagas’ cardiomyopathy. N. Engl. J. Med. 2015, 373, 1295–1306. [Google Scholar] [CrossRef] [PubMed]
- Junior, P.A.S.; Molina, I.; Murta, S.M.F.; Sánchez-Montalvá, A.; Salvador, F.; Corrêa-Oliveira, R.; Carneiro, C.M. Experimental and clinical treatment of Chagas disease: A review. Am. J. Trop. Med. Hyg. 2017, 97, 1289. [Google Scholar] [CrossRef]
- Caldas, I.S.; Santos, E.G.; Novaes, R.D. An evaluation of benznidazole as a Chagas disease therapeutic. Expert. Opin. Pharmacother. 2019, 20, 1797–1807. [Google Scholar] [CrossRef]
- Patterson, S.; Wyllie, S. Nitro drugs for the treatment of trypanosomatid diseases: Past, present, and future prospects. Trends Parasitol. 2014, 30, 289–298. [Google Scholar] [CrossRef]
- Chatelain, E.; Scandale, I. Animal models of Chagas disease and their translational value to drug development. Expert Opin. Drug Discov. 2020, 15, 1381–1402. [Google Scholar] [CrossRef]
- Vermelho, A.B.; Rodrigues, G.C.; Supuran, C.T. Why hasn’t there been more progress in new Chagas disease drug discovery? Expert Opin. Drug Discov. 2020, 15, 145–158. [Google Scholar] [CrossRef]
- Wilkinson, S.R.; Taylor, M.C.; Horn, D.; Kelly, J.M.; Cheeseman, I. A mechanism for cross-resistance to nifurtimox and benznidazole in trypanosomes. Proc. Natl. Acad. Sci. USA 2008, 105, 5022–5027. [Google Scholar] [CrossRef] [PubMed]
- Woster, P. Antiprotozoal Agents (African Trypanosomiasis, Chagas Disease, and Leishmaniasis); Elsevier: Amsterdam, The Netherlands, 2007. [Google Scholar]
- Bhattacharya, S.; Sur, D.; Karbwang, J. Childhood visceral leishmaniasis. Indian J. Med. Res. 2006, 123, 353. [Google Scholar] [PubMed]
- Sundar, S.; Singh, A. Chemotherapeutics of visceral leishmaniasis: Present and future developments. Parasitology 2018, 145, 481–489. [Google Scholar] [CrossRef] [PubMed]
- Dorlo, T.P.; Kip, A.E.; Younis, B.M.; Ellis, S.J.; Alves, F.; Beijnen, J.H.; Njenga, S.; Kirigi, G.; Hailu, A.; Olobo, J. Visceral leishmaniasis relapse hazard is linked to reduced miltefosine exposure in patients from Eastern Africa: A population pharmacokinetic/pharmacodynamic study. J. Antimicrob. Chemother. 2017, 72, 3131–3140. [Google Scholar] [CrossRef] [PubMed]
- Mbui, J.; Olobo, J.; Omollo, R.; Solomos, A.; Kip, A.E.; Kirigi, G.; Sagaki, P.; Kimutai, R.; Were, L.; Omollo, T. Pharmacokinetics, safety, and efficacy of an allometric miltefosine regimen for the treatment of visceral leishmaniasis in Eastern African children: An open-label, phase II clinical trial. Clin. Infect. Dis. 2019, 68, 1530–1538. [Google Scholar] [CrossRef] [PubMed]
- Musa, A.M.; Younis, B.; Fadlalla, A.; Royce, C.; Balasegaram, M.; Wasunna, M.; Hailu, A.; Edwards, T.; Omollo, R.; Mudawi, M. Paromomycin for the treatment of visceral leishmaniasis in Sudan: A randomized, open-label, dose-finding study. PLoS Neglected Trop. Dis. 2010, 4, e855. [Google Scholar] [CrossRef] [PubMed]
- Jamil, K.M.; Haque, R.; Rahman, R.; Faiz, M.A.; Bhuiyan, A.T.M.R.H.; Kumar, A.; Hassan, S.M.; Kelly, H.; Dhalaria, P.; Kochhar, S. Effectiveness study of paromomycin IM injection (PMIM) for the treatment of visceral leishmaniasis (VL) in Bangladesh. PLoS Neglected Trop. Dis. 2015, 9, e0004118. [Google Scholar] [CrossRef] [PubMed]
- Jhingran, A.; Chawla, B.; Saxena, S.; Barrett, M.P.; Madhubala, R. Paromomycin: Uptake and resistance in Leishmania donovani. Mol. Biochem. Parasitol. 2009, 164, 111–117. [Google Scholar] [CrossRef] [PubMed]
- Diro, E.; Ritmeijer, K.; Boelaert, M.; Alves, F.; Mohammed, R.; Abongomera, C.; Ravinetto, R.; De Crop, M.; Fikre, H.; Adera, C. Long-term clinical outcomes in visceral leishmaniasis-HIV co-infected patients during and after pentamidine secondary prophylaxis in Ethiopia: A single-arm clinical trial Authors and affiliations. Clin. Infect. Dis. 2017, 66, 444–451. [Google Scholar] [CrossRef] [PubMed]
- Rahman, A.-E.; Mabrouk, R. The Impact of First-line Nurse Managers Leadership Development Training Program on Workgroup Climate and Performance. Doctoral Dissertation, University of Alexandria, Alexandria, Egypt, 2017. [Google Scholar]
- Balasegaram, M.; Ritmeijer, K.; Lima, M.A.; Burza, S.; Ortiz Genovese, G.; Milani, B.; Gaspani, S.; Potet, J.; Chappuis, F. Liposomal amphotericin B as a treatment for human leishmaniasis. Expert Opin. Emerg. Drugs 2012, 17, 493–510. [Google Scholar] [CrossRef] [PubMed]
- Deray, G. Amphotericin B nephrotoxicity. J. Antimicrob. Chemother. 2002, 49, 37–41. [Google Scholar] [CrossRef] [PubMed]
- Burza, S.; Croft, S.; Boelaert, M. Leishmaniasis. Lancet 2018, 392, 951–970. [Google Scholar] [CrossRef]
- Sundar, S.; Chakravarty, J. Antimony toxicity. Int. J. Environ. Res. Public Health 2010, 7, 4267–4277. [Google Scholar] [CrossRef]
- Arce, A.; Estirado, A.; Ordobas, M.; Sevilla, S.; García, N.; Moratilla, L.; De La Fuente, S.; Martínez, A.; Pérez, A.; Aránguez, E. Re-emergence of leishmaniasis in Spain: Community outbreak in Madrid, Spain, 2009 to 2012. Eurosurveillance 2013, 18, 20546. [Google Scholar] [CrossRef]
- Sundar, S.; Chakravarty, J.; Agarwal, D.; Rai, M.; Murray, H.W. Single-dose liposomal amphotericin B for visceral leishmaniasis in India. N. Engl. J. Med. 2010, 362, 504–512. [Google Scholar] [CrossRef]
- Pereira, I.R.; Vilar-Pereira, G.; Silva, A.A.d.; Lannes-Vieira, J. Severity of chronic experimental Chagas’ heart disease parallels tumour necrosis factor and nitric oxide levels in the serum: Models of mild and severe disease. Memórias Inst. Oswaldo Cruz 2014, 109, 289–298. [Google Scholar] [CrossRef]
- Molina, I.; Gómez i Prat, J.; Salvador, F.; Treviño, B.; Sulleiro, E.; Serre, N.; Pou, D.; Roure, S.; Cabezos, J.; Valerio, L. Randomized trial of posaconazole and benznidazole for chronic Chagas’ disease. N. Engl. J. Med. 2014, 370, 1899–1908. [Google Scholar] [CrossRef] [PubMed]
- Lima, Á.A.; Soares-Sobrinho, J.L.; Silva, J.L.; Corrêa-Júnior, R.A.; Lyra, M.A.; Santos, F.L.; Oliveira, B.G.; Hernandes, M.Z.; Rolim, L.A.; Rolim-Neto, P.J. The use of solid dispersion systems in hydrophilic carriers to increase benznidazole solubility. J. Pharm. Sci. 2011, 100, 2443–2451. [Google Scholar] [CrossRef]
- World Health Organization. Sustaining the Drive to Overcome the Global Impact of Neglected Tropical Diseases: Second WHO Report on Neglected Diseases; World Health Organization: Geneva, Switzerland, 2013. [Google Scholar]
- de Mecca, M.M.; Fanelli, S.L.; Bartel, L.C.; de Castro, C.R.; Díaz, E.G.; Castro, J.A. Nifurtimox nitroreductase activity in different cellular fractions from male rat pancreas. Biochemical and ultrastructural alterations. Life Sci. 2007, 81, 144–152. [Google Scholar] [CrossRef] [PubMed]
- Mecca, M.M.d.; Bartel, L.C.; Castro, C.R.d.; Castro, J.A. Benznidazole biotransformation in rat heart microsomal fraction without observable ultrastructural alterations: Comparison to Nifurtimox-induced cardiac effects. Mem. Inst. Oswaldo Cruz 2008, 103, 549–553. [Google Scholar] [CrossRef]
- Altamura, F.; Rajesh, R.; Catta-Preta, C.M.; Moretti, N.S.; Cestari, I. The current drug discovery landscape for trypanosomiasis and leishmaniasis: Challenges and strategies to identify drug targets. Drug Dev. Res. 2022, 83, 225–252. [Google Scholar] [CrossRef] [PubMed]
- Chanda, K. An overview on the therapeutics of neglected infectious diseases—Leishmaniasis and Chagas diseases. Front. Chem. 2021, 9, 622286. [Google Scholar]
- Santos, S.S.; de Araújo, R.V.; Giarolla, J.; El Seoud, O.; Ferreira, E.I. Searching for drugs for Chagas disease, leishmaniasis and schistosomiasis: A review. Int. J. Antimicrob. Agents 2020, 55, 105906. [Google Scholar] [CrossRef]
- Fairlamb, A.H.; Wyllie, S. The critical role of mode of action studies in kinetoplastid drug discovery. Front. Drug Discov. 2023, 3, 1185679. [Google Scholar] [CrossRef] [PubMed]
- Bhargava, P.; Singh, R. Developments in diagnosis and antileishmanial drugs. Interdiscip. Perspect. Infect. Dis. 2012, 2012, 626838. [Google Scholar] [CrossRef]
- Alcântara, L.M.; Ferreira, T.C.; Gadelha, F.R.; Miguel, D.C. Challenges in drug discovery targeting TriTryp diseases with an emphasis on leishmaniasis. Int. J. Parasitol. Drugs Drug Resist. 2018, 8, 430–439. [Google Scholar] [CrossRef] [PubMed]
- Roatt, B.M.; de Oliveira Cardoso, J.M.; De Brito, R.C.F.; Coura-Vital, W.; de Oliveira Aguiar-Soares, R.D.; Reis, A.B. Recent advances and new strategies on leishmaniasis treatment. Appl. Microbiol. Biotechnol. 2020, 104, 8965–8977. [Google Scholar] [CrossRef] [PubMed]
- Zahid, M.S.H.; Johnson, M.M.; Tokarski II, R.J.; Satoskar, A.R.; Fuchs, J.R.; Bachelder, E.M.; Ainslie, K.M. Evaluation of synergy between host and pathogen-directed therapies against intracellular Leishmania donovani. Int. J. Parasitol. Drugs Drug Resist. 2019, 10, 125–132. [Google Scholar] [CrossRef] [PubMed]
- Novais, F.O.; Amorim, C.F.; Scott, P. Host-Directed Therapies for Cutaneous Leishmaniasis. Front. Immunol. 2021, 12, 660183. [Google Scholar] [CrossRef]
- Kumari, D.; Perveen, S.; Sharma, R.; Singh, K. Advancement in leishmaniasis diagnosis and therapeutics: An update. Eur. J. Pharmacol. 2021, 910, 174436. [Google Scholar] [CrossRef]
- Rassi, A., Jr.; Rassi, A.; Marin-Neto, J.A. Chagas disease. Lancet 2010, 375, 1388–1402. [Google Scholar] [CrossRef]
- Pérez-Molina, J.A.; Molina, I. Chagas disease. Lancet 2018, 391, 82–94. [Google Scholar] [CrossRef]
- Parihar, S.P.; Hartley, M.-A.; Hurdayal, R.; Guler, R.; Brombacher, F. Topical simvastatin as host-directed therapy against severity of cutaneous leishmaniasis in mice. Sci. Rep. 2016, 6, 33458. [Google Scholar] [CrossRef]
- Kumar, P.; Shivam, P.; Mandal, S.; Prasanna, P.; Kumar, S.; Prasad, S.R.; Kumar, A.; Das, P.; Ali, V.; Singh, S.K. Synthesis, characterization, and mechanistic studies of a gold nanoparticle–amphotericin B covalent conjugate with enhanced antileishmanial efficacy and reduced cytotoxicity. Int. J. Nanomed. 2019, 14, 6073. [Google Scholar] [CrossRef]
- Raja, M.R.C.; Velappan, A.B.; Chellappan, D.; Debnath, J.; Mahapatra, S.K. Eugenol derived immunomodulatory molecules against visceral leishmaniasis. Eur. J. Med. Chem. 2017, 139, 503–518. [Google Scholar] [CrossRef]
- Fernández, O.L.; Rosales-Chilama, M.; Quintero, N.; Travi, B.L.; Wetzel, D.M.; Gómez, M.A.; Saravia, N.G. Potency and preclinical evidence of synergy of oral azole drugs and miltefosine in an ex vivo model of Leishmania (Viannia) panamensis infection. Antimicrob. Agents Chemother. 2022, 66, e01425-21. [Google Scholar] [CrossRef]
- Vishwakarma, P.; Parmar, N.; Chandrakar, P.; Sharma, T.; Kathuria, M.; Agnihotri, P.K.; Siddiqi, M.I.; Mitra, K.; Kar, S. Ammonium trichloro [1, 2-ethanediolato-O, O′]-tellurate cures experimental visceral leishmaniasis by redox modulation of Leishmania donovani trypanothione reductase and inhibiting host integrin linked PI3K/Akt pathway. Cell. Mol. Life Sci. 2018, 75, 563–588. [Google Scholar] [CrossRef]
- Kyriazis, I.D.; Koutsoni, O.S.; Aligiannis, N.; Karampetsou, K.; Skaltsounis, A.-L.; Dotsika, E. The leishmanicidal activity of oleuropein is selectively regulated through inflammation-and oxidative stress-related genes. Parasites Vectors 2016, 9, 441. [Google Scholar] [CrossRef] [PubMed]
- Kyriazis, I.; Smirlis, D.; Papadaki, A.; Koutsoni, O.; Aligiannis, N.; Skaltsounis, A.; Dotsika, E. Leishmanicidal activity of oleuropein: Leishmania donovani promastigote cell death through a possibly ROS-independent mechanism. J. Pharmacogn. Nat. Prod. 2017, 3, 141. [Google Scholar] [CrossRef]
- Dayakar, A.; Chandrasekaran, S.; Veronica, J.; Maurya, R. Leptin induces the phagocytosis and protective immune response in Leishmania donovani infected THP-1 cell line and human PBMCs. Exp. Parasitol. 2016, 160, 54–59. [Google Scholar] [CrossRef]
- Roy, A. A review on the alkaloids an important therapeutic compound from plants. IJPB 2017, 3, 1–9. [Google Scholar]
- Roy, S.; Saha, S.; Gupta, P.; Ukil, A.; Das, P.K. Crosstalk of PD-1 signaling with the SIRT1/FOXO-1 axis during the progression of visceral leishmaniasis. J. Cell Sci. 2019, 132, jcs226274. [Google Scholar] [CrossRef] [PubMed]
- Raja, M.R.C.; Kar, A.; Srinivasan, S.; Chellappan, D.; Debnath, J.; Mahapatra, S.K. Oral administration of eugenol oleate cures experimental visceral leishmaniasis through cytokines abundance. Cytokine 2021, 145, 155301. [Google Scholar] [CrossRef] [PubMed]
- Raj, S.; Saha, G.; Sasidharan, S.; Dubey, V.K.; Saudagar, P. Biochemical characterization and chemical validation of Leishmania MAP Kinase-3 as a potential drug target. Sci. Rep. 2019, 9, 16209. [Google Scholar] [CrossRef] [PubMed]
- Merida-de-Barros, D.A.; Chaves, S.P.; Belmiro, C.L.R.; Wanderley, J.L.M. Leishmaniasis and glycosaminoglycans: A future therapeutic strategy? Parasites Vectors 2018, 11, 536. [Google Scholar] [CrossRef] [PubMed]
- Tindana, P.; de Haan, F.; Amaratunga, C.; Dhorda, M.; van der Pluijm, R.W.; Dondorp, A.M.; Cheah, P.Y. Deploying triple artemisinin-based combination therapy (TACT) for malaria treatment in Africa: Ethical and practical considerations. Malar. J. 2021, 20, 119. [Google Scholar] [CrossRef]
- Larkins-Ford, J.; Greenstein, T.; Van, N.; Degefu, Y.N.; Olson, M.C.; Sokolov, A.; Aldridge, B.B. Systematic measurement of combination-drug landscapes to predict in vivo treatment outcomes for tuberculosis. Cell Syst. 2021, 12, 1046–1063.e1047. [Google Scholar] [CrossRef]
- Pushpakom, S.; Iorio, F.; Eyers, P.A.; Escott, K.J.; Hopper, S.; Wells, A.; Doig, A.; Guilliams, T.; Latimer, J.; McNamee, C. Drug repurposing: Progress, challenges and recommendations. Nat. Rev. Drug Discov. 2019, 18, 41–58. [Google Scholar] [CrossRef]
- Breckenridge, A.; Jacob, R. Overcoming the legal and regulatory barriers to drug repurposing. Nat. Rev. Drug Discov. 2019, 18, 1–2. [Google Scholar] [CrossRef]
- Braga, S.S. Multi-target drugs active against leishmaniasis: A paradigm of drug repurposing. Eur. J. Med. Chem. 2019, 183, 111660. [Google Scholar] [CrossRef]
- Andrade, C.H.; Neves, B.J.; Melo-Filho, C.C.; Rodrigues, J.; Silva, D.C.; Braga, R.C.; Cravo, P.V. In silico chemogenomics drug repositioning strategies for neglected tropical diseases. Curr. Med. Chem. 2019, 26, 4355–4379. [Google Scholar] [CrossRef] [PubMed]
- de Oliveira, E.A.M.; Lang, K.L. Drug repositioning: Concept, classification, methodology, and importance in rare/orphans and neglected diseases. J. Appl. Pharm. Sci. 2018, 8, 157–165. [Google Scholar]
- Lima, I.D.; Lima, A.L.; Mendes-Aguiar, C.d.O.; Coutinho, J.F.; Wilson, M.E.; Pearson, R.D.; Queiroz, J.W.; Jeronimo, S.M. Changing demographics of visceral leishmaniasis in northeast Brazil: Lessons for the future. PLoS Neglected Trop. Dis. 2018, 12, e0006164. [Google Scholar] [CrossRef] [PubMed]
- Lima, M.P.; Costa, L.E.; Lage, D.P.; Dias, D.S.; Ribeiro, P.A.; Machado, A.S.; Ramos, F.F.; Salles, B.C.; Fagundes, M.I.; Carvalho, G.B. Diagnostic application of recombinant Leishmania proteins and evaluation of their in vitro immunogenicity after stimulation of immune cells collected from tegumentary leishmaniasis patients and healthy individuals. Cell. Immunol. 2018, 334, 61–69. [Google Scholar] [CrossRef]
- Bustamante, C.; Ochoa, R.; Asela, C.; Muskus, C. Repurposing of known drugs for leishmaniasis treatment using bioinformatic predictions, in vitro validations and pharmacokinetic simulations. J. Comput-Aided Mol. Des. 2019, 33, 845–854. [Google Scholar] [CrossRef] [PubMed]
- Tunes, L.G.; Morato, R.E.; Garcia, A.; Schmitz, V.; Steindel, M.; Correa-Junior, J.D.; Dos Santos, H.l.F.; Frezard, F.; de Almeida, M.V.; Silva, H. Preclinical gold complexes as oral drug candidates to treat leishmaniasis are potent trypanothione reductase inhibitors. ACS Infect. Dis. 2020, 6, 1121–1139. [Google Scholar] [CrossRef] [PubMed]
- Pedra-Rezende, Y.; Fernandes, M.C.; Mesquita-Rodrigues, C.; Stiebler, R.; Bombaça, A.C.S.; Pinho, N.; Cuervo, P.; De Castro, S.L.; Menna-Barreto, R.F. Starvation and pH stress conditions induced mitochondrial dysfunction, ROS production and autophagy in Trypanosoma cruzi epimastigotes. Biochim. Biophys. Acta (BBA)-Mol. Basis Dis. 2021, 1867, 166028. [Google Scholar] [CrossRef] [PubMed]
- Tabrez, S.; Rahman, F.; Ali, R.; Muhammad, F.; Alshehri, B.M.; Alaidarous, M.A.; Banawas, S.; Dukhyil, A.A.B.; Rub, A. Repurposing of FDA-approved drugs as inhibitors of sterol C-24 methyltransferase of Leishmania donovani to fight against leishmaniasis. Drug Dev. Res. 2021, 82, 1154–1161. [Google Scholar] [CrossRef] [PubMed]
- Khadir, F.; Shaler, C.R.; Oryan, A.; Rudak, P.T.; Mazzuca, D.M.; Taheri, T.; Dikeakos, J.D.; Haeryfar, S.M.; Rafati, S. Therapeutic control of leishmaniasis by inhibitors of the mammalian target of rapamycin. PLoS Neglected Trop. Dis. 2018, 12, e0006701. [Google Scholar] [CrossRef]
- Dominguez-Asenjo, B.; Gutierrez-Corbo, C.; Perez-Pertejo, Y.; Iborra, S.; Balana-Fouce, R.; Reguera, R.M. Bioluminescent imaging identifies thymus, as overlooked colonized organ, in a chronic model of Leishmania donovani mouse visceral leishmaniasis. ACS Infect. Dis. 2021, 7, 871–883. [Google Scholar] [CrossRef]
- Jantan, I.; Bukhari, S.N.A.; Mohamed, M.A.S.; Wai, L.K.; Mesaik, M.A. The evolving role of natural products from the tropical rainforests as a replenishable source of new drug leads. In Drug Discovery and Development—From Molecules to Medicine; IntechOpen: London, UK, 2015; pp. 3–38. [Google Scholar]
- García, M.; Monzote, L. Marine products with anti-protozoal activity: A review. Curr. Clin. Pharmacol. 2014, 9, 258–270. [Google Scholar] [CrossRef]
- Chaurasia, R.; Jain, N. Current Strategies And Recent Advances In Nanostructured Delivery Systems For Managing Leishmaniasis—A Review. J. Adv. Sci. Res. 2022, 13, 43–55. [Google Scholar] [CrossRef]
- Valli, M.; Souza, J.M.; Chelucci, R.C.; Biasetto, C.R.; Araujo, A.R.; Bolzani, V.D.S.; Andricopulo, A.D. Identification of natural cytochalasins as leads for neglected tropical diseases drug discovery. PLoS ONE 2022, 17, e0275002. [Google Scholar] [CrossRef]
- Thomford, N.E.; Senthebane, D.A.; Rowe, A.; Munro, D.; Seele, P.; Maroyi, A.; Dzobo, K. Natural Products for Drug Discovery in the 21st Century: Innovations for Novel Drug Discovery. Int. J. Mol. Sci. 2018, 19, 1578. [Google Scholar] [CrossRef]
- Nweze, J.A.; Mbaoji, F.N.; Li, Y.M.; Yang, L.Y.; Huang, S.S.; Chigor, V.N.; Eze, E.A.; Pan, L.X.; Zhang, T.; Yang, D.F. Potentials of marine natural products against malaria, leishmaniasis, and trypanosomiasis parasites: A review of recent articles. Infect. Dis. Poverty 2021, 10, 9. [Google Scholar] [CrossRef]
- Cortes, S.; Bruno de Sousa, C.; Morais, T.; Lago, J.; Campino, L. Potential of the natural products against leishmaniasis in Old World—A review of in-vitro studies. Pathog. Glob. Health 2020, 114, 170–182. [Google Scholar] [CrossRef]
- Lazarin-Bidóia, D.; Garcia, F.P.; Ueda-Nakamura, T.; Silva, S.O.; Nakamura, C.V. Natural compounds based chemotherapeutic against Chagas disease and leishmaniasis: Mitochondrion as a strategic target. Mem. Inst. Oswaldo Cruz 2022, 117, e220396. [Google Scholar] [CrossRef] [PubMed]
- Gharpure, S.; Ankamwar, B. Use of nanotechnology in combating coronavirus. 3 Biotech 2021, 11, 358. [Google Scholar] [CrossRef] [PubMed]
- Karuppusamy, C.; Venkatesan, P. Role of nanoparticles in drug delivery system: A comprehensive review. J. Pharm. Sci. Res. 2017, 9, 318. [Google Scholar]
- Kim, D.Y.; Kadam, A.; Shinde, S.; Saratale, R.G.; Patra, J.; Ghodake, G. Recent developments in nanotechnology transforming the agricultural sector: A transition replete with opportunities. J. Sci. Food Agric. 2018, 98, 849–864. [Google Scholar] [CrossRef] [PubMed]
- Celis-Giraldo, C.T.; López-Abán, J.; Muro, A.; Patarroyo, M.A.; Manzano-Román, R. Nanovaccines against animal pathogens: The latest findings. Vaccines 2021, 9, 988. [Google Scholar] [CrossRef] [PubMed]
- Javed, R.; Ghonaim, R.; Shathili, A.; Khalifa, S.A.; El-Seedi, H.R. Phytonanotechnology: A greener approach for biomedical applications. In Biogenic Nanoparticles for Cancer Theranostics; Elsevier: Amsterdam, The Netherlands, 2021; pp. 43–86. [Google Scholar]
- Sangar, O.S.; Patil, A.C.; Payghan, S.A. Nanoparticles: As a Nano based Drug Delivery System. Asian J. Pharm. Clin. Res. 2022, 11, 30–35. [Google Scholar]
- Almayouf, M.A.; El-Khadragy, M.; Awad, M.A.; Alolayan, E.M. The effects of silver nanoparticles biosynthesized using fig and olive extracts on cutaneous leishmaniasis-induced inflammation in female balb/c mice. Biosci. Rep. 2020, 40, BSR20202672. [Google Scholar] [CrossRef]
- Parvez, S.; Yadagiri, G.; Singh, A.; Karole, A.; Singh, O.P.; Sundar, S.; Mudavath, S.L. Improvising anti-leishmanial activity of amphotericin B and paromomycin using co-delivery in d-α-tocopheryl polyethylene glycol 1000 succinate (TPGS) tailored nano-lipid carrier system. Chem. Phys. Lipids 2020, 231, 104946. [Google Scholar] [CrossRef]
- Bahraminejad, S.; Pardakhty, A.; Sharifi, I.; Ranjbar, M.; Karami-Mohajeri, S.; Sharifi, F. Preparation and evaluation of physicochemical properties and anti-leishmanial activity of zirconium/tioxolone niosomes against Leishmania major. Arab. J. Chem. 2022, 15, 104156. [Google Scholar]
- Singh, K.; Ahlawat, S.; Kumari, D.; Matlani, U.; Meenakshi; Kaur, T.; Rao, A. Safety of Nanoparticles: Emphasis on Antimicrobial Properties. In Biomedical Applications and Toxicity of Nanomaterials; Springer: Singapore, 2023; pp. 425–458. [Google Scholar]
- Parvez, S.; Abbas, G.; Shahid, M.; Amjad, M.; Hussain, M.; Asad, S.A.; Imran, M.; Naeem, M.A. Effect of salinity on physiological, biochemical and photostabilizing attributes of two genotypes of quinoa (Chenopodium quinoa Willd.) exposed to arsenic stress. Ecotoxicol. Environ. Saf. 2020, 187, 109814. [Google Scholar] [CrossRef]
- Gedda, M.R.; Singh, B.; Kumar, D.; Singh, A.K.; Madhukar, P.; Upadhyay, S.; Singh, O.P.; Sundar, S. Post kala-azar dermal leishmaniasis: A threat to elimination program. PLoS Neglected Trop. Dis. 2020, 14, e0008221. [Google Scholar] [CrossRef]
- Ray, K.K.; Wright, R.S.; Kallend, D.; Koenig, W.; Leiter, L.A.; Raal, F.J.; Bisch, J.A.; Richardson, T.; Jaros, M.; Wijngaard, P.L. Two phase 3 trials of inclisiran in patients with elevated LDL cholesterol. N. Engl. J. Med. 2020, 382, 1507–1519. [Google Scholar] [CrossRef]
- Nafari, A.; Cheraghipour, K.; Sepahvand, M.; Shahrokhi, G.; Gabal, E.; Mahmoudvand, H. Nanoparticles: New agents toward treatment of leishmaniasis. Parasite Epidemiol. Control 2020, 10, e00156. [Google Scholar] [CrossRef]
- Prasanna, P.; Kumar, P.; Kumar, S.; Rajana, V.K.; Kant, V.; Prasad, S.R.; Mohan, U.; Ravichandiran, V.; Mandal, D. Current status of nanoscale drug delivery and the future of nano-vaccine development for leishmaniasis–A review. Biomed. Pharmacother. 2021, 141, 111920. [Google Scholar] [CrossRef]
- Athanasiou, E.; Agallou, M.; Tastsoglou, S.; Kammona, O.; Hatzigeorgiou, A.; Kiparissides, C.; Karagouni, E. A poly (lactic-co-glycolic) acid nanovaccine based on chimeric peptides from different Leishmania infantum proteins induces dendritic cells maturation and promotes peptide-specific IFNγ-producing CD8+ T cells essential for the protection against experimental visceral leishmaniasis. Front. Immunol. 2017, 8, 684. [Google Scholar]
- Agallou, M.; Margaroni, M.; Athanasiou, E.; Toubanaki, D.K.; Kontonikola, K.; Karidi, K.; Kammona, O.; Kiparissides, C.; Karagouni, E. Identification of BALB/c immune markers correlated with a partial protection to Leishmania infantum after vaccination with a rationally designed multi-epitope cysteine protease a peptide-based nanovaccine. PLoS Neglected Trop. Dis. 2017, 11, e0005311. [Google Scholar] [CrossRef]
- Assolini, J.P.; Carloto, A.C.M.; da Silva Bortoleti, B.T.; Gonçalves, M.D.; Pellissier, F.T.; Feuser, P.E.; Cordeiro, A.P.; de Araújo, P.H.H.; Sayer, C.; Sapla, M.M.M. Nanomedicine in leishmaniasis: A promising tool for diagnosis, treatment and prevention of disease-An update overview. Eur. J. Pharmacol. 2022, 923, 174934. [Google Scholar] [CrossRef] [PubMed]
- Roquero, I.; Cantizani, J.; Cotillo, I.; Manzano, M.P.; Kessler, A.; Martín, J.J.; McNamara, C.W. Novel chemical starting points for drug discovery in leishmaniasis and Chagas disease. Int. J. Parasitol. Drugs Drug Resist. 2019, 10, 58–68. [Google Scholar] [CrossRef] [PubMed]
- Yousef, B.A.; Elwaseela, T.H.; Ali, T.A.; Mohammed, F.E.; Mohammed, W.O.; Alobaid, M.; Dirar, A.I. Anti-malarial drugs as potential inhibitors of leishmania glycolytic enzymes: Development of new anti-leishmanial agents. Pharmacol. Clin. Pharm. Res. 2020, 5, 77–88. [Google Scholar] [CrossRef]
- Verma, A.; Ghosh, S.; Salotra, P.; Singh, R. Artemisinin-resistant Leishmania parasite modulates host cell defense mechanism and exhibits altered expression of unfolded protein response genes. Parasitol. Res. 2019, 118, 2705–2713. [Google Scholar] [CrossRef]
- Hendrickx, S.; Caljon, G.; Maes, L. Need for sustainable approaches in antileishmanial drug discovery. Parasitol. Res. 2019, 118, 2743–2752. [Google Scholar] [CrossRef] [PubMed]
- Wróbel, A.; Arciszewska, K.; Maliszewski, D.; Drozdowska, D. Trimethoprim and other nonclassical antifolates an excellent template for searching modifications of dihydrofolate reductase enzyme inhibitors. J. Antibiot. 2020, 73, 5–27. [Google Scholar] [CrossRef] [PubMed]
- Sharma, V.K.; Bharatam, P.V. Identification of selective inhibitors of Ld DHFR enzyme using pharmacoinformatic methods. J. Comput. Biol. 2021, 28, 43–59. [Google Scholar] [CrossRef] [PubMed]
- Kapil, S.; Singh, P.; Kashyap, A.; Silakari, O. Structure based designing of benzimidazole/benzoxazole derivatives as anti-leishmanial agents. SAR QSAR Environ. Res. 2019, 30, 919–933. [Google Scholar] [CrossRef] [PubMed]
- Pramanik, P.K.; Chakraborti, S.; Bagchi, A.; Chakraborti, T. Bioassay-based Corchorus capsularis L. leaf-derived β-sitosterol exerts antileishmanial effects against Leishmania donovani by targeting trypanothione reductase. Sci. Rep. 2020, 10, 20440. [Google Scholar] [CrossRef] [PubMed]
- Singh, S.; Kumari, E.; Bhardwaj, R.; Kumar, R.; Dubey, V.K. Molecular events leading to death of Leishmania donovani under spermidine starvation after hypericin treatment. Chem. Biol. Drug Des. 2017, 90, 962–971. [Google Scholar] [CrossRef]
- Singh, S.; Sarma, S.; Katiyar, S.P.; Das, M.; Bhardwaj, R.; Sundar, D.; Dubey, V.K. Probing the molecular mechanism of hypericin-induced parasite death provides insight into the role of spermidine beyond redox metabolism in Leishmania donovani. Antimicrob. Agents Chemother. 2015, 59, 15–24. [Google Scholar] [CrossRef] [PubMed]
- Henninot, A.; Collins, J.C.; Nuss, J.M. The current state of peptide drug discovery: Back to the future? J. Med. Chem. 2018, 61, 1382–1414. [Google Scholar] [CrossRef]
- Qvit, N.; Kornfeld, O.S. Development of a Backbone Cyclic Peptide Library as Potential Antiparasitic Therapeutics Using Microwave Irradiation. J. Vis. Exp. 2016, 107, e53589. [Google Scholar] [CrossRef]
- Qvit, N.; Schechtman, D.; Pena, D.A.; Berti, D.A.; Soares, C.O.; Miao, Q.; Liang, L.A.; Baron, L.A.; Teh-Poot, C.; Martínez-Vega, P.; et al. Scaffold proteins LACK and TRACK as potential drug targets in kinetoplastid parasites: Development of inhibitors. Int. J. Parasitol. Drugs Drug Resist. 2016, 6, 74–84. [Google Scholar] [CrossRef] [PubMed]
- Wang, L.; Wang, N.; Zhang, W.; Cheng, X.; Yan, Z.; Shao, G.; Wang, X.; Wang, R.; Fu, C. Therapeutic peptides: Current applications and future directions. Signal Transduct. Target. Ther. 2022, 7, 48. [Google Scholar] [CrossRef] [PubMed]
- Derda, R.; Jafari, M.R. Synthetic cross-linking of peptides: Molecular linchpins for peptide cyclization. Protein Pept. Lett. 2018, 25, 1051–1075. [Google Scholar] [CrossRef] [PubMed]
- Kang, N.J.; Jin, H.-S.; Lee, S.-E.; Kim, H.J.; Koh, H.; Lee, D.-W. New approaches towards the discovery and evaluation of bioactive peptides from natural resources. Crit. Rev. Environ. Sci. Technol. 2020, 50, 72–103. [Google Scholar] [CrossRef]
- Davda, J.; Declerck, P.; Hu-Lieskovan, S.; Hickling, T.P.; Jacobs, I.A.; Chou, J.; Salek-Ardakani, S.; Kraynov, E. Immunogenicity of immunomodulatory, antibody-based, oncology therapeutics. J. Immunother. Cancer 2019, 7, 105. [Google Scholar] [CrossRef]
- Nishioka, K.; Hayashi, S.; Farrer, M.J.; Singleton, A.B.; Yoshino, H.; Imai, H.; Kitami, T.; Sato, K.; Kuroda, R.; Tomiyama, H. Clinical heterogeneity of α-synuclein gene duplication in Parkinson’s disease. Ann. Neurol. Off. J. Am. Neurol. Assoc. Child. Neurol. Soc. 2006, 59, 298–309. [Google Scholar] [CrossRef]
- Qvit, N.; Rubin, S.J.S.; Urban, T.J.; Mochly-Rosen, D.; Gross, E.R. Peptidomimetic therapeutics: Scientific approaches and opportunities. Drug Discov. Today 2017, 22, 454–462. [Google Scholar] [CrossRef]
- Weng, H.-B.; Chen, H.-X.; Wang, M.-W. Innovation in neglected tropical disease drug discovery and development. Infect. Dis. Poverty 2018, 7, 1–9. [Google Scholar] [CrossRef]
- Qvit, N.; Crapster, J.A. Peptides that target protein-protein interactions as an anti-parasite strategy. Chim. Oggi/CHEMISTRY Today 2014, 32, 62–66. [Google Scholar]
- Jacobs, T.; Bruhn, H.; Gaworski, I.; Fleischer, B.; Leippe, M. NK-lysin and its shortened analog NK-2 exhibit potent activities against Trypanosoma cruzi. Antimicrob. Agents Chemother. 2003, 47, 607–613. [Google Scholar] [CrossRef] [PubMed]
- Souza, A.L.; Faria, R.X.; Calabrese, K.S.; Hardoim, D.J.; Taniwaki, N.; Alves, L.A.; De Simone, S.G. Temporizin and temporizin-1 peptides as novel candidates for eliminating Trypanosoma cruzi. PLoS ONE 2016, 11, e0157673. [Google Scholar] [CrossRef]
- Kleschenko, Y.E.; Karpenko, L.; Villalta, F. Effects of human defensin-α1 on Trypanosoma cruzi trypomastigotes in vitro. Bull. Exp. Biol. Med. 2010, 149, 731. [Google Scholar] [CrossRef]
- Pinto, E.G.; Pimenta, D.C.; Antoniazzi, M.M.; Jared, C.; Tempone, A.G. Antimicrobial peptides isolated from Phyllomedusa nordestina (Amphibia) alter the permeability of plasma membrane of Leishmania and Trypanosoma cruzi. Exp. Parasitol. 2013, 135, 655–660. [Google Scholar] [CrossRef]
- Brand, G.D.; Leite, J.R.S.; Silva, L.P.; Albuquerque, S.; Prates, M.V.; Azevedo, R.B.; Carregaro, V.; Silva, J.S.; Sá, V.C.; Brandao, R.A. Dermaseptins from Phyllomedusa oreades and Phyllomedusa distincta: Anti-Trypanosoma cruzi Activity without Cytotoxicity To Mammalian Cells. J. Biol. Chem. 2002, 277, 49332–49340. [Google Scholar] [CrossRef]
- Adade, C.M.; Oliveira, I.R.; Pais, J.A.; Souto-Padrón, T. Melittin peptide kills Trypanosoma cruzi parasites by inducing different cell death pathways. Toxicon 2013, 69, 227–239. [Google Scholar] [CrossRef]
- Freire, K.A.; Torres, M.D.T.; Lima, D.B.; Monteiro, M.L.; Martins, A.M.C.; Oliveira Jr, V.X. Wasp venom peptide as a new antichagasic agent. Toxicon 2020, 181, 71–78. [Google Scholar] [CrossRef] [PubMed]
- Santos, F.A.; Cruz, G.S.; Vieira, F.A.; Queiroz, B.R.; Freitas, C.D.; Mesquita, F.P.; Souza, P.F. Systematic review of antiprotozoal potential of antimicrobial peptides. Acta Trop. 2022, 236, 106675. [Google Scholar] [CrossRef] [PubMed]
- El-Dirany, R.; Shahrour, H.; Dirany, Z.; Abdel-Sater, F.; Gonzalez-Gaitano, G.; Brandenburg, K.; Martinez de Tejada, G.; Nguewa, P.A. Activity of anti-microbial peptides (AMPs) against Leishmania and other parasites: An overview. Biomolecules 2021, 11, 984. [Google Scholar] [CrossRef] [PubMed]
- Rubin, J.E.; Crowe, S.E. Celiac Disease. Ann. Intern. Med. 2020, 172, Itc1–Itc16. [Google Scholar] [CrossRef] [PubMed]
- Lei, J.; Sun, L.; Huang, S.; Zhu, C.; Li, P.; He, J.; Mackey, V.; Coy, D.H.; He, Q. The antimicrobial peptides and their potential clinical applications. Am. J. Transl. Res. 2019, 11, 3919. [Google Scholar]
- Zhang, Q.-Y.; Yan, Z.-B.; Meng, Y.-M.; Hong, X.-Y.; Shao, G.; Ma, J.-J.; Cheng, X.-R.; Liu, J.; Kang, J.; Fu, C.-Y. Antimicrobial peptides: Mechanism of action, activity and clinical potential. Mil. Med. Res. 2021, 8, 48. [Google Scholar] [CrossRef] [PubMed]
- Lewies, A.; Wentzel, J.F.; Jacobs, G.; Du Plessis, L.H. The potential use of natural and structural analogues of antimicrobial peptides in the fight against neglected tropical diseases. Molecules 2015, 20, 15392–15433. [Google Scholar] [CrossRef] [PubMed]
- Robledo, S.M.; Pérez-Silanes, S.; Fernández-Rubio, C.; Poveda, A.; Monzote, L.; González, V.M.; Alonso-Collado, P.; Carrión, J. Neglected Zoonotic Diseases: Advances in the Development of Cell-Penetrating and Antimicrobial Peptides against Leishmaniosis and Chagas Disease. Pathogens 2023, 12, 939. [Google Scholar] [CrossRef] [PubMed]
- Rojas-Pirela, M.; Kemmerling, U.; Quiñones, W.; Michels, P.A.; Rojas, V. Antimicrobial Peptides (AMPs): Potential Therapeutic Strategy against Trypanosomiases? Biomolecules 2023, 13, 599. [Google Scholar] [CrossRef] [PubMed]
- Robles-Loaiza, A.A.; Pinos-Tamayo, E.A.; Mendes, B.; Teixeira, C.; Alves, C.; Gomes, P.; Almeida, J.R. Peptides to tackle leishmaniasis: Current status and future directions. Int. J. Mol. Sci. 2021, 22, 4400. [Google Scholar] [CrossRef] [PubMed]
- Price, R.L. Determining the Effect of Treatment with an Exogenous Host Defence Peptide on Mycobacterium marinum-Zebrafish Infection. Ph.D. Thesis, Imperial College London, London, UK, 2017. [Google Scholar]
- Zahedifard, F.; Lee, H.; No, J.H.; Salimi, M.; Seyed, N.; Asoodeh, A.; Rafati, S. Anti-leishmanial activity of Brevinin 2R and its Lauric acid conjugate type against L. major: In vitro mechanism of actions and in vivo treatment potentials. PLoS Neglected Trop. Dis. 2019, 13, e0007217. [Google Scholar]
- Rivas, L.; Luque-Ortega, J.R.; Andreu, D. Amphibian antimicrobial peptides and Protozoa: Lessons from parasites. Biochim. Biophys. Acta (BBA)-Biomembr. 2009, 1788, 1570–1581. [Google Scholar] [CrossRef]
- Magana, M.; Pushpanathan, M.; Santos, A.L.; Leanse, L.; Fernandez, M.; Ioannidis, A.; Giulianotti, M.A.; Apidianakis, Y.; Bradfute, S.; Ferguson, A.L. The value of antimicrobial peptides in the age of resistance. Lancet Infect. Dis. 2020, 20, e216–e230. [Google Scholar] [CrossRef]
- Salas-Sarduy, E.; Niemirowicz, G.T.; José Cazzulo, J.; Alvarez, V.E. Target-based screening of the Chagas box: Setting up enzymatic assays to discover specific inhibitors across bioactive compounds. Curr. Med. Chem. 2019, 26, 6672–6686. [Google Scholar] [CrossRef]
- Fieck, A.; Hurwitz, I.; Kang, A.S.; Durvasula, R. Trypanosoma cruzi: Synergistic cytotoxicity of multiple amphipathic anti-microbial peptides to T. cruzi and potential bacterial hosts. Exp. Parasitol. 2010, 125, 342–347. [Google Scholar] [CrossRef]
- Sabia, E.F., Jr.; Menezes, L.F.S.; de Araújo, I.F.S.; Schwartz, E.F. Natural occurrence in venomous arthropods of antimicrobial peptides active against protozoan parasites. Toxins 2019, 11, 563. [Google Scholar] [CrossRef]
- Richter, A.; Sutherland, D.; Ebrahimikondori, H.; Babcock, A.; Louie, N.; Li, C.; Coombe, L.; Lin, D.; Warren, R.L.; Yanai, A. Associating Biological Activity and Predicted Structure of Antimicrobial Peptides from Amphibians and Insects. Antibiotics 2022, 11, 1710. [Google Scholar] [CrossRef]
- Telleria, E.L.; Tinoco-Nunes, B.; Leštinová, T.; de Avellar, L.M.; Tempone, A.J.; Pitaluga, A.N.; Volf, P.; Traub-Csekö, Y.M. Lutzomyia longipalpis antimicrobial peptides: Differential expression during development and potential involvement in vector interaction with microbiota and leishmania. Microorganisms 2021, 9, 1271. [Google Scholar] [CrossRef]
- Fang, Y.; He, X.; Zhang, P.; Shen, C.; Mwangi, J.; Xu, C.; Mo, G.; Lai, R.; Zhang, Z. In vitro and in vivo antimalarial activity of LZ1, a peptide derived from snake cathelicidin. Toxins 2019, 11, 379. [Google Scholar] [CrossRef]
- Adade, C.M.; Souto-Padrón, T. Venoms as sources of novel anti-parasitic agents. Toxins Drug Discov. 2015, 1–31. [Google Scholar] [CrossRef]
- De Rycker, M.; Baragaña, B.; Duce, S.L.; Gilbert, I.H. Challenges and recent progress in drug discovery for tropical diseases. Nature 2018, 559, 498–506. [Google Scholar] [CrossRef] [PubMed]
- World Health Organization. Ending the Neglect to Attain the Sustainable Development Goals: A Road Map for Neglected Tropical Diseases 2021–2030; World Health Organization: Geneva, Switzerland, 2020. [Google Scholar]
- Nakatsuji, T.; Chen, T.H.; Narala, S.; Chun, K.A.; Two, A.M.; Yun, T.; Shafiq, F.; Kotol, P.F.; Bouslimani, A.; Melnik, A.V.; et al. Antimicrobials from human skin commensal bacteria protect against Staphylococcus aureus and are deficient in atopic dermatitis. Sci. Transl. Med. 2017, 9, eaah4680. [Google Scholar] [CrossRef] [PubMed]
- Vargas Buonfiglio, L.G.; Vanegas Calderon, O.G.; Cano, M.; Simmering, J.E.; Polgreen, P.M.; Zabner, J.; Gerke, A.K.; Comellas, A.P. Seasonal Antimicrobial Activity of the Airway: Post-Hoc Analysis of a Randomized Placebo-Controlled Double-Blind Trial. Nutrients 2020, 12, 2602. [Google Scholar] [CrossRef] [PubMed]
- Mahlapuu, M.; Björn, C.; Ekblom, J. Antimicrobial peptides as therapeutic agents: Opportunities and challenges. Crit. Rev. Biotechnol. 2020, 40, 978–992. [Google Scholar] [CrossRef] [PubMed]
- Giovati, L.; Ciociola, T.; Magliani, W.; Conti, S. Antimicrobial peptides with antiprotozoal activity: Current state and future perspectives. Future Med. Chem. 2018, 10, 2569–2572. [Google Scholar] [CrossRef] [PubMed]
- Ferreira, L.L.G.; de Moraes, J.; Andricopulo, A.D. Approaches to advance drug discovery for neglected tropical diseases. Drug Discov. Today 2022, 27, 2278–2287. [Google Scholar] [CrossRef] [PubMed]
- Moraes, C.B.; Witt, G.; Kuzikov, M.; Ellinger, B.; Calogeropoulou, T.; Prousis, K.C.; Mangani, S.; Di Pisa, F.; Landi, G.; Iacono, L.D.; et al. Accelerating Drug Discovery Efforts for Trypanosomatidic Infections Using an Integrated Transnational Academic Drug Discovery Platform. SLAS Discov. 2019, 24, 346–361. [Google Scholar] [CrossRef] [PubMed]
- Parthasarathy, A.; Kalesh, K. Defeating the trypanosomatid trio: Proteomics of the protozoan parasites causing neglected tropical diseases. RSC Med. Chem. 2020, 11, 625–645. [Google Scholar] [CrossRef] [PubMed]
- Jiang, Z.; Vasil, A.I.; Hale, J.D.; Hancock, R.E.; Vasil, M.L.; Hodges, R.S. Effects of net charge and the number of positively charged residues on the biological activity of amphipathic alpha-helical cationic antimicrobial peptides. Biopolymers 2008, 90, 369–383. [Google Scholar] [CrossRef]
- Bittencourt, C.R.; de Oliveira Farias, E.A.; Bezerra, K.C.; Véras, L.M.C.; Silva, V.C.; Costa, C.H.N.; Bemquerer, M.P.; Silva, L.P.; Souza de Almeida Leite, J.R.; Eiras, C. Immobilization of cationic antimicrobial peptides and natural cashew gum in nanosheet systems for the investigation of anti-leishmanial activity. Mater. Sci. Eng. C Mater. Biol. Appl. 2016, 59, 549–555. [Google Scholar] [CrossRef]
- Mendes, B.; Almeida, J.R.; Vale, N.; Gomes, P.; Gadelha, F.R.; Da Silva, S.L.; Miguel, D.C. Potential use of 13-mer peptides based on phospholipase and oligoarginine as leishmanicidal agents. Comp. Biochem. Physiol. C Toxicol. Pharmacol. 2019, 226, 108612. [Google Scholar] [CrossRef]
- Rangel, M.; Cabrera, M.P.; Kazuma, K.; Ando, K.; Wang, X.; Kato, M.; Nihei, K.; Hirata, I.Y.; Cross, T.J.; Garcia, A.N.; et al. Chemical and biological characterization of four new linear cationic α-helical peptides from the venoms of two solitary eumenine wasps. Toxicon 2011, 57, 1081–1092. [Google Scholar] [CrossRef]
- Brand, G.D.; Leite, J.R.; de Sá Mandel, S.M.; Mesquita, D.A.; Silva, L.P.; Prates, M.V.; Barbosa, E.A.; Vinecky, F.; Martins, G.R.; Galasso, J.H.; et al. Novel dermaseptins from Phyllomedusa hypochondrialis (Amphibia). Biochem. Biophys. Res. Commun. 2006, 347, 739–746. [Google Scholar] [CrossRef]
- Díaz-Achirica, P.; Ubach, J.; Guinea, A.; Andreu, D.; Rivas, L. The plasma membrane of Leishmania donovani promastigotes is the main target for CA(1-8)M(1-18), a synthetic cecropin A-melittin hybrid peptide. Biochem. J. 1998, 330 Pt 1, 453–460. [Google Scholar] [CrossRef]
- Pérez-Cordero, J.J.; Lozano, J.M.; Cortés, J.; Delgado, G. Leishmanicidal activity of synthetic antimicrobial peptides in an infection model with human dendritic cells. Peptides 2011, 32, 683–690. [Google Scholar] [CrossRef]
- Kückelhaus, S.A.; Leite, J.R.; Muniz-Junqueira, M.I.; Sampaio, R.N.; Bloch, C., Jr.; Tosta, C.E. Antiplasmodial and antileishmanial activities of phylloseptin-1, an antimicrobial peptide from the skin secretion of Phyllomedusa azurea (Amphibia). Exp. Parasitol. 2009, 123, 11–16. [Google Scholar] [CrossRef] [PubMed]
- Mangoni, M.L.; Papo, N.; Saugar, J.M.; Barra, D.; Shai, Y.; Simmaco, M.; Rivas, L. Effect of natural L- to D-amino acid conversion on the organization, membrane binding, and biological function of the antimicrobial peptides bombinins H. Biochemistry 2006, 45, 4266–4276. [Google Scholar] [CrossRef] [PubMed]
- Marr, A.; Cen, S.; Hancock, R.; McMaster, W. Identification of synthetic and natural host defense peptides with leishmanicidal activity. Antimicrob. Agents Chemother. 2016, 60, 2484–2491. [Google Scholar] [CrossRef] [PubMed]
- Patiño-Márquez, I.A.; Patiño-González, E.; Hernández-Villa, L.; Ortíz-Reyes, B.; Manrique-Moreno, M. Identification and evaluation of Galleria mellonella peptides with antileishmanial activity. Anal. Biochem. 2018, 546, 35–42. [Google Scholar] [CrossRef] [PubMed]
- Rhaiem, R.B.; Houimel, M. Targeting Leishmania major parasite with peptides derived from a combinatorial phage display library. Acta Trop. 2016, 159, 11–19. [Google Scholar] [CrossRef] [PubMed]
- Bahar, A.A.; Ren, D. Antimicrobial peptides. Pharmaceuticals 2013, 6, 1543–1575. [Google Scholar] [CrossRef]
- Zanetti, M. Cathelicidins, multifunctional peptides of the innate immunity. J. Leukoc. Biol. 2004, 75, 39–48. [Google Scholar] [CrossRef]
- Li, J.; Koh, J.J.; Liu, S.; Lakshminarayanan, R.; Verma, C.S.; Beuerman, R.W. Membrane Active Antimicrobial Peptides: Translating Mechanistic Insights to Design. Front. Neurosci. 2017, 11, 73. [Google Scholar] [CrossRef]
- Oñate-Garzón, J.; Manrique-Moreno, M.; Trier, S.; Leidy, C.; Torres, R.; Patiño, E. Antimicrobial activity and interactions of cationic peptides derived from Galleria mellonella cecropin D-like peptide with model membranes. J. Antibiot. 2017, 70, 238–245. [Google Scholar] [CrossRef]
- Zhang, C.; Yang, M. Antimicrobial Peptides: From Design to Clinical Application. Antibiotics 2022, 11, 349. [Google Scholar] [CrossRef]
- Chen, Y.; Guarnieri, M.T.; Vasil, A.I.; Vasil, M.L.; Mant, C.T.; Hodges, R.S. Role of peptide hydrophobicity in the mechanism of action of alpha-helical antimicrobial peptides. Antimicrob. Agents Chemother. 2007, 51, 1398–1406. [Google Scholar] [CrossRef] [PubMed]
- Cunningham, A.D.; Qvit, N.; Mochly-Rosen, D. Peptides and peptidomimetics as regulators of protein-protein interactions. Curr. Opin. Struct. Biol. 2017, 44, 59–66. [Google Scholar] [CrossRef] [PubMed]
- Rubin, S.; Qvit, N. Cyclic Peptides for Protein-Protein Interaction Targets: Applications to Human Disease. Crit. Rev. Eukaryot. Gene Expr. 2016, 26, 199–221. [Google Scholar] [CrossRef] [PubMed]
- Rapposelli, S.; Gaudio, E.; Bertozzi, F.; Gul, S. Editorial: Protein-Protein Interactions: Drug Discovery for the Future. Front. Chem. 2021, 9, 811190. [Google Scholar] [CrossRef]
- Gundampati, R.K.; Sahu, S.; Shukla, A.; Pandey, R.K.; Patel, M.; Banik, R.M.; Jagannadham, M.V. Tryparedoxin peroxidase of Leishmania braziliensis: Homology modeling and inhibitory effects of flavonoids for anti-leishmanial activity. Bioinformation 2014, 10, 353. [Google Scholar] [CrossRef]
- Venkatesan, S.K.; Saudagar, P.; Shukla, A.K.; Dubey, V.K. Screening natural products database for identification of potential antileishmanial chemotherapeutic agents. Interdiscip. Sci. Comput. Life Sci. 2011, 3, 217–231. [Google Scholar] [CrossRef]
- Amiri-Dashatan, N.; Rezaei-Tavirani, M.; Ranjbar, M.M.; Koushki, M.; Nasab, S.D.M.; Ahmadi, N. Discovery of Novel Pyruvate Kinase Inhibitors Against Leishmania major among FDA Approved Drugs Through System Biology and Molecular Docking Approach. Turk. J. Pharm. Sci. 2021, 18, 710. [Google Scholar] [CrossRef] [PubMed]
No | Diseases | Species | Types | Geographic Distributions | References |
---|---|---|---|---|---|
1 | Leishmaniasis | Leishmania (L.) Aethiopica | Cutaneous and mucocutaneous leishmaniasis | Ethiopia, Kenya | [39] |
2 | L. Tropica | Visceral and cutaneous leishmaniasis | Eastern and Northern India, Central Asia, East and South Africa, Middle East | [39] | |
3 | L. Amazonensis | Cutaneous and mucocutaneous leishmaniasis | Brazil, Bolivia, Venezuela | [40] | |
4 | L. Infantum | Visceral and cutaneous leishmaniasis | Mexico, Brazil, Bolivia, Venezuela, Northern Africa, Middle East, Mediterranean regions, Southern Europe, Central Asia | [41] | |
5 | L. Donovani | Post Kala azar dermal leishmaniasis, visceral and cutaneous leishmaniasis | India, Myanmar, Nepal, Sri Lanka, Middle East, China, Ethiopia, Kenya, Sudan | [41] | |
6 | L. Major | Cutaneous and mucocutaneous leishmaniasis | Central Asia, Middle East, Central, Northern and West Africa | [42] | |
7 | L. Mexicana | Cutaneous and visceral leishmaniasis | United States of America, Venezuela, Ecuador, Peru, Brazil | [40] | |
8 | L. Venezuelensis | Cutaneous leishmaniasis | Northern and Southern America, Venezuela | [43] | |
9 | L. Braziliensis | Cutaneous and mucocutaneous leishmaniasis | Amazon stretch, Brazil, Southern America, Bolivia, Peru, Venezuela | [44] | |
10 | L. Guyanensis | Cutaneous and mucocutaneous leishmaniasis | Southern America, French Guiana, Suriname, Brazil | [45] | |
11 | L. Panamensis | Cutaneous and mucocutaneous leishmaniasis | Panama, South and Northern America, Brazil, Ecuador, Columbia, Venezuela | [45] | |
12 | L. Lainsoni | Cutaneous leishmaniasis | French Guiana, Peru, Bolivia, Brazil | [46] | |
13 | L. Naffi | Cutaneous leishmaniasis | French Guiana, Brazil | [46] | |
14 | L. Lindenberg | Cutaneous leishmaniasis | Brazil | [47] | |
15 | L. Peruviana | Cutaneous and mucocutaneous leishmaniasis | Peru, Bolivia, Amazon | [48] | |
16 | L. Shawi | Cutaneous leishmaniasis | Brazil | [49] | |
17 | L. Martiniquensis | Visceral and cutaneous leishmaniasis | Martinique, Thailand, France, Germany, Switzerland, Myanmar | [50] | |
18 | L. Siamensis | Visceral and cutaneous leishmaniasis | Central Europe, Thailand, United States of America | [51] | |
19 | L. Colombiensis | Visceral and cutaneous leishmaniasis | Columbia | [52] | |
20 | African Trypanosomiasis (aka Sleeping Sickness) | T. brucei | Acute and chronic infections | Eastern, Western, Southern and Central Africa | [53] |
21 | Chagas disease (aka American trypanosomiasis) | T. cruzi | Acute and chronic infections | Bolivia, Argentina, Paraguay, Ecuador, El Salvador, Guatemala | [54] |
Drug/ Compounds | Disease | Target Organism | Model | Outcomes | References |
---|---|---|---|---|---|
Imatinib | CL | L. amazonensis | C57BL/6 mice | A reduction in abrasion in mice and an increase in phagocytosis | [209] |
AS101 (tellurium-based compound) | VL | L. donovani | BALB/c mice | An increase in the production of ROS and NO. Nuclear factor kappa B (NF-κB) and mitogen-activated protein kinase pathways are activated | [210] |
Oleuropein | VL | L. donovani | J774A.1 cell line and BALB/c mice | Inflammatory response accompanied by increased levels of interferon-gamma (IFN-γ) and IL-12 | [211,212] |
Leptin | VL | L. donovani | THP-1 cell line | Increase NO production and promote Th1 response to kill parasites | [213] |
Mahanine | VL | L. donovani | J774A.1 cell line and BALB/c mice | Inhibits the production of Th2 cytokines (IL10) while modulating Th1 cytokines | [214,215] |
Simvastatin | CL | L. major | BALB/c mice | The drug inhibits cholesterol biosynthesis and reduces promastigotes’ attachment to the host | [206] |
Eugenol | CL | L. amazonensis | BALB/c mice | The Th1 immune response is triggered by the release of IL-12 and IFN-γ | [216,217] |
Phospholipase A2 | CL | L. amazonensis | BALB/c mice | The stimulation of NF-κB in macrophages and tumor necrosis factor-alpha (TNF-alpha) production (increased Th1 immune response) and NO production is also enhanced | [218] |
Drug/Compounds | Disease | Target Organism | Model | Outcomes | References |
---|---|---|---|---|---|
Sertraline | VL | L. infantum | BALB/c mice | Reduced the parasite’s growth significantly. In addition to oxidative damage, essential metabolic pathways were altered | [226,227] |
Cladribine, Lamivudine, Metformin, Perphenazine, Rifabutin, and Tenofovir | CL | L. braziliensis and L. panamensis | U-937 cell line | According to in vitro studies, rifabutin and perphenazine inhibited parasites better than the other drugs | [228] |
Gold (I) triphenyl- phosphine and triethyl- phosphine based complexes | CL | L. amazonensis and L. braziliensis | BALB/c mice | It is reported that the IC50 for the anti-leishmanial activity is 0.5–5.5 μM. ROS-mediated cell death is caused by the inhibition of trypanothione reductase activity | [229] |
Triclosan | CL | L. amazonensis | BALB/c mice | The parasite was inhibited in its growth, as well as mitochondria were damaged and membrane permeability was reduced | [230] |
Simeprevir | VL | L. donovani | THP-1 cell line | ROS-mediated cell death combined with leishmanicidal properties against Promastigotes and Amastigotes | [231] |
Rapamycin | CL | L. major and L. tropica | BALB/c mice | Proliferation of the parasite was markedly inhibited. A reduction in parasite load in mice along with the polarization of the immune system towards Th1 was observed | [232] |
Nifuratel | CL and VL | L. major, L. infantum, and L. donovani | BALB/c mice | In a mouse model, both oral and intralesional administration cured cutaneous and visceral infections | [233] |
Drug/Compounds | Disease | Target Organism | Model | Outcomes | References |
---|---|---|---|---|---|
Silver NPs containing Fig and Olive extracts | CL | L. major | BALB/c mice | Reduction in skin lesions and improved antioxidative capacity | [248] |
Nano-hydrogels loaded with buparvaquone | CL | L. amazonensis | BALB/c mice | Infected BALB/c mice showed a significant decrease in parasitic burden of 95% | [249] |
Chitosan/CdO core shell nanodots | CL | L. major | THP-1 cell line | The compound inhibited promastigotes proliferation and induced Th1 immunity at IC50 0.6 μL/mL | [250] |
Cyclodextrin NPs containing Amp B and paromomycin | VL | L. donovani | J774A.1 cell line and Swiss albino mice | By inhibiting parasite growth with an IC50 0.013 μg/mL, it reduced the parasitic burden by 70–90% | [251] |
Chitosan NPs containing Amp B and paromomycin | VL | L. donovani | J774A.1 cell line | NPs inhibit parasite growth better than Amp B alone, and >90% parasite clearance was reported | [252] |
Nanotube appended with Amp B | VL | L. donovani | J774A.1 cell line and golden hamster | Composite graphene–carbon nanotubes significantly reduced parasitic proliferation by >90% when compared to AmB alone, proving that it is a safe cure for parasites | [253] |
Guar gum NPs containing and Amp B | VL | L. donovani | Golden hamster | It inhibits parasites by 2–3 fold compared to drug alone and reduces parasitic burden by 95% | [254] |
Drug Candidate | Drug Target | Mode of Action | References |
---|---|---|---|
Artesunate Quinine Mefloquine | GAPDH | Inhibits the parasites’ glycolytic enzymes GAPDH | [261,262] |
Cycloguanil | DHFR | Inhibits DHFR | [263,264,265] |
Trimethoprim (TMP, 2) | |||
ZINC57774418 (Z18) | |||
ZINC69844431 (Z31) | |||
ZINC71746025 (Z25) | |||
D11596 (DB96) | Inhibits DHFR activity | [265] | |
2-(4-((2,4- dichlorobenzyl)oxy)phenyl)-1Hbenzo[d]imidazole | DHFR and PTR1 | DHFR-TS/PTR1 inhibitors | [266] |
2-(4-((2,4- dichlorobenzyl)oxy)phenyl)-1Hbenzo[d]imidazole-1Hbenzo[d]oxazole | DHFR and PTR1 | ||
Trichloro[1,2-ethanediolato-O,O’]tellurate (AS101) | TR | Induces ROS-mediated apoptosis by binding to TR cysteine residues | [210] |
β-sitosterol CCL | Inhibit TR activity | [267] | |
Hypericin | Spermidine synthase | ROS and spermidine reduction | [268,269] |
Peptide | Source | Sequence | IC50 µg/mL | Study Model | Reference |
---|---|---|---|---|---|
NK-2 | Synthetic peptide | KILRGVCKKIMRTFLRRISKDILTGKK | - | in vitro | [281] |
Temporizin-1 | Synthetic peptide | FLPLWLWLWLWLWKLK | - | in vitro | [282] |
Defensin-α1 | Homo sapiens (Human) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | - | in vitro | [283] |
Phylloseptin 7 | Phyllomedusa nordestina (Frog) | FLSLIPHAINAVSAIAKHF | 0.34 | in vitro | [284] |
DS 01 | Phyllomedusa oreades (Frog) | GLWSTIKQKGKEAAIAAAKAAGQAALGAL | - | in vitro | [285] |
Melittin | Apis mellifera (Bee) | - | 2.44 | in vitro | [286] |
Polybia-CP | Polybia paulista (Wasp) | ILGTILGLLSKL | - | in vitro | [287] |
Hmc 364–382 | Penaeus monodon (Shrimp) | NVQYYGALHNTAHIVLGRQ | 4.79 | in vitro | [287] |
Species (Diseases) | Peptide Name | Sources | Sequences | Study Model | Net Charge | Hydrophobicity (kcal/mol) | PI | Length | References |
---|---|---|---|---|---|---|---|---|---|
Leishmania | DRS 01 | Phyllomedusa | GLWSTIKQKGKEAAIAAAKAAGQAALGAL | in vitro | +3 | +26.50 | 10.60 | 29 | [318] |
Leishmania | Dermaseptin 4 | Phyllomedusa | GLWSTIKQKGKEAAIAAAKAAGKAALNAASEAL | in vitro | +3 | +33.32 | 10.43 | 33 | [284] |
Leishmania | Dermaseptin 1 | Nordestina | GLWSTIKNVGKEAAIAAGKAALGAL | in vitro | +2 | +21.05 | 10.37 | 25 | [284] |
Leishmania | p-Acl | Agkistrodon contortrix | KKYKAYFKFKCKK | in vitro | +7 | +23.14 | 10.45 | 13 | [319] |
Leishmania | p-AclR7 | Laticinctus | RRYRAYFRFRCRR | in vitro | +7 | +16.21 | 12.36 | 13 | [319] |
Leishmania | Eumenitin-R | Eumenes rubrofemoratus | LNLKGLIKKVASLLN | in vitro | +3 | +12.28 | 10.89 | 15 | [320] |
Leishmania | Dermaseptin-01 | Amphibian | GLWSTIKNVGKEAAIAAGKAALGAL | - | +2 | +21.05 | 10.35 | 25 | [321] |
Leishmania | Dermaseptin-H3 | Amphibian | GLWSTIKNVGEAAIAAGKAALGAL | - | +1 | +18.25 | 9.95 | 24 | [321] |
Leishmania | Melittin | Insect | GIGAVLKVLTTGLPALISWIKRKQQ | - | +4 | +13.83 | 11.79 | 24 | [322] |
Leishmania | Melittin | Insect | GIGAVLTTGLPALISWIKRKRQQ | - | +4 | +14.55 | 12.51 | 23 | [322,323] |
Leishmania | Phylloseptin-1 | Amphibian | FLSLIPHAINAVSAIAKHN | - | +1 | +12.09 | 9.93 | 19 | [324] |
Leishmania | Bombinin H | Amphibian | IIGPVLGLVGSALGGLLKKI | - | +2 | +9.82 | 10.65 | 20 | [325] |
Leishmania | LL-37 | Cathelicidin | [LL-37, 37 aa] | in vitro | +6 | +41.03 | 11.15 | 37 | [326] |
Leishmania | E6 | Synthetic | RRWRIVVIRVRR | in vitro | +6 | +13.05 | 13.18 | 12 | [326] |
Leishmania | cecropin-A | Hemolymph of the giant silkworm Hyalophora cecropia | KWKLFKKIEKVGQNIRDGIIKAGPAVAWVGQATQIAK | in vitro | +6 | +33.11 | 10.94 | 37 | [327] |
Leishmania | Cecropin-D | Galleria mellonella hemolymph | ENFFKEIERAGQRIRDAIISAAPAVETLAQAQKIIKGGD | in vitro | 0 | +42.64 | 7.07 | 39 | [323] |
Leishmania | Eumenitin-F | LNLKGIFKKVASLLT | in vitro | +3 | +11.22 | 10.89 | 15 | [303] | |
Leishmania | Eumenitin-R | LNLKGLIKKVASLLN | in vitro | +3 | +12.28 | 10.89 | 15 | [303] | |
Leishmania | P1 | Direct screening of a linear hexa-peptide library on L. major metacyclic parasite | MASKPQR | in vitro and in vivo | +2 | +13.71 | 11.53 | 7 | [328] |
Leishmania | P2 | Direct screening of a linear hexa-peptide library on L. major metacyclic parasite | MAAKYN | in vitro and in vivo | +1 | +11.17 | 9.58 | 6 | [328] |
Leishmania | P3 | Direct screening of a linear hexa-peptide library on L. major metacyclic parasite | MAHYSG | in vitro and in vivo | 0 | +10.96 | 7.63 | 6 | [328] |
Leishmania | P4 | Direct screening of a linear hexa-peptide library on L. major metacyclic parasite | MYVIRG | in vitro and in vivo | +1 | +7.90 | 9.68 | 6 | [328] |
Leishmania | P5 | Direct screening of a linear hexa-peptide library on L. major metacyclic parasite | SLSWVC | in vitro and in vivo | 0 | +5.00 | 4.93 | 6 | [328] |
Leishmania | P6 | Direct screening of a linear hexa-peptide library on L. major metacyclic parasite | QRKMAS | in vitro and in vivo | +2 | +13.57 | 11.52 | 6 | [328] |
Chagas disease | Mucin-associated surface proteins (MASP) | SLLSDAENPGGEVFNDNK | in vitro | −3 | +26.98 | 3.53 | 18 | [328] | |
Chagas disease | Mucin-associated surface proteins (MASP) | DAENPGGEVFNDNKKGLSRV | in vitro | −1 | +33.07 | 4.48 | 20 | [328] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Berhe, H.; Kumar Cinthakunta Sridhar, M.; Zerihun, M.; Qvit, N. The Potential Use of Peptides in the Fight against Chagas Disease and Leishmaniasis. Pharmaceutics 2024, 16, 227. https://doi.org/10.3390/pharmaceutics16020227
Berhe H, Kumar Cinthakunta Sridhar M, Zerihun M, Qvit N. The Potential Use of Peptides in the Fight against Chagas Disease and Leishmaniasis. Pharmaceutics. 2024; 16(2):227. https://doi.org/10.3390/pharmaceutics16020227
Chicago/Turabian StyleBerhe, Hayelom, Mahesh Kumar Cinthakunta Sridhar, Mulate Zerihun, and Nir Qvit. 2024. "The Potential Use of Peptides in the Fight against Chagas Disease and Leishmaniasis" Pharmaceutics 16, no. 2: 227. https://doi.org/10.3390/pharmaceutics16020227
APA StyleBerhe, H., Kumar Cinthakunta Sridhar, M., Zerihun, M., & Qvit, N. (2024). The Potential Use of Peptides in the Fight against Chagas Disease and Leishmaniasis. Pharmaceutics, 16(2), 227. https://doi.org/10.3390/pharmaceutics16020227