Next Article in Journal
Species Composition and Distribution of Terrestrial Herbs in a High Montane Forest in Ecuador
Previous Article in Journal
Biodiversity Conservation in Xishuangbanna, China: Diversity Analysis of Traditional Knowledge Related to Biodiversity and Conservation Progress and Achievement Evaluation
Previous Article in Special Issue
A New Genus and Two New Species of Short-Palped Crane Flies (Diptera: Limoniidae) from Central Asia
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
Diversity
Volume 16
Issue 5
10.3390/d16050261
diversity-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

The Mosquitoes of Morelos, Mexico: DNA Barcodes, Distribution, Ecology and the Resurrection of the Name Culiseta dugesi Dyar and Knab (Diptera: Culicidae) †

by
Aldo I. Ortega-Morales
1,*,
Luis M. Hernández-Triana
2,*,
Javier A. Garza-Hernández
3,
Carlos M. Ramírez-Huicochea
4,
Andrés J. Martínez-Gaona
4,
J. Manuel Quijano-Barraza
5,
Cassandra González-Acosta
4 and
Fabián Correa-Morales
6
1
Departamento de Parasitología, Universidad Autónoma Agraria Antonio Narro, Unidad Laguna, Torreón 27054, Mexico
2
Animal and Plant Health Agency, Virology Department, Vector Borne Diseases Research Group, Surrey KT153NB, UK
3
Laboratorio de Entomología Médica, Instituto de Ciencias Biomédicas, Universidad Autónoma de Ciudad Juárez, Ciudad Juárez 32310, Mexico
4
Unidad de Investigación Entomológica y Bioensayos, Centro Nacional de Programas Preventivos y Control de Enfermedades, Eje 4 Sur, Av. Benjamín Frnanklin, Escandón I, Mexico City 06170, Mexico
5
Laboratorio de Variación Biológica y Evolución, Departamento de Zoología, Escuela Nacional de Ciencias Biológicas, Instituto Politécnico Nacional, Prolongación de Carpio y Plan de Ayala s/n, Mexico City 11340, Mexico
6
Centro Nacional de Programas Preventivos y Control de Enfermedades, Eje 4 Sur, Av. Benjamín Frnanklin, Escandón I, Mexico City 06170, Mexico
*
Authors to whom correspondence should be addressed.
†
The LSID for this publication is: 2F00E8A8-99AA-4D89-84F2-72B95F24A19A.
Diversity 2024, 16(5), 261; https://doi.org/10.3390/d16050261
Submission received: 29 February 2024 / Revised: 22 April 2024 / Accepted: 24 April 2024 / Published: 26 April 2024
(This article belongs to the Special Issue Diptera in Aquatic and Semiaquatic Environments: Diversity and Adaptations)
Browse Figures
Review Reports Versions Notes

Abstract

:
To update the record of mosquito diversity in the state of Morelos, Mexico, mosquito collections were conducted in both physiographical regions of Morelos: the Neo-volcanic Axis and the South Mountain Range. Immature stages were collected from aquatic habitats, while adult mosquitoes were collected using CDC light traps, Shannon traps and approaching/landing on the collecting personnel. All specimens were identified using taxonomic keys and the mitochondrial cytochrome C oxidase subunit 1 (COI). Following Mexico State, this is the second study of mosquito taxonomy of a complete Mexican state using COI barcoding. In Morelos, a total of 58 species of mosquito occurs, of which we report 12 for first time (Aedes vexans, Ae. euplocamus, Ae. vargasi, Psorophora cilipes, Ps. lineata, Culex restrictor, Cx. interrogator, Cx. nigripalpus, Cx. tarsalis, Cx. sandrae, Cx. lactator and Toxorhynchites moctezuma). Morelos now ranks sixth in mosquito diversity among Mexican states. Phylogenetic trees were constructed for 32 species, including Ae. shannoni, which is a new record for GenBank databases. Additionally, we report COI barcode sequences of Culiseta dugesi Dyar and Knab, which is resurrected from the synonymy of Cs. particeps (Adams). Fourth-instar larvae and adult females of Cs. dugesi were redescribed. This brings the number of mosquito species in Mexico to 248. Ecological and distributional notes for the new records, the medical importance of mosquito species in Morelos, and an identification key for larvae and females of the known Culiseta species occurring in Mexico are also included.

1. Introduction

The family Culicidae currently includes approximately 3720 described species [1]. Several species are biting pests and also play an important role as vectors of pathogens of humans and livestock [2]. These include some viral diseases such as dengue, chikungunya, Japanese encephalitis, yellow fever, West Nile virus, Rift Valley fever and Zika, as well as several nematodes and protozoans such as Dirofilaria spp. and Plasmodium spp. [2,3]. As a result, mosquitoes are one of the principal target groups of surveillance and control programs worldwide [4]. In addition, mosquitoes may serve as key indicators of landscape degradation [5,6,7].
Current approaches to species identification still rely heavily upon morphology-based procedures, which typically require substantial training and may not always provide an accurate resolution on specimen identity due to homogeneity between life stages of different species and the presence of complex species [8,9,10,11]. To overcome this impediment, a small portion (658 bp) of the mitochondrial cytochrome C oxidase unit I (COI) gene was proposed as a standardized DNA marker in support of species identification for animal barcodes, in a process commonly referred to as DNA barcoding [12,13].
Prior to this study, 247 species of Culicidae mosquitoes belonging to 21 genera have been reported in Mexico [14]. Of the 10 Mexican states that have been studied in terms of taxonomy and distribution of mosquito species, the largest numbers have been found in Veracruz (n = 139 spp.) [14,15,16,17], Tabasco (n = 105 spp.) [14,18,19,20,21], Quintana Roo (n = 85 spp.) [14,22,23,24,25,26,27,28,29] and Tamaulipas (n = 80 spp.) [14,30], whereas the states with the least numbers of species are Tlaxcala (n = 26 spp.) [31], Mexico City (n = 28 spp.) [32,33], Querétaro (n = 50 spp.) [34], Mexico State (n = 51 spp.) [35], Hidalgo (n = 57 spp.) [36,37] and Nuevo León (n = 68 spp.) [14,38,39,40].
Prior to this study, 45 mosquito species were reported in Morelos. However, most records were based on collections made in urban and sub-urban regions, neglecting collections from conserved forest and jungle regions, mainly in the south of the state. In this study, the two physiographical regions of Morelos (Neo-Volcanic Axis and South Mountain Range) were sampled during the dry and rainy seasons, with special emphasis on conserved forest regions and other sylvan areas. In the present study, we apply the COI DNA barcoding approach in support of the identification of mosquitoes in Morelos. In addition, we assessed the DNA barcode variability using Bayesian phylogenetic methods to detect cryptic diversity across the taxa we analyzed.
Morphological and molecular taxonomic evidence suggest that, in Morelos, 58 mosquito species occur. In addition, the use of barcodes, used in parallel with techniques of classical taxonomy, was useful for the re-discovery and description of Culiseta dugesi Dyar and Knab, which had been synonymized under the name Cs. particeps (Adams). Systematic and ecological information, and morphological descriptions of fourth-instar larvae and adult females of Cs. dugesi, are provided in this study. Additionally, biological information for each state’s species records, the northernmost and southernmost distributions of some species and information on species originally discovered in Morelos, as well as the medical importance of each species, are provided.

2. Material and Methods

2.1. Study Area

Morelos is located in south-central Mexico (19°7′54″ and 18°19′56″ N; 98°37′58″ and 99°29′39″ W). Morelos has an area of 4950 Km2, the second smallest state in Mexico. Morelos is bordered to the north by Mexico City and Mexico State, to the south by Puebla and Guerrero, to the west by Guerrero and Mexico State, and to the east by Puebla. Morelos is divided into two physiographical regions and three subregions (shown in parenthesis) (Figure 1): Neo-volcanic Axis with two sub-regions (Lakes and Volcanoes of Anahuac and Mountain Ranges of Southern Puebla) and the South Mountain Range with one sub-region (Mountain Ranges and Valleys of Guerrero) [41]. The regions and sub-regions of Morelos including the municipalities sampled are depicted in Table 1.

2.2. Mosquito Collection and Identification

Mosquitoes were collected in all life stages (except eggs), in specific sites in the two physiographic regions of Morelos (Table 1). The collections were conducted in both the dry and rainy seasons from 2009–2018. Immature stages were collected from any available water body, and some environmental parameters were recorded such as pH, salinity, and temperature which were measured using a portable Hanna® (mod. HI98129) tester. Larvae and pupae were placed in cups with water from the original aquatic habitat and transported alive to the Laboratory of Parasitology of the Autonomous Agrarian University Antonio Narro Laguna Unit (LBM-UAAAN-UL). A portion of fourth-instar larvae from each collection was mounted on microscope slides using Euparal as the mounting medium. The other larvae were placed into individual emergence tubes to obtain the adult stages and the larval and pupal exuviae. Male genitalia were dissected to assist the taxonomic identification when it was required. Adults were collected using CDC light traps baited with cotton balls containing drops of octenol, which were placed 20:00–9:00 h. and checked daily. Shannon traps baited with humans were used during daylight hours, and resting mosquitoes were aspirated directly from caves and vegetation. All adult mosquitoes were killed using triethylamine vapors and later mounted on insect pins. Mosquitoes mounted on insect pins were identified using specific identification keys and a stereomicroscope Discovery V8 (Zeiss, Jena, Germany), while immature stages and exuviae were identified using a Primostar microscope (Zeiss). The terminology proposed by Harbach and Knight [42] for mosquito anatomy and the classification system for the family Culicidae proposed by Wilkerson et al. [43] are used in this study.

2.3. Genomic DNA Extraction

We employed a modified Hotshot technique [44] for the DNA extraction. In this case, 1–2 legs from each mosquito voucher were placed directly into 50 µL of alkaline lysis buffer (25 mM NaOH, 0.2 mM Na2EDTA) in a 96-well plate, which was then sonicated (Grant Ultrasonic 3 L Bath) in a water bath for 15 min. The plate was subsequently incubated in a thermocycler for 30 min at 94 °C, cooled for 5 min at 4 °C, and then centrifuged for 3 min at 3000 rpm, after which 50 µL of the neutralizing buffer (40 mMTri-HCL) was added to each sample. The plate was then stored at −80 °C until analysis.

2.4. Polymerase Chain Reaction and DNA Sequencing

PCR amplification of the full-length COI barcode region [44,45] was performed using Folmer primers (LCO1490 and HCO2198) and a Quiagen PCR system with the following reaction mix, final volume 50 µL: 2 µL of DNA template, 25 µL H2O, 5 µL NH4, 5 µL of dNTPs (2 mM/µL), 2.5 µL of MgCl2 (25 mM/µL), 0.1 µL Bioline Taq Polymerase (Bioline Reagents Ltd., London, UK), 5 µL of each primer (each at 10 pmol/µL), and 0.38 µL of bovine serum albumin (20 mg/mL) [39,40,41]. The thermal profile consisted of the following: an initial denaturation step at 94 °C for 1 min., 5 cycles of preamplification of 94 °C for 1 min., 45 °C for 1.5 min., 72 °C for 1.5 min., followed by 35 cycles of amplification of 94 °C for 1 min., 57 °C for 1.5 min., and 72 °C for 1 min., followed by a final elongation step of 72 °C for 5 min [4,46,47]. Products showing the correct band size were sequencing in both directions using the ABI PRISM® BigDye® Terminator v3.1 Cycle Sequencing Kit (Applied Biosystems, Waltham, MA, USA) at the Sequencing Unit, Animal and Plant Health Agency, United Kingdom. Paired bi-directional sequence traces were combined to produce a single consensus sequence (the full-length 658 bp barcode sequence). To achieve this, individual forward and reverse traces were oriented, edited, and aligned using the Sequencer (v.4.5; Genes Codes Corporation, Ann Harbour, MI, USA), GenDoc (v. 2.6.02) and ClustalX sequence analysis programs [4]. Full details for each specimen and sequence information can be found at the Barcode of Life Database (BOLD) within the “Human Pathogens and Zoonoses Initiative”, Working Group 1.4.

2.5. Genetic Data Analysis

For molecular species identification using the COI DNA barcoding region, the protocols of Hernández-Triana et al. [46,47] and Hebert et al. [12,13] were followed. Amplicons were obtained using a Qiagen PCR system following the reaction mix of Hernández-Triana et al. [4]. The dataset was analyzed in MEGA v.6 [48]. The Bayesian inference was performed in BEASTv.2.6.7 [49] using the TrNef substitution model (ln = −7561.4940) and estimated parameter priors with the Yule model. Three independent Markov chains of 10,000,000 replicates were run with sampling every 10,000. The sample parameters were combined with LogCombiner and basic parameters were checked in Tracer v.1.7.1 [50]. The sampled trees were combined with LogCombiner and then summarized with TreeAnnotator. The posterior probability was calculated for each node in a maximum clade credibility tree with a burn-in of 10%. For barcode sequences larger than 500 bp, a Barcode Index Number (BIN) was assigned and each BIN was mapped according to species. The taxonomic discordance in the dataset [4] was analyzed using BOLD as detailed in Ratnasingham and Hebert [51].

2.6. Ethical Consideration

All specimens studied during this research were collected by official personnel of the Mexican public health and vector control programs, and personnel from the Mexican network of Entomological and Bioassay Research Units (UIEBs). The different UIEBs located in most states of Mexico serve as reference laboratories for taxonomic identification of vectors collected on the field, and design specific strategies for control of vector-borne diseases. This study was approved and supported by the National Center of Preventive Programs and Disease Control (CENAPRECE).

3. Results

3.1. Mosquitoes and New Records

A total of 3515 specimens from 200 collection samples were studied. Among the specimens were 1284 fourth-instar larvae, 468 larval exuviae, 846 pupal exuviae, 32 pupae, 487 adult females, 392 adult males, and 6 dissected male genitalia. The mosquito fauna of Morelos state consists of 58 species representing the subfamilies Anophelinae and Culicinae, 6 tribes of the subfamily Culicinae, 10 genera, and 23 subgenera (Table 2). Four subgenera (Aedimorphus, Psorophora, Anoedioporpa and Micraedes) and twelve species [Aedes vexans (Meigen), Ae. euplocamus Dyar and Knab, Ae. vargasi Schick, Psorophora cilipes (Fabricius), Ps. lineata (von Humboldt), Culex restrictor Dyar and Knab, Cx. interrogator Dyar and Knab, Cx. nigripalpus Theobald, Cx. tarsalis Coquillett, Cx. sandrae Berlin, Cx. lactator Dyar and Knab and Toxorhynchites moctezuma (Dyar and Knab)] are recorded in Morelos for the first time (Table 2). One species (Cs. dugesi) was re-discovered, described and resurrected from the synonymy of Cs. particeps herein. The species accumulation curve of the 43 mosquito species collected is shown in Figure 2.

3.2. Species Originally Described in Morelos

This species-group is composed of endemic Mexican mosquito species, and although all these species were originally discovered in Morelos, they have currently also been reported in other states of Mexico. Aedes ramirezi, Ae. shannoni, Ae. chionotum, Ae. gabriel, and Ae. kompi were originally discovered in Morelos.
On 29 June 1947, immature stages of Ae. kompi were first collected by W. G. Downs from tree holes and rock holes in Tepoztlán. In this study, immature stages of Ae. kompi were collected from one tree hole with colored water at 2 m. from ground level in Tepoztlán in association with Ae. gabriel and Ae. ageypti. In Huitzilac, females of Ae. kompi were collected approaching humans during the day with partial shade in association with Cs. dugesi. Aedes kompi has been found only in Mexico State and Morelos.
On 10 June 1948, immature stages of Ae. shannoni were first collected by W. G. Downs in Cuernavaca county from temporal ground pools; since then, very few records of the presence of Ae. shannoni have been published, it being one of the most uncommon mosquito species in Mexico. In this study, immature stages of Ae. shannoni were collected from temporal ground pools with clean water and emergent vegetation with partial shade and from volcanic rock holes with clean water and partial shade in Tlaquiltenango, Puente de Ixtla and Tlayacapan counties. Females of Ae. shannoni were also collected biting humans diurnally; this species is a persistent biter, that kept biting even when the host was moving; associated species in this collection were Ae. epactius, Hg. mesodentatus, and Ae. gabriel. Aedes shannoni has been found in the states of Guerrero, Mexico State, Michoacán, Morelos, and Querétaro.
On 19 August 1965, immature stages of Ae. chionotum were first collected by D. Schroeder from tree holes in Cuernavaca. Zavortink [58] described all life stages except the eggs. Additional collection records were provided by Heinemann and Belkin [59]. During this study, immature stages of Ae. chionotum were collected from ovitraps placed in a tree above 1.5 m. from ground level with clean water and leaves at the bottom in Huitzilac and from volcanic rock holes with clean water and abundant leaves at the bottom with partial shade in Tepoztlán. Aedes chionotum has been found in Mexico State, Morelos, and Oaxaca.
On 7 September 1965, immature stages of Ae. gabriel were first collected by D. Schroeder from a large tree hole in Cuernavaca county. Schick [57] described all life stages except the eggs and additional collection records were provided by Heinemann and Belkin [59] and Ortega-Morales et al. [37]. In this study, Ae. gabriel was one of the most common species collected from tree holes, being well distributed in all sub-regions of Morelos where it finds favorable conditions. Immature stages of Ae. gabriel were collected from several tree holes with colored water and total shade and from discarded tires in Tlaquiltenango, Jojutla and Tepoztlán counties in association with Ae. epactius, Ae. chionotum, Ae. kompi, Ae. vargasi, Ae. aegypti, Ae. albopictus, Hg. equinus, Hg. mesodentatus, Cx. coronator, Cx. declarator, Cx. quinquefasciatus, Cx. stigmatosoma Cx. thriambus, Cx. corniger, Cx. lactator and Tx. mocetzuma. Additionally, immature stages were collected from rock holes in the Olmec ruins of Chimalactlán. In Tepoztlán, females associated with Ae. epactius, Ae. guerrero, Ae. shannoni and Hg. mesodentatus were collected biting humans during daylight hours. Aedes gabriel has been found in the states of Hidalgo, Jalisco, Mexico State, Morelos, and Zacatecas.
In 29 June 1969, immature stages of Ae. ramirezi were first collected by W.G. Downs from volcanic rock holes in Cuernavaca county. Zavortink [58] re-described fourth-instar larvae, pupae, and the male and female of this species, and additional collection records were provided by Heinemann and Belkin [59]. In Morelos, immature stages of Ae. ramirezi are frequently found in volcanic rock holes, which presumably are the typical aquatic habitat for this species. During this study, immature stages of Ae. ramirezi were collected from rock holes in the Olmec ruins of Chimalactlán in association with Ae. gabriel and Cx. coronator; in this same location, adults were collected resting from dry rock holes, while females were collected biting humans diurnally in Huautla; additionally, immature stages were collected from discarded tires with colored water and abundant leaves at the bottom and total shade in Huitzilac associated with Ae. epactius, Cx. coronator, Cx. quinquefasciatus, Cx. stigmatosoma and Cs. particeps. Aedes ramirezi has been found in the states of Jalisco, Morelos, Sinaloa, Sonora, and Veracruz.

3.3. Biological and Ecological Notes for the New State Records

Biological and ecological notes for each species-group are reported here. Specific notes including the collection sites, date of collection, larval habitat, aquatic parameters, and associated species are shown in Table 3.

3.3.1. Genus Aedes

Of the 19 species of Aedes known from Morelos, three are reported for the first time in the state: Ae. vexans, Ae. euplocamus and Ae. vargasi. Females of Ae. vexans were collected approaching humans at a single location in one single site in Miacatlán, while immature stages of Ae. euplocamus were collected from a temporal ground pool during the rainy season. Immature stages of Aedes vargasi were commonly found in tree holes and artificial containers in the conserved regions of the state.

3.3.2. Genus Psorophora

The subgenus Psorophora of genus Psorophora is recorded for the first time in Morelos: Ps. cilipes and Ps. lieanata were both collected from a single site each; adults of Ps. cilipes were collected resting intra-domiciliarily, while immature stages of Ps. lineata were collected from an artificial container.

3.3.3. Genus Culex

The genus Culex is the most diverse group of mosquitoes in Morelos; of the twenty-one species of Culex known, six are reported for the first time in the state, and the subgenera Anoedioporpa and Micraedes are first reported here. Immature stages of Cx. restrictor were collected from a tree hole with colored water in single site, while immature stages of Cx. interrogator were commonly found in temporal ground pools and adult stages were collected resting in vegetation, it being a common species in Morelos. Immature stages of Cx. nigripalpus were collected once from a temporal ground pool; adults of Cx. tarsalis were collected resting in vegetation with total shade; while immature stages of Cx. sandrae were collected from bromeliad axils 2–3 m above the ground in a forest region of the state, and immature stages of Cx. lactator were collected once from a tree hole in a conserved area of Morelos.

3.3.4. Genus Toxorhynchites

The genus Toxorhynchites, subgenus Lynchiella had already been previously reported in Morelos with Tx. theobaldi (Dyar and Knab) [61]. This record was misidentified with Tx. moctezuma, of which immature stages were collected from artificial containers and tree holes in one conserved forest of Morelos.

3.4. Molecular Analysis, COI-Barcoding Identification and Cryptic Diversity

In total, we analyzed 112 DNA barcode sequences of 32 species, which represents 56% of all species occurring in Morelos. Three sequences were obtained from the BOLD database from specimens collected in Querétaro, Mexico (Cs. particeps BOLD:ADQ4018) and were added to the dataset. One single sequence of Ae. shannoni (BOLD:ADP9644) was obtained; this species is a new sequence record for the COI GenBank database. Phylogenetic relationships were reconstructed by Bayesian inference (Figure 3). We did not obtain DNA barcodes for six species, as they were collected as immatures and previously mounted on microscope slides for identification, as follows: An. eiseni, An. pseudopunctipennis, Ps. lineata, Cx. declarator, Cx. nigripalpus and Cx. pilosus. A further seven species were processed, but failed to amplify DNA: Ae. vexans, Hg. mesodentatus, Ps. cilipes, Cx. tarsalis, Cx. sandrae, Cx. lactator and Ma. dyari. In general, all specimens of the same species clustered together, although there was a deep split in Cx. stigmatosoma (BOLD:ABY6041 and BOLD:AAA7661) and Cs. particeps (BOLD:ADQ4018 and BOLD:ADF3447) with two BINS for each species.
Within the genus Aedes, there are three strong groups of monophyletic species with boostrap values of more than 80%: (1) the subgenus Stegomyia: Ae. aegypti (BOLD:AAA4210) and Ae. albopictus (BOLD:AAA5870); (2) the subgenera Aztecaedes: Ae. ramirezi (BOLDADQ1468), Howardina: Ae. allotecnon (BOLDADM:1245), Ae. guerrero (BOLD:ADS4355), and Ae. quadrivittatus (BOLD:ADM1683); and Ochlerotatus: Ae. angustivittatus (BOLD:ACN9372), Ae. euplocamus (BOLD:ADL7578), Ae. shannoni, and Ae. trivittatus (BOLD:ADP6375); and (3) the subgenus Protomacleaya: Ae. chionotum (BOLD:ADV8040), Ae. gabriel (BOLD:ADM0866), Ae. idanus (BOLD:ADP8592), Ae. kompi (BOLD:ADL9968), and Ae. vargasi (BOLD:ADM0829). Within the genus Culex, the subgenera Culex: Cx. coronator (BOLD:AAN3636), Cx. interrogator (BOLD:ADL8796), Cx. quinquefasciatus (BOLD:AAA4751) Cx. stigmatosoma; and Phenacomyia: Cx. corniger (BOLD:AAF1735) formed a monophyletic group (>0.75). Finally, all specimens identified as Cs. dugesi (BOLD:ADM1783) grouped closely with Cs. particeps, although both taxa were well separated with high bootstrap support for posterior probability (Figure 3). The BINS corresponding to Cs. dugesi and Cs. particeps formed sister clades sharing a monophyletic origin (>0.75). Although Cs. dugesi did not segregate and display low support values, this group is well differentiated from the Cs. particeps clade.
The specimens placed in the clade of the Scapularis group of Aedes (Ochlerotatus) were Ae. angustivittatus, Ae. euplocamus, Ae. shannoni and Ae. trivittatus. The voucher specimen of Ae. euplocamus was identified using the Arnell [64] key, and it fits with the Ae. condolescens Dyar and Knab description; however, since the distribution of Ae. condolescens is restricted to the Antillean region, from the Greater Antilles to the Lucayan Archipelago, and it has also been reported in Florida, USA, the presence of this species in Mexico is doubtful. For this reason, the identity of this taxon is kept under the name of Ae. euplocamus until we can obtain specimens for further morphological examination. Although the affinities of Ae. shannoni with other Ochlerotatus species are unknown, it is possible that a new species-subgroup within the Scapularis group, which contain species with rings of white scales on each segment of the hind leg, including the Mexican endemic species Ae. amateuri Ortega and Zavortink and Ae. shannoni, could be related to this group of species.

3.5. Re-Description of Culiseta dugesi Dyar and Knab

Culiseta (Culiseta) dugesi Dyar and Knab type specimens: Lectotype assigned by Stone and Knight [65]: adult female without associated larval and pupal exuviae [USNMENT01935000, USNM, Waashington, DC, USA], Guanajuato, Mexico, 20 January 1905, col. A. Dugès (Figure 4 and Figure 5). Paratypes: 4 adult female, without associated larval and pupal exuviae, same data as lectotype; unspecific number of adults collected from Mexico city, Mexico, 26 October 1900, col. S. Arara. Synonymized with Cs. particps by Stone [66].
Fourth-instar larvae. Head: Setae 4-C double, 5,6-C with fewer branches and usually somewhat longer than 5-C (Figure 6A). Saddle with coarse dorsoposterior aciculae. Thorax: Integument without spicules. Abdomen: Sometimes dark spots on dorsal segments. Segment VIII: Comb scales moderate in size, evenly fringed, with sub-equal spinules. Siphon with row of single spicules distal to pecten (Figure 6B).
Pupa. Unknown.
Female. Head: Occiput and vertex covered with narrow decumbent pale scales, inter-ocular setae dark and large, pedicel orange with few pale scales. Antenna about 0.50–0.75 fore-femur length. Clypeus bare, dark-brown. Maxillary palpus about 0.25 proboscis length, three-segmented, with some pale scales. Proboscis long as fore femur, sometimes slightly longer, with pale and dark scales intermixed. Thorax: Integument of scutum yellowish or light-brown, covered with yellow bristles and yellow narrow decumbent scales, achorstichal setae absent (Figure 7). Prescutellar area dark, with dark bristles. Scutellum trilobed, with patch of creamy scales on each lobe. Integument of mesokatepisternum and mesanepimeron yellowish, mostly covered with large patch of white scales. Wing: Approximately 1.50–1.80 mm, scales on veins all narrow and dark, cross veins with scales. Halter: Dark-brown scaled. All femora speckled with pale scales, sub-apical spot of white scales, tibia intermixed with dark and pale scales, tarsomeres of each leg with basal rings of white scales on each segment. Abdomen: All tergum covered with dark scales but with some white scales, conspicuous basal bands of white scales on all terga, sternum with white scales (Figure 8).
Male. Unknown.
Systematics. Females of Cs. dugesi are distinguished from all five species within the genus Culiseta in Mexico, Cs. melanura (Coquillett), Cs. impatiens (Walker), Cs. incidens (Thompson), Cs. inornata (Williston) and Cs. particeps, by having distinct basal pale bands on their abdominal terga, hindtarsomeres with broad pale bands, cross veins of the wing with scales, femora with narrow sub-apical pale-scaled bands, and the integument of scutum and mesokatepisetrnum being yellowish colored. Larvae are distinguished by a siphon with spiniforms along the midventral line, antenna shorter than the head, a saddle with coarse dorsoposterior aciculae, and the setae 4-C double, rarely single.
Bionomics. Culiseta dugesi have been collected in four Mexican states: three of these were Guanajuato (lectotype), Mexico City, and Huitzilac municipality, Morelos, where adult females were collected approaching humans diurnally; associated species in this site were Ae. kompi and Cx. sp., while immature stages were collected from an abandoned plastic bucket filled with rain water, in conditions of total shade and with some leaves at the bottom; associated species were Cx. arizonensis and Cs. particeps; some adults of Cs. dugesi were collected resting inside the same bucket. The fourth state was Querétaro, where this species was previously reported as Culiseta n. sp. in association with Cx. thriambus and Tx. moctezuma [34]. Immature stages of Cs. dugesi could occur in natural containers such as tree holes and/or volcanic rock holes at ground level. The medical importance of Cs. dugesi is unknown.
Distribution. Culiseta dugesi has been collected in these locations: the mountains and plains of the north of Guanajuato, Guanajuato State, belonging to the Central Plateau; the northern region of the state of Morelos in Huitzilac county and Mexico City, belonging to the sub-region Lakes and Volcanoes of Anahuac, of the Neo-volcanic Axis (Figure 9); and in Pinal de Amoles county, Querétaro, belonging to the Huaesteco Carso of the Sierra Madre Oriental. Culiseta dugesi could occur in the forested regions of the states between Guanajuato and Querétaro such as Mexico State, Hidalgo, and northeastern Michoacán; all these states share physiographical conditions such as mountain forest regions above 2000 m of elevation, within the regions of Central Plateau, Neo-volcanic Axis and the Sierra Madre Oriental.
Etymology. This species was dedicated to Alfredo Dugès (1826–1910), Mexican zoologist and botanist of French origin.

3.6. Keys to Species of Larvae and Females of Culiseta in Mexico

LARVAE (Modified from Darsie and Ward [67]).
1. Siphon with row of 8–14 setae along mid-ventral line…………………….Cs. melanura
Distr. Canada, Mexico, USA [43]; Distr. Mex.: Nuevo León [68].
-Siphon with setae otherwise distributed, no mid ventral row……………………………2
2(1). Setae 5,6-C similar in size and number of branches………………………Cs. impatiens
Distr. Canada, Mexico, USA [43]; Distr. Mex.: Nuevo León, Sonora [14].
-Setae 6-C with fewer branches and usually somewhat longer than 5-C……………………3
3(2). Saddle with coarse dorsoposterior aciculae …………………………………………4
-Saddle not aciculate dorsoposteriorly………………………………………………………5
4(3). Setae 4-C branched, nearly equal in size to setae 5-6C………………….Cs. particeps
Distr. Costa Rica, El Salvador, Guatemala, Mexico, Panama, USA [43]; Distr. Mexico: Baja California, Baja California Sur, Chiapas, Coahuila, Durango, Guanajuato, Guerrero, Hidalgo, Mexico City Mexico, State, Michoacán, Morelos, Nuevo León, Oaxaca, Puebla, Sonora, Tamaulipas, Tlaxcala, Veracruz [31,56,60,69,70,71].
-Setae 4-C double, sometimes single……………………………………………Cs. dugesi
Distr. Mexico; Distr. Mex: Guanajuato, Mexico City, Morelos, Querétaro.
5(3). Setae 1-X with branches equal to length of saddle or longer………………Cs. inornata
Distr. Canada, Cuba, Mexico, USA [43]; Distr. Mex.: Aguascalientes, Baja California, Baja California Sur, Coahuila, Durango, Hidalgo, Mexico City, Mexico State, Nuevo León, Sonora, Tamaulipas, Tlaxcala [31,56,71].
-Setae 1-X with fine branches, shorter than saddle…….…………………….…Cs. incidens
Distr. Canada, Mexico, USA [43]; Distr. Mex.: Baja California, Baja California Sur, Coahuila, Mexico State, Sonora, Tlaxcala [31,35,56].
ADULT FEMALE (Modified from Darsie and Ward [67]).
1. Abdominal terga without basal pale bands……………………………………Cs. melanura
-Abdominal terga with distinct basal pale bands…………………………………………….2
2(1). Hindtarsomeres with pale scale bands on some segments…………………….………3
-Hindtarsomeres unbanded………………………………………………………………….5
3(2). Hindtarsomeres with narrow pale bands, covering less than 0.1 of hind
tarsomere 2; cross veins of wing without scales…………………………….….Cs. incidens
Hindtarsomeres with broad pale bands, covering 0.25–0.33 of hind tarsomere 2; cross veins of wing with scales……………………………….……………………………………4
4(3). Integument of scutum and mesokatepisternum dark-brown………………Cs. particeps
-Integument of scutum and mesokatepisternum yellowish or light-brown……….Cs. dugesi
5(2). Wing with dark and pale scales intermixed on anterior veins; hind tarsomeres
1,2 with dark and pale scales…………………………………………….………Cs. inornata
-Wing and hind tarsomeres all dark-scaled………………………………………Cs. impatiens

3.7. Medical Importance of the Mosquitoes of Morelos

Some of the species reported in Morelos are of medical and veterinary importance because they are vectors of pathogens causing diseases. In Table 4 the most important public health species that occur in Morelos are listed. Additionally, although the medical importance of some species is unknown, we include here the species that were collected biting humans diurnally with conditions of partial shade.

4. Discussion and Conclusions

4.1. Mosquito Species-Groups Reaching Their Distributional Limits in Morelos

Based on our collection records and the known distributions of the mosquito species collected in Morelos, two groups of species are recognized. Some species of each group have similar geographical distributions, reaching their northern or southern distributional limits in the state.

4.1.1. Group 1

Species that occur in mountain regions in south-central Mexico and reach their southernmost distributional limit in Morelos include Ae. gabriel and Cx. apicalis. Immature stages of Ae. gabriel commonly develop in tree holes, although it has been found in volcanic rock holes. Ae. gabriel is a Mexican endemic species that has been reported in the states of Morelos, Jalisco, Zacatecas [59] and Hidalgo [36]. Culex aplicalis is included in this group because it occurs in the Nearctic region, extending from western USA and southern Texas [67] into Mexico throughout the sub-region of Lakes and Volcanoes of Anahuac in Morelos, where it reaches its southernmost distributional limit.

4.1.2. Group 2

Mexican endemic species that occur in mountain regions in the central–southern area of the country and reach their northernmost distributional limit in Morelos include Ae. chionotum and Cx. sandrae. Immature stages of Ae. chionotum develop in tree holes, and it has been reported in the states of Morelos and Oaxaca [58], while immature stages of Cx. sandrae develop in bromeliad axils and it has been reported in the states of Guerrero and Oaxaca [72]. Also included in this group are species that occur in the Neotropical region that extends into Mexico, and in Morelos they reach their northernmost distributional limit, including An. parapunctipennis, Hg. anastasionis, Ps. lineata and Cx. limacifer. Except for Hg. anastasionis, which develops in tree holes, all those species develop in ground pools. All of the pools are commonly full with summer rain, but some aquatic habitats could be permanent water bodies such as lakes and swamps.

4.2. Species Not Collected during Our Collection Trips

The 12 species of this group were not collected in the present study, but records were obtained from literature reports including those from Vargas and Martínez-Palacios [54] of Anopheles parapunctipennis. This species has been reported in some states of southeastern Mexico (Chiapas, Oaxaca, and Veracruz) and Guatemala, but has also been reported in central Mexico in Nearctic environments in the states of Hidalgo [73], Puebla and Veracruz [74]. Although An. parapunctipennis is found at elevations above 2500 m, in Morelos its presence is uncommon and it is considered a rare species.
Vargas [55] encountered Culex salinarius, Cx. conspirator, Cx. erraticus, Cx. iolambdis, Cx. limacifer, Cx. apicalis, Ur. coatzacoalcos, and Ur. sapphirina. All those species develop in temporary ponds of rainwater at ground level with emerging aquatic vegetation. This type of aquatic habitat was not found frequently during our field trips. Culex salinarius is a common species that has been frequently reported in coastal regions of various states of Mexico. In central states, far from the coastal regions, this species is uncommon and can be confused in its larval stage with Cx. nigripalpus and/or Cx. erythrothorax. Culex conspirator, Cx. erraticus, Cx. iolambdis and Cx. limacifer are species that are common in tropical coastal regions; these could be found in temporary pools and ponds in southern Morelos, bordering Guerrero state, where environmental conditions are favorable to their development. In Mexico, species of the subgenus Neoculex can be commonly found in natural and artificial containers in temperate regions, particularly in the north and middle of Mexico, where the environmental conditions are related to the Nearctic region. Culex aplicalis could reach its southernmost distributional rank in Morelos. Although Ur. coatzacoalcos was not found during our collections, this species must be common during the rainy season in the southern part of Morelos, while Ur. sapphirina is one of the most common species in the genus Uranotaenia in the Nearctic region of Mexico. This species has been reported in many states of Mexico, but, however, this was also not found during our collections.
Díaz-Nájera and Vargas [56] reported finding Aedes sexlineatus, Ae. taeniorhynchus, and Psorophora columbiae. In Mexico, six species within the subgenus Howardina of Aedes are found, of which four are present in Morelos. The immature stages of all Mexican species of Howardina typically develop in epiphytic bromeliad axils, which grow on woody trees in oak forest regions. Since species of Howardina were reported for the first time in Morelos, large areas of oak forest have been deforested in Morelos, especially in the north and around the capital city of Cuernavaca, causing a conversion of the habitat decreasing the population of epiphytic bromeliads that grew naturally in this region. Possibly Ae. sexlineatus has decreased its population due to deforestation. Aedes taeniorhynchus and Ps. columbiae are common species in the coastal regions of Mexico; those species are problematic in touristic areas because of their high numbers and persistence in biting humans. In Morelos, those species were not found and they are possibly uncommon species.
Ibáñez-Bernal and Martínez-Campos [60] found Cx. bidens. This tropical species has been previously reported from Mexico to Argentina. In Mexico this species has been reported in different states where apparently it seems common in tropical regions of Mexico. However, it was not found in our collections.

4.3. Species from Adjacent Regions That May Occur in Morelos

Numerous species of mosquitoes that have not yet been reported from Morelos occur in the adjacent states of Mexico City and/or Mexico State and can logically be expected to occur within Morelos. Included among these 19 species are Anopheles aztecus Hoffmann, An. franciscanus McCracken, An. punctipennis (Say), Aedes lorraineae Berlin, Ae. muelleri Dyar, Ae. scapularis (Rondani), Ae. zoosophus Dyar and Knab, Psorophora cyanescens (Coquillett), Culex erythrothorax Dyar, Cx. pinarocampa (Dyar and Knab), Cx. pseudostigmatosoma Strickman, Cx. rejector Dyar and Knab, Culiseta incidens, Cs. inornata, Limatus durhamii (Theobald), Wyeomyia mitchellii (Theobald), Uranotaenia syntheta Dyar and Shannon, Ur. geometrica Theobald and Ur. lowii Theobald [32,33,35].

4.4. Species Names Removed from Morelos

Some species reported in Morelos in early publications are not included in this study because their names have changed since they were originally reported. The names removed from the list of Morelos fauna and the reasons for their removal are explained here. Reasons for the removal of the following: Cx. fatigans Wiedemann reported by Martini [52]; Ae. terrens (Walker), and Cx. virgultus Theobald reported by Vargas [55]; Ae. atropalpus (Coquillett); and Cx. peus Speiser reported by Díaz-Nájera and Vargas [56], are explained in a previous publication on the mosquitoes of Tamaulipas by Ortega-Morales et al. [30]. Reasons for the removal of Tx. theobaldi (Dyar and Knab) reported by Villegas-Trejo et al. [61] are given a previous publication on the mosquitoes of Nuevo León by Ortega-Morales et al. [38].
Aedes triseriatus (Say) and Cs. maccrackenae Dyar and Knab were previously reported in Morelos by Vargas [55]. However, no species of the Triseriatus group of Aedes has been reported as far south as Morelos, with the only exception being Ae. zoosophus Dyar and Knab which has been previously reported in Guerrero [75]. Records of Ae. triseriatus in Morelos were possibly misidentified with species within the Kompi and/or Terrens groups. Culiseta maccrackenae was reduced to synonymy with Cs. particeps by Stone [66].

4.5. Mosquito Diversity in Morelos and Mexico

With the addition of the new mosquito records and the new species reported in Morelos, there are currently 58 species known in the state. Morelos ranks sixth with the greatest diversity of species of the eleven Mexican states that have been systematically inventoried for mosquito species. With the addition of Culiseta dugesi to the list of mosquito species in Mexico City and Mexico, there are currently 29 species and 248 known species, respectively.

4.6. DNA Barcoding

The DNA barcodes sequences of specimens we analyzed in this study grouped together in the same clade, although we detected species with two different BINs, e.g., Cs. particeps and Cx. stigmatosoma, which might be indicative of cryptic diversity. This agrees with results obtained by [4,34,35] during integrative studies to delineate the mosquito fauna in Mexico as well in other insect groups. The specimens we here identified as Cs. dugesi show an interspecific genetic divergence of 3.77% in comparison with Cs. participes and are separated with strong support values from those identified as Cs. particeps. This supports our hypothesis that they represent a different species. The latter finding is also supported by the different morphological traits found in the adult female general coloration and larval stage.

Author Contributions

A.I.O.-M. and C.G.-A.—study conceptualization; A.I.O.-M. and L.M.H.-T.—methodology; A.I.O.-M., J.A.G.-H., C.M.R.-H., A.J.M.-G. and C.G.-A.—sampling; A.I.O.-M. and L.M.H.-T.—data curation; A.I.O.-M.—mosquito identification; L.M.H.-T. and J.M.Q.-B.—molecular analysis; A.I.O.-M.—writing and original draft preparation; L.M.H.-T. and J.M.Q.-B.—review and editing; A.I.O.-M., L.M.H.-T., C.G.-A. and F.C.-M.—project administration and founding acquisition. All authors have read and agreed to the published version of the manuscript.

Funding

Funding was provided by the National Center of Preventive Programs and Disease Control (CENAPRECE), through the Entomological and Bioassay Research Units (UIEBS) (Mexico); and the Department for Environment Food and Rural Affairs (DEFRA), Scottish Government and Welsh Government through grants SV3045, and SE4113; and the EU Framework Horizon 2020 Innovation Grant, European Virus Archive (EVAg, grant no. 653316).

Institution Review Board Statement

Not applicable.

Data Availability Statement

All mosquitoes (mounted on pins and/or microscope slides) collected in Morelos State were deposited in the Culicidae Collection (CC-UL), Parasitology Department, Universidad Autónoma Agraria Antonio Narro unidad laguna (Autonomous Agrarian University Antonio Narro laguna unit), Torreón, Coahuila, Mexico.

Acknowledgments

We thank Jorge A. Alvarado-Zapata, Eduardo Dávalos-Becerril, José I. Benítez-Alba, Vicente H. González-Álvarez, Miguel A. Moreno-García, Jorge L. Peralta-Rodríguez, Miriam J. Vázquez-Anzures, Miriam Alquisira-Domínguez, Salvador Morales-Avitia, Juan J. Castro-Xochitla, Oscar L. Galindo-Soto, and all staff from UIEBS for their valuable collaboration during the collection trips; Jaime Thirion for his hospitality during our collection trips in Morelos; David B. Pecor for his assistance during the revision of the Culiseta dugesi lectotype and preparing and photographing the type material and the original labels. This article is dedicated to the memory of Jaime Thirion-Icaza (1957–2023), teacher, colleague and friend.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Harbach, R.E. Mosquito Taxonomic Inventory. 2013. Available online: https://mosquito-taxonomic-inventory.myspecies.info (accessed on 15 April 2023).
  2. Becker, N.; Petrić, D.; Zgomba, M.; Boase, C.; Madon, M.; Dahl, C.; Kaiser, A. Mosquitoes and Their Control, 2nd ed.; Springer: Berlin/Heidelberg, Germany, 2010. [Google Scholar]
  3. Medlock, J.K.; Snow, K.R.; Leach, S.A. Possible ecology and epidemiology of medically important mosquito-borne arboviruses in Great Britain. Epidemiol. Infect. 2007, 135, 466–482. [Google Scholar] [CrossRef]
  4. Hernández-Triana, L.M.; Brugman, V.A.; Prosser, S.W.J.; Weland, C.; Nikilova, N.; Thorne, L.; de Marco, M.F.; Fooks, A.R.; Johnson, N. Molecular approaches for blood meal analysis and species identification of mosquitoes (Insecta: Diptera: Culicidae) in rural locations in southern England, United Kingdom. Zootaxa 2017, 4250, 67–76. [Google Scholar] [CrossRef]
  5. Dorvillé, L.F.M. Mosquitoes as bioindicators of forest degradation in southern Brazil, a statical evaluation of published data in the literature. Stud. Neotrop. Fauna Environ. 1996, 31, 68–78. [Google Scholar] [CrossRef]
  6. Guedes, M.L.P.; Navarro-Silva, M.A. Mosquito community composition in dynamic landscapes from the Atlantic forest biome (Diptera, Culicidae). Rev. Bras. Entomol. 2014, 58, 88–94. [Google Scholar] [CrossRef]
  7. Montagner, F.R.G.; Silva, O.S.; Jahnke, S.M. Mosquito species occurrence in association with landscape composition in green urban areas. Braz. J. Biol. 2018, 78, 233–239. [Google Scholar] [CrossRef]
  8. Cywinska, A.; Hunter, F.F.; Hebert, P.D.N. Identifying Canadian mosquitoes species through DNA barcodes. Med. Vet. Entomol. 2006, 20, 413–424. [Google Scholar] [CrossRef]
  9. Linton, Y.; Lee, A.; Curtis, C. Discovery of a third member of the Maculipennis group in SW England. Eur. Mosq. Bull. 2005, 19, 5–9. [Google Scholar]
  10. Packer, L.; Gibbs, J.; Sheffields, C.; Hanner, R. DNA barcoding and the mediocrity of morphology. Mol. Ecol. Resour. 2009, 1, 42–50. [Google Scholar] [CrossRef]
  11. Versteirt, V.; Nagy, Z.T.; Roelants, P.; Denis, L.; Breman, F.C.; Damiens, D.; Dekomick, W.; Backelijau, T.; Coosemans, M.; Van Bortel, W. Identification of Belgian mosquito species (Diptera: Culicidae) by DNA barcoding. Mol. Ecol. Resour. 2015, 15, 449–457. [Google Scholar] [CrossRef]
  12. Hebert, P.N.D.; Cywinska, A.; Ball, S.L.; deWaard, J.R. Biological identification through DNA barcodes. Proc. R. Soc. B Biol. Sci. 2003, 270, 213–321. [Google Scholar] [CrossRef]
  13. Hebert, P.N.D.; Ratnasingham, S.; deWaard, J.R. Barcoding animal life: Cytochrome c oxidase subunit 1 divergences among closely related species. Proc. R. Soc. Biol. Sci. 2003, 270, 596–599. [Google Scholar] [CrossRef] [PubMed]
  14. Ortega-Morales, A.I.; León-Espinosa, G.A.; Rodríguez-Rojas, J.J. Updated checklist of the mosquitoes (Diptera: Culicidae) of Mexico. J. Vector Ecol. 2023, 49, 28–43. [Google Scholar] [CrossRef] [PubMed]
  15. Ibáñez-Bernal, S.; Mendoza-Palmero, F.S.; Hernández-Xoliot, R.A. Mosquitos (Insecta: Diptera: Culicidae). In La Biodiversidad de Veracruz Estudio de Estado, Vol. II.; Cruz-Angón, A., Lorca-Hernández, F.G., Hernández-Ortiz, V., Morales-Mavil., J.E., Eds.; Comisión Nacional para el Conocimiento y Uso de la Biodiversidad CONABIO: Mexico City, México, 2011; pp. 399–403. [Google Scholar]
  16. Mendez-Andrade, A.; Rivera-García, K.D.; Ibáñez-Bernal, S. Notes on the Toxorhynchites of Mexico: Redescription of Tx. moctezuma (Dyar & Knab) and new record for Tx. grandiosus (Williston) in Veracruz (Diptera: Culicidae). Zootaxa 2019, 4576, 140–150. [Google Scholar]
  17. Rivera-García, K.D.; Méndez-Andrade, A.; Ibáñez-Bernal, S. Trichoprosopon mixtli sp. nov., a new sabethini species (Diptera: Culicidae) from a Mexican cloud forest, with an assessment of the genus and keys for the identification pk known species. Zootaxa 2023, 5254, 94–116. [Google Scholar] [CrossRef]
  18. Torres-Chable, O.M.; Baak-Baak, C.M.; Cigarroa-Toledo, N.; Zaragoza-Vera, C.V.; Arjona-Jiménez, G.; Moreno-Perez, L.G.; Machain-Williams, C.; García-Rejon, J. Mosquito fauna un home environments of Tabasco, Mexico. Southwest. Entomol. 2017, 42, 969–982. [Google Scholar] [CrossRef]
  19. Ortega-Morales, A.I.; Méndez-López, R.; Garza-Hernández, J.A.; González-Álvarez, V.H.; Ruiz-Arrondo, I.; Huerta-Jiménez, H.; Rodríguez-Martínez, L.M.; Rodríguez-Pérez, M.A. The mosquitoes (Diptera: Culicidae) of Tabasco, Mexico. J. Vector Ecol. 2019, 44, 57–67. [Google Scholar] [CrossRef]
  20. Rodríguez-Martínez, L.M.; Yzquierdo-Gómez, P.; González-Acosta, C.; Correa-Morales, F. First record of Aedes (Ochlerotatus) fulvus in Tabasco and distribution notes of other Aedes in Mexico. Southwest. Entomol. 2020, 45, 263–268. [Google Scholar] [CrossRef]
  21. Ortega-Morales, A.I.; Rodríguez-Martínez, L.M.; Méndez-Alvarado, W.; Garza-Hernández, J.A.; López-Hernández, I.; Medrano-Santillana, M.; González-Acosta, C.; Correa-Morales, F. The distribution of Uranotaenia sapphirina and Ur. socialis in Tabasco, southern Mexico. J. Am. Mosq. Control Assoc. 2022, 38, 141–147. [Google Scholar] [CrossRef]
  22. Ortega-Morales, A.I.; Mis-Ávila, P.C.; Elizondo-Quiroga, A.; Harbach, R.E.; Siller-Rodríguez, Q.K.; Fernández-Salas, I. The mosquitoes of Quintana Roo state, Mexico (Diptera: Culicidae). Acta Zool. Mex. (N.S.) 2010, 26, 33–46. [Google Scholar] [CrossRef]
  23. Ordóñez-Sánchez, F.; Sánchez-Trinidad, A.; Mis-Ávila, P.; Canul-Amaro, G.; Fernández-Salas, I.; Ortega-Morales, A.I. Nuevos registros de mosquitos (Diptera: Culicidae) en algunas localidades de Campeche y Quintana Roo. Entomol. Mex. 2013, 12, 850–854. [Google Scholar]
  24. Chan-Chablé, R.J.; Ortega-Morales, A.I.; Martínez-Arce, A. First record of Psorophora albipes in Quintana Roo, Mexico. J. Am. Mosq. Control Assoc. 2016, 32, 237–239. [Google Scholar] [CrossRef]
  25. Ortega-Morales, A.I.; Casas-Martínez, M.; Bond, G.; Harbach, R.E. First records of Psorophora cilipes and Culex theobaldi in Quintana Roo, Mexico. J. Am. Mosq Control Assoc. 2018, 34, 124–127. [Google Scholar] [CrossRef] [PubMed]
  26. Chan-Chablé, R.J.; Martínez-Arce, A.; Mis-Ávila, P.C.; Ortega-Morales, A.I. DNA barcodes and evidence of cryptic diversity of anthropophagous mosquitoes in Quintana Roo, Mexico. Ecol. Evol. 2019, 9, 4692–4705. [Google Scholar] [CrossRef] [PubMed]
  27. Chan-Chablé, R.J.; Martínez-Arce, A.; Ortega-Morales, A.I.; Mis-Ávila, P.C. New records and updated checklist of mosquito species in Quintana Roo, Mexico, using DNA-Barcoding. J. Am. Mosq Control Assoc. 2020, 36, 264–268. [Google Scholar] [CrossRef] [PubMed]
  28. Canto-Mis, K.L.; Chan-Chablé, R.J.; Gómez-Rivera, A.S.; López-Sosa, X.Y.; González-Acosta, C.; Correa-Morales, F.; Mis-Ávila, P.C. Nuevos registros de distribución para Uranotaenia sapphirina (Osten Sacken, 1868) (Diptera: Culicidae) en Quintana Roo, México. Rev. Chilena Entomol. 2021, 47, 613–617. [Google Scholar] [CrossRef]
  29. Canto-Mis, K.L.; Gómez-Rivera, A.S.; Chan-Chablé, R.J.; González-Acosta, C.; Correa-Morales, F.; Mis-Ávila, P.C. Primer registro de distribución para Psorophora varipes (Coquillett, 1904) (Diptera: Culicidae) en Quintana Roo, México. Rev. Chilena Entomol. 2022, 48, 293–297. [Google Scholar] [CrossRef]
  30. Ortega-Morales, A.I.; Zavortink, T.J.; Huerta-Jiménez, H.; Sánchez-Rámos, F.J.; Valdés-Perezgasga, M.T.; Reyes-Villanueva, F.; Siller-Rodríguez, Q.; Fernández-Salas, I. Mosquito records from Mexico: The mosquitoes (Diptera: Culicidae) of Tamaulipas state. J. Med. Entomol. 2015, 52, 171–184. [Google Scholar] [CrossRef] [PubMed]
  31. Muñoz-Cabrera, L.O.; Ibáñez-Bernal, S.; Corona-Vargas, M.C. Los mosquitos (Diptera: Culicidae) de Tlaxcala, México. I: Lista comentada de especies. Folia Entomol. Mex. 2006, 45, 223–271. [Google Scholar]
  32. Dampf, A. Distribución y ciclo annual de Uranotaenia syntheta Dyar & Shannon en México y descripción del hipopigio masculine (Insecta, Diptera). Rev. Soc. Mex. Hist. Nat. 1943, 4, 147–170. [Google Scholar]
  33. Dávalos-Becerril, E.; Correa-Morales, F.; González-Acosta, C.; Santos-Luna, R.; Peralta-Rodríguez, J.; Pérez-Rentería, C.; Ordóñez-Álvarez, R.; Huerta, H.; Carmona-Perez, M.; Díaz-Quiñonez, J.A.; et al. Urban and semi-urban mosquitoes of Mexico City: A risk for endemic mosquito borne-disease transmission. PLoS ONE 2019, 14, e0212987. [Google Scholar] [CrossRef]
  34. Ortega-Morales, A.I.; Hernández-Triana, L.M.; Siller-Rodríguez, Q.K. The mosquitoes of Querétaro, Mexico: Distribution, ecology, and the discovery of Shannoniana huasteca n. sp. (Diptera: Culicidae). Diversity 2023, 15, 697. [Google Scholar] [CrossRef]
  35. Adeniran, A.A.; Hernández-Triana, L.M.; Ortega-Morales, A.I.; Garza-Hernández, J.A.; de la Cruz-Ramos, J.; Chan-Chablé, R.J.; Vázquez-Marroquín, R.; Huerta-Jiménez, H.; Nikolova, N.I.; Fooks, A.R.; et al. Identification of mosquitoes (Diptera: Culicidae) from Mexico State, Mexico using morphology and COI DNA barcoding. Acta Trop. 2021, 213, 105730. [Google Scholar] [CrossRef] [PubMed]
  36. Ortega-Morales, A.I.; Zavortink, T.J.; Huerta-Jiménez, H.; Ibáñez-Bernal, S.; Siller-Rodríguez, Q.K. The mosquitoes (Diptera: Culicidae) of Hidalgo state, Mexico. Acta Trop. 2019, 189, 94–103. [Google Scholar] [CrossRef]
  37. Ortega-Morales, A.I.; Pérez-Paredes, M.G.; Siller-Rodríguez, Q.K.; Moreno-García, M.; González-Acosta, C.; Correa-Morales, F. First record of Aedes gabriel in Hidalgo state, Mexico. J. Am. Mosq Control Assoc. 2019, 35, 51–54. [Google Scholar] [CrossRef] [PubMed]
  38. Ortega-Morales, A.I.; Zavortink, T.J.; Garza-Hernández, J.A.; Siller-Rodríguez, Q.K.; Fernández-Salas, I. The mosquitoes (Diptera: Culicidae) of Nuevo León, Mexico, with descriptions of two new species. PLoS ONE 2019, 14, e0217694. [Google Scholar] [CrossRef] [PubMed]
  39. Villegas-Ramírez, H.M.; Ortega-Morales, A.I.; Flores-Suárez, A.; Fernández-Salas, I.; Ponce-García, G. First record of Aedes podographicus in Nuevo León state, Mexico. J. Am. Mosq Control Assoc. 2021, 37, 87–89. [Google Scholar] [CrossRef] [PubMed]
  40. Ortega-Morales, A.I.; Morillón-Borjón, G.; Morales-Avitia, I.J.; Sánchez-García, A.A.; Ayala-Sulca, Y.O.; Sánchez-Rámos, F.J. First record of Wyeomyia mitchellii in Nuevo León, Mexico. J. Am. Mosq Control Assoc. 2022, 38, 216–218. [Google Scholar] [CrossRef] [PubMed]
  41. INEGI. Instituto Nacional de Estadística y Geografía. 2018. Available online: https://cuentame.inegi.org.mx/monografias/informacion/mor/territorio/relieve.aspx?tema=me&e=17 (accessed on 15 September 2023).
  42. Harbach, R.E.; Knight, K.L. Taxonomist´s Glossary of Mosquito Anatomy; Plexus Publishing, Inc.: Marlton, NJ, USA, 1980; ISBN 9780937548004. [Google Scholar]
  43. Wilkerson, R.C.; Linton, T.-M.; Strickman, D. Mosquitoes of the World. Vol. 2; Johns Hopkins University Press: Baltimore, MD, USA, 2021. [Google Scholar]
  44. Montero-Pau, J.; Gómez, A.; Muñoz, J. Application of an inexpresive and high throughput genomic DNA extraction method for the molecular ecology of zooplanktonic diapausing eggs. Limnol. Oceanogr. 2008, 6, 218–222. [Google Scholar] [CrossRef]
  45. Folmer, O.; Black, M.; Hoeh, W.; Lutz, T.; Vrijenhoek, R. DNA Primers for amplification of mitochondrial Cytochrome c Oxidase Subunit I from diverse Metazoan Invertebrtes. Mol. Mar. Biol. Biotechnol. 1994, 3, 294–299. [Google Scholar]
  46. Hernández-Triana, L.M.; Crainey, J.L.; Hall, A.; Faith, F.; Mackenzie-Dodds, J.; Shelley, A.J.; Zhou, X.; Post, R.G.; Gregory, R.T.; Hebert, P.N.D. The utility of DNA barcoding for species identification within the blackfly subgenus Trichodagmia Enderlein (Diptera: Simuliidae: Simulium) and related taxa in the New World. Zootaxa 2012, 3154, 43–69. [Google Scholar]
  47. Hernández-Triana, L.M.; Prosser, S.W.; Rodríguez-Pérez, M.A.; Chaverri, L.G.; Hebert, P.N.D.; Gregory, T.R. Recovery of DNA barcodes from blackfly museum specimens (Diptera: Simuliidae) using primer sets that target a variety of sequence lengths. Mol. Ecol. Resour. 2014, 4, 508–518. [Google Scholar] [CrossRef] [PubMed]
  48. Tamura, K.; Peterson, D.; Peterson, N.; Stoecher, G.; Nei, M.; Kumar, S. MEGA 5. 2007. Available online: http://www.megasoftware.net (accessed on 15 April 2020).
  49. Bouckaert, R.; Vaughan, T.G.; Barido-Sottani, J.; Duchêne, S.; Fourment, M.; Gavryushkina, A.; Heled, J.; Jones, G.; Kuhnet, D.; De Maio, N.; et al. BEAST 2.5: An advanced softwere platform for Bayesian evolutionary analysis. PLoS Comput. Biol. 2019, 15, e1006650. [Google Scholar] [CrossRef] [PubMed]
  50. Rambaut, A.; Drummond, A.J.; Xie, D.; Baele, G.; Suchard, M.A. Posterior summarization in Bayesian phylogenetics using Tracer 1. Syst. Biol. 2018, 67, 901–904. [Google Scholar] [CrossRef] [PubMed]
  51. Ratnasingham, S.; Hebert, P.N.D. A DNA-Based registry for all animal species: The barcode index number (BIN) system. PLoS ONE 2013, 8, e66213. [Google Scholar] [CrossRef]
  52. Martini, E.W. Los Mosquitos de México; Boletín técnico, Departamento de Salubridad: Mexico City, Mexico, 1935. [Google Scholar]
  53. Vargas, L.; Downs, W.G. Tres especies nuevas de Aedes (Diptera, Culicidae). Rev. Soc. Mex. Hist. Nat. 1950, 11, 160–177. [Google Scholar]
  54. Vargas, L.; Martínez-Palacios, A. Anofelinos Mexicanos, Taxonomía y Distribución; Secretaría de Salud: Ciudad de México, México, 1956; p. 181. [Google Scholar]
  55. Vargas, L. Especies y distribución de mosquitos mexicanos no Anofelinos (Insecta, Diptera). Rev. Inst. Salubr. Enf. Trop. 1956, 1, 19–36. [Google Scholar]
  56. Díaz-Nájera, A.; Vargas, L. Mosquitos mexicanos: Distribución geográfica actualizada. Rev. Inv. Salud Pública. 1973, 33, 111–125. [Google Scholar]
  57. Schick, R.X. Mosquito studies (Diptera, Culicidae) XX. The Terrens group of Aedes (Finlaya). Contrib. Am. Entomol. Inst. 1970, 5, 1–158. [Google Scholar]
  58. Zavortink, T.J. Mosquito studies (Diptera, Culicidae) XXVIII. The New World species formerly placed in Aedes (Finlaya). Contrib. Am. Entomol. Inst. 1972, 8, 1–206. [Google Scholar]
  59. Heinemann, S.J.; Belkin, J.N. Collection records of the project “Mosquitoes of Middle America” Mexico (MEX, MF, MT, MX). Mosq. Syst. 1977, 9, 483–535. [Google Scholar]
  60. Ibáñez-Bernal, S.; Martínez-Campos, C. Clave para la identificación de larvas de mosquitos comunes en las áreas urbanas y suburbanas de la República Mexicana (Diptera: Culicidae). Folia Entomol. Mex. 1994, 92, 43–73. [Google Scholar]
  61. Villegas-Trejo, A.; Manrique-Saide, P.; Che-Mendoza, A.; Cruz-Canto, W.; González-Fernández, M.; González-Acosta, C.; Dzul-Manzanilla, F.; Huerta, H.; Arredondo-Jiménez, J.A. First report of Aedes albopictus and other mosquito species in Morelos, Mexico. J. Am. Mosq. Control Assoc. 2010, 26, 321–323. [Google Scholar] [CrossRef] [PubMed]
  62. Ortega-Morales, A.I.; Moreno-García, M.; González-Acosta, C.; Correa-Morales, F. Mosquito surveillance in Mexico: The use of ovitraps for Aedes aegypti, Ae. albopictus, and non-target species. Fla. Entomol. 2018, 101, 623–626. [Google Scholar] [CrossRef]
  63. Hernández-Guevara, L.F.; Sánchez-Ramos, F.J.; Chan-Chable, R.J.; Hernández-Triana, L.M.; Valdés-Perezgasga, M.T.; González-Acosta, C.; Correa-Morales, F. First record of Mansonia dyari in the state of Morelos, Mexico, based on morphology and COI DNA Barcoding. J. Am. Mosq. Control Assoc. 2020, 36, 33–36. [Google Scholar] [CrossRef] [PubMed]
  64. Anrell, J.H. Mosquito studies (Diptera, Culicidae) XXXIII. A revision of the Scapularis group of Aedes (Ochlerotatus). Contrib. Am. Entomol. Inst. 1976, 13, 1–144. [Google Scholar]
  65. Stone, A.; Knight, K. Type specimens of moquitoes in the United States National Museum: VI, Miscellaneous genera, addenda, and summary. J. Wash. Acad. Sci. 1957, 47, 196–202. [Google Scholar]
  66. Stone, A. Types of mosquitoes described by C. F. Adams in 1903 (Diptera, Culicidae). J. Kans. Entomol. Soc. 1958, 31, 235–237. [Google Scholar]
  67. Darsie, R.F.; Ward, R.A. Identification and Geographical Distribution of the Mosquitoes of North America, North of Mexico. University Press of Florida: Gainesville, FL, USA, 2005. [Google Scholar]
  68. Ortega-Morales, A.I.; Elizondo-Quiroga, A.; González-Villarreal, D.A.; Siller-Rodríguez, Q.K.; Reyes-Villanueva, F.; Fernández-Salas, I. First record of Culiseta melanura in Mexico, with additional Mexican records for Aedes sollicitans. J. Am. Mosq. Control Assoc. 2009, 25, 100–102. [Google Scholar] [CrossRef]
  69. Dzul-Manzanilla, F.A.; Manrique-Saide, P.; Huerta-Jiménez, H.; Morales-Rios, E.; Ventura-Juarez, O.; Hernández-Herrera, L. Mosquitos (Diptera: Culicidae) del estado de Guerrero, México. Entomol. Mex. 2013, 12, 659–861. [Google Scholar]
  70. Viveros-Santos, V.; Zumaquero-Rios, J.L.; Sandoval-Ruiz, C.A. Ensamble de mosquitos (Diptera: Culicidae) en la región central del estado de Puebla, México. Entomol. Mex. 2015, 2, 655–661. [Google Scholar]
  71. Pérez-Santiago, G.; Hernández-Amparan, S.; Ibáñez-Bernal, S.; Correa-Ramírez, M.M. First report of mosquitoes of the urban area of Durango City, Durango. Rev. Lat. Amb. Cienc. 2018, 9, 805–820. [Google Scholar]
  72. Berlin, O.G.W. Mosquito studies (Diptera, Culicidae) XVIII. The subgenus Micraedes of Culex. Contrib. Am. Entomol. Inst. 1969, 5, 21–63. [Google Scholar]
  73. Ibáñez-Bernal, S. Los mosquitos del estado de Hidalgo, México (Diptera: Culicidae). In Investigaciones Recientes Sobre Flora y Fauna de Hidalgo, México; Villaviciencio, M.A., Marmolejo, Y., Pérez, B.E., Eds.; Universidad Autónoma de Hidalgo: Pachuca, Hidalgo, Mexico, 1993; pp. 233–337. [Google Scholar]
  74. Beltrán-Aguilar, A.; Ibáñez-Bernal, S.; Mendoza-Palmero, F.; Sandoval-Ruiz, C.A.; Hernández-Xoliot, R.A. Taxonomía y distribución de los anofelinos en el estado de Veracruz, México (Diptera: Culicidae, Anophelinae). Acta Zool. Mex. 2011, 27, 601–755. [Google Scholar] [CrossRef]
  75. Sánchez-Trinidad, A.; Ordóñez-Sánez, F.; Valdés-Perezgasga, M.T.; Sánchez-Ramos, F.J.; Zavortink, T.; Cortés-Guzmán, A.J.; Ortega-Morales, A.I. Geographical distribution of the Aedes Triseriatus group (Diptera: Culicidae) in Mexico. J. Vector Ecol. 2014, 39, 134–137. [Google Scholar] [CrossRef] [PubMed]
Diversity 16 00261 g001
Figure 1. Physiography of Morelos state. Map originally elaborated for this article.
Figure 1. Physiography of Morelos state. Map originally elaborated for this article.
Diversity 16 00261 g001
Diversity 16 00261 g002
Figure 2. Species accumulation curve for the 43 mosquito species (200 collections) collected in Morelos during 2009–2018.
Figure 2. Species accumulation curve for the 43 mosquito species (200 collections) collected in Morelos during 2009–2018.
Diversity 16 00261 g002
Diversity 16 00261 g003
Figure 3. Bayesian phylogenetic tree of COI DNA barcode of the mosquitoes of Morelos. Red box shows the Culiseta dugesi sequences.
Figure 3. Bayesian phylogenetic tree of COI DNA barcode of the mosquitoes of Morelos. Red box shows the Culiseta dugesi sequences.
Diversity 16 00261 g003
Diversity 16 00261 g004
Figure 4. Culiseta dugesi lectotype (A) General aspect of adult female; (B) Dorsal view of head and occiput; (C) Lateral view of proboscis; (D) Original labels.
Figure 4. Culiseta dugesi lectotype (A) General aspect of adult female; (B) Dorsal view of head and occiput; (C) Lateral view of proboscis; (D) Original labels.
Diversity 16 00261 g004
Diversity 16 00261 g005
Figure 5. Culiseta dugesi lectotype (A) Dorsal view of scutum; (B) Lateral view of thorax; (C) Dorsal view of abdomen; (D) Wing.
Figure 5. Culiseta dugesi lectotype (A) Dorsal view of scutum; (B) Lateral view of thorax; (C) Dorsal view of abdomen; (D) Wing.
Diversity 16 00261 g005
Diversity 16 00261 g006
Figure 6. Immature stages of Culiseta dugesi (A) Arrow point to the Setae 4-C double; (B) siphon with row of single spicules distal to pecten.
Figure 6. Immature stages of Culiseta dugesi (A) Arrow point to the Setae 4-C double; (B) siphon with row of single spicules distal to pecten.
Diversity 16 00261 g006
Diversity 16 00261 g007
Figure 7. Lateral view of adult female of Culiseta dugesi. Arrows point to the integument of scutum, mesokatepisternum and mesanepimeton which is yellowish and light-brown.
Figure 7. Lateral view of adult female of Culiseta dugesi. Arrows point to the integument of scutum, mesokatepisternum and mesanepimeton which is yellowish and light-brown.
Diversity 16 00261 g007
Diversity 16 00261 g008
Figure 8. Dorsal view of adult female of Culiseta dugesi. Arrow point to the abdomen with tergum covered with dark scales and some white scales, conspicuous basal bands of white scales on all segments.
Figure 8. Dorsal view of adult female of Culiseta dugesi. Arrow point to the abdomen with tergum covered with dark scales and some white scales, conspicuous basal bands of white scales on all segments.
Diversity 16 00261 g008
Diversity 16 00261 g009
Figure 9. Collection site of Culiseta dugesi showing the conserved vegetation of temperate forest. The site is near the “Lagoons of Zempoala” National Park in Huitizilac, Morelos, Mexico.
Figure 9. Collection site of Culiseta dugesi showing the conserved vegetation of temperate forest. The site is near the “Lagoons of Zempoala” National Park in Huitizilac, Morelos, Mexico.
Diversity 16 00261 g009
Table 1. Description of the physiography of Morelos and list of municipalities sampled [41].
Table 1. Description of the physiography of Morelos and list of municipalities sampled [41].
Region (Sub-Region)Municipalities SampledDescription of Sub-Regions
Neo-volcanic Axis (Lakes and Volcanoes of Anahuac)Axochiapan, Ayala, Cuautla, Cuernavaca, Huitzilac, Jantetelco, Jonacatepec, Temoac, Tepalcingo, Tepoztlán, Tetela del Volcán, Tlanepantla, Tlayacapan, Yecapixtla, ZacualpanThis sub-region has a relief with hills and mountains with elevations above 3000 m., the climate is temperate humid, cool in summer. Extensive regions of pine and oak forest, as well as shrub lands and grasslands.
Neo-volcanic Axis (Mountain Ranges of Southern Puebla)Amacuzac, Jojutla, Tepalcingo, TlaquiltenangoThis sub-region is composed of volcanic rocks and hills, some mountains with elevations above 1500 m, the climate is temperate humid in winter and warm humid in summer. Extensive areas of sub-tropical forest and grasslands.
South Mountain Range
(Mountain Ranges and Valleys of Guerrero)		Mazatepec, Miacatlán, Puente de Ixtla, Xoxocotla, Yautepec,This sub-region is made up of small canyons and lower mountains, the climate is warm and humid, with rains during the summer. The vegetation is composed of grasslands, shrubs, copal and amate forests
Table 2. Checklist of the mosquito species of Morelos. Ma: Martini [52]; VD: Vargas and Downs [53]; VM: Vargas and Martínez-Palacios [54]; Va: Vargas [55]; DV: Díaz-Nájera and Vargas [56]; Sc: Schick [57]; Za: Zavortink [58]; HB: Heinemann and Belkin [59]; IM: Ibáñez-Bernal and Martínez-Campos [60]; Vi: Villegas-Trejo et al. [61]; Or: Ortega-Morales et al. [62]; He: Hernández-Guevara et al. [63]; F.R.: First recorded; NSR: New state record; NS: New species. New records for Morelos are indicated in bold.
Table 2. Checklist of the mosquito species of Morelos. Ma: Martini [52]; VD: Vargas and Downs [53]; VM: Vargas and Martínez-Palacios [54]; Va: Vargas [55]; DV: Díaz-Nájera and Vargas [56]; Sc: Schick [57]; Za: Zavortink [58]; HB: Heinemann and Belkin [59]; IM: Ibáñez-Bernal and Martínez-Campos [60]; Vi: Villegas-Trejo et al. [61]; Or: Ortega-Morales et al. [62]; He: Hernández-Guevara et al. [63]; F.R.: First recorded; NSR: New state record; NS: New species. New records for Morelos are indicated in bold.
TaxaF.R.TaxaF.R.
Anopheles (Anopheles) Culex (Anoedioporpa)
1. An. eiseni CoquillettVM30. Cx. restrictor Dyar and KnabNSR
2. An. parapunctipennis Martini VMCulex (Culex)
3. An. pseudopunctipennis TheobaldVM31. Cx. bidens Dyar and KnabIM
Aedes(Aedimorphus) 32. Cx. coronator Dyar and KnabVa
4. Ae. vexans (Meigen)NSR33. Cx. declarator Dyar and KnabDV
Aedes (Aztecaedes) 34. Cx. interrogator Dyar and KnabNSR
5. Ae. ramirezi Vargas and DownsVD35. Cx. nigripalpus TheobaldNSR
Aedes (Georgecriagius) 36. Cx. quinquefasciatus SayMa
6. Ae. epactius Dyar and KnabDV37. Cx. restuans TheobaldVi
Aedes (Howardina) 38. Cx. salinarius CoquillettVa
7. Ae. allotecnon Kumm, Komp, and RuizDV39. Cx. stigmatosoma DyarMa
8. Ae. guerrero BerlinHB40. Cx. tarsalis CoquillettNSR
9. Ae. quadrivittatus (Coquillett)Va41. Cx. thriambus DyarVa
10. Ae. sexlineatus (Theobald)DVCulex (Melanoconion)
Aedes (Ochlerotatus) 42. Cx. conspirator Dyar and KnabVa
11. Ae. angustivittatus Dyar and KnabVa43. Cx. erraticus (Dyar and Knab)Va
12. Ae. shannoni Vargas and DownsVD44. Cx. iolambdis DyarVa
13. Ae. euplocamus Dyar and KnabNSR45. Cx. limacifer KompVa
14. Ae. taeniorhynchus (Wiedemann)DV46. Cx. pilosus (Dyar and Knab)Va
15. Ae. trivittatus (Coquillett)HBCulex (Micraedes)
Aedes (Protomacleaya) 47. Cx. sandrae BerlinNSR
16. Ae. chionotum ZavortinkZaCulex (Neoculex)
17. Ae. gabriel SchickSc48. Cx. apicalis AdamsVa
18. Ae. idanus SchickHB49. Cx. arizonensis BohartVa
19. Ae. kompi Vargas and DownsVDCulex (Phenacomyia)
20. Ae. vargasi SchickNSR50. Cx. corniger TheobaldVi
Aedes (Stegomyia) 51. Cx. lactator Dyar and KnabNSR
21. Ae. aegypti (Linneaus)VaLutzia (Lutzia)
22. Ae. albopictus (Skuse)Vi52. Lt. bigoti (Bellardi)Va
Haemagogus (Haemagogus) Culiseta (Culiseta)
23. Hg. anastasionis DyarDV53. Cs. dugesi Dyar and KnabNSR
24. Hg. equinus TheobaldOr54. Cs. particeps (Adams)DV
25. Hg. mesodentatus Komp and KummDVMansonia (Mansonia)
Psorophora (Grabhamia) 55. Ma. dyari Belkin, Heinemann, and PageHe
26. Ps. columbiae (Dyar and Knab)DVToxorhynchites (Lynchiella)
Psorophora (Janthinosoma) 56. Tx. moctezuma (Dyar and Knab)NSR
27. Ps. ferox (von Humboldt)
Psorophora (Psorophora)
28. Ps. cilipes (Fabricius)
29. Ps. lineata (von Humboldt)		HB
NSR
NSR		Uranotaenia (Uranotaenia)
57. Ur. coatzacoalcos Dyar and Knab
58. Ur. sapphirina (Osten Sacken)		Va
Va
Table 3. Collection records of the newly reported species found in Morelos, Mexico. The type of aquatic habitat of the immature stages or environmental condition where adults were collected (pH, temperature in Celsius degrees scale, and dissolved salts in scale of parts per million; the location and county within Morelos where species were collected; the geographic coordinates in scale of degrees, minutes, and seconds; elevation (meters above sea level); date of collection; and associated species of each collection.
Table 3. Collection records of the newly reported species found in Morelos, Mexico. The type of aquatic habitat of the immature stages or environmental condition where adults were collected (pH, temperature in Celsius degrees scale, and dissolved salts in scale of parts per million; the location and county within Morelos where species were collected; the geographic coordinates in scale of degrees, minutes, and seconds; elevation (meters above sea level); date of collection; and associated species of each collection.
SpeciesHabitat/ParametersEnvironmentLocation, CountyCoordinate/ElevationCollection
Date		Associated spp.
Aedes vexansHuman-bitingShrub region Miacatlán18°46′44″ N–99°21′50″ W, 1004 m.12 September 2017No associated spp.
Aedes euplocamusTemporal ground pool with clear water (pH 7.9, 23 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′52.61″ N–99°0′44.5″ W, 1098 m.7 June 2017Ae. shannoni, Ae. trivittatus, Cx. stigmatosoma
Aedes vargasiTree hole, colored water, (pH 9.8, >2000 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′16″ N–99°0′50.94″ W, 1118 m.8 June 2017Ae. gabriel, Tx. moctezuma
Tree hole (Licania arborea Seeman), colored water, (pH 8.5, 470 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′26.44″ N–99°1′5.75″ W, 1125 m.8 June 2017Hg. equinus
Tree hole (Ruprechtia fusca Meyer), colored water, (pH 8.9, 950 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′26.44″ N–99°1′5.75″ W, 1125 m.8 June 2017Ae. gabriel, Hg. equinus
Tree hole (Bursera lancifolia Schltdl.,), colored water, (pH 8.10, 418 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′26.44″ N–99°1′5.75″ W, 1125 m.8 June 2017Ae. gabriel, Hg. mesodentatus, Cx. lactator
Tree hole (Licania arborea Seeman), colored water, (pH 8.17, 218 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′52.23″ N–99°0′50.04″ W, 1121 m.8 June 2017Ae. gabriel, Cx. stigmatosoma, Cx. corniger
Discarded tire, clean water, (pH 8, 145 PPM, 29 °C)Mountain regionQuilamula, Tlaquiltenango18°30′32.33″ N–99°1′7.97″ W, 1089 m.7 June 2017Ae. gabriel
Plastic bottle, colored water, (pH 7.18, 3.75 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′39.82″ N–99°0′53.12″ W, 1087 m.8 June 2017Ae. albopictus
Adults resting intra-domiciliaryMountain regionQuilamula, Tlaquiltenango18°30′40.8″ N–99°1′10.47″ W, 1087 m.7 June 2017Hg. mesodentatus
Psorophora cilipesAdults resting intra-domiciliaryShrub regionMiacatlán18°46′44″ N–99°21′50″ W, 1004 m.12 September 2017No associated spp.
Psorophora lineataArtificial pool with clean water without vegetationUrban areaTepoztlán18°58.908′ N–99°6.66″ W, 1793 m.12 July 2009No associated spp.
Culex restrictorTree hole, colored water with abundant leavesMountain regionSan Andrés de la Cal, Tepoztlán18°57′21″ N–99°6′46″ W, 1487 m.2 July 2017Ae. albopictus
Culex interrogatorTemporal ground pool with clean water and abundant emergent vegetation (pH 9.38, 798 PPM)Hills regionTehuixtla, Jojutla18°33′55″ N–99°16′7″ W, 884 m.13 June 2017Ae. epactius, Cx. coronator
Temporal ground pool with colored water (pH 9.96, 187 PPM)Hills regionPuente de Ixtla18°36′47″ N–99°18′45″ W, 898 m.14 June 2017Ae. epactius, Cx. coronator, Cx. stigmatosoma
Temporal ground pool with clean water and abundant vegetation (pH 9.53, 246 PPM)Hills regionPuente de Ixtla18°36′47″ N–99°18′45″ W, 898 m.14 June 2017Cx. coronator, Cx. stigmatosoma, Cx. quinquefasciatus
Temporal ground pool with colored water and abundant vegetation (pH 9.53, 246 PPM)Hills regionPuente de Ixtla18°37′20″ N–99°19′7″ W, 902 m.14 June 2017Ae. epactius, Ae. shannoni, Cx. coronator
Temporal ground pool with clean water and abundant vegetationMountain regionMazatepec18°43′21.78″ N–99°21′24.03″ W, 968 m.14 June 2017Cx. coronator, Cx. quinquefasciatus, Cx. stigmatosoma
Temporal ground pool with clean water and abundant vegetationHills regionXoxocotla, Puente de Ixtla18°39′42″ N–99°13′33″ W, 940 m.14 June 2017Cx. coronator, Cx. stigmatosoma
Adults resting in vegetation, total shadeHills regionJojutla18°36′27″ N–99°11′1″ W, 880 m.14 June 2017Cx. coronator
Culex nigripalpusTemporal ground pool with clean water, abundant vegetation and green algae (pH 8.1, 266 PPM, 29 °C)Mountain regionQuilamula, Tlaquiltenango18°30′52.61″ N–99°0′44.5″ W, 1098 m.7 June 2017An. pseudopunctipennis, Ae. shannoni, Cx. coronator, Cx. declarator
Culex tarsalisAdults resting in vegetation, total shadeHills regionJojutla18°36′27″ N–99°11′1″ W, 880 m.14 June 2017No associated spp.
Culex sandraeAxils of bromeliads with clean water, 2 mts. from ground levelMountain regionLos Venados, Tetela del Volcán18°53′59″ N–98°42′26″ W, 2182 m.30 June 2017Ae. quadrivittatus
Axils of bromeliads with clean water, 3 mts. from ground levelMountain regionTetela del Volcán18°54′33.01″ N–98°42′9.46″ W, 2314 m.1 July 2017No associated spp.
Culex lactatorTree hole (Bursera lancifolia Schltdl.,), colored water, (pH 8.10, 418 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′26.44″ N–99°1′5.75″ W, 1125 m.8 June 2017Ae. gabriel, Ae. vargasi, Hg. mesodentatus
Culiseta dugesiAdults approaching humans Mountain regionCEDIF, Huitzilac19°1′58.11′ N″–99°15′18.21″ W, 2600 m.15 June 2017Ae. kompi, Cx. sp.
Discarded tire with clean water and total shade (pH 7.2, 110 PPM, 20.4 °C) Mountain regionLa Encantada, Huitzilac19°0′59′ N″–99°13′13″ W, 2450 m.18 September 2017Cx. arizonensis, Cs. particeps
Adults resting inside artificial containerMountain regionLa Encantada, Huitzilac19°0′59′ N″–99°13′13″ W, 2450 m.18 September 2017No associated spp.
Toxorhynchites moctezumaTree hole, colored water, (pH 9.8, >2000 PPM, 27 °C)Mountain regionQuilamula, Tlaquiltenango18°30′16″ N–99°0′50.94″ W, 1118 m.8 June 2017Ae. gabriel, Ae. vargasi
Discarded tire with clean water and total shadeHills regionYautepec18°54′13″ N–99°3′51″ W, 1223 m.27 June 2017No associated spp.
Table 4. Medical importance and pathogens of mosquito vector species collected in Morelos state, Mexico. Mal: Malaria. DI: Dirofilaria immitis. DENV: Dengue virus. ZIKV: Zika virus. CHIKV: Chikungunya virus. YF: Yellow fever virus. SLE: St. Louis encephalitis virus. WNV: West Nile virus. VEEV: Venezuelan equine encephalitis virus. EEEV: Eastern equine encephalitis virus. WEEV: Western equine encephalitis virus. LCV: La Crosse virus [43]. * Species collected by human biting/approaching humans.
Table 4. Medical importance and pathogens of mosquito vector species collected in Morelos state, Mexico. Mal: Malaria. DI: Dirofilaria immitis. DENV: Dengue virus. ZIKV: Zika virus. CHIKV: Chikungunya virus. YF: Yellow fever virus. SLE: St. Louis encephalitis virus. WNV: West Nile virus. VEEV: Venezuelan equine encephalitis virus. EEEV: Eastern equine encephalitis virus. WEEV: Western equine encephalitis virus. LCV: La Crosse virus [43]. * Species collected by human biting/approaching humans.
TaxaMalDIDENVZIKVCHKVYFSLEWNVVEEVEEEVWEEVLCV
An. pseudopunctipennis * ✓
Aedes vexans * ✓ ✓ ✓✓✓✓✓
Ae. ramirezi *
Ae. epactius *
Ae. guerrero *
Ae. quadrivittatus *
Ae. angustivittatus * ✓
Ae. shannoni *
Ae. taeniorhynchus ✓✓✓
Ae. trivittatus ✓ ✓ ✓✓✓
Ae. gabriel *
Ae. kompi *
Ae. aegypti * ✓✓✓✓ ✓✓✓ ✓
Ae. albopictus * ✓✓✓✓✓ ✓✓✓✓✓
Haemagogus equinus ✓
Hg. mesodentatus * ✓✓ ✓✓
Ps. columbiae ✓✓
Ps. ferox * ✓✓
Culex nigripalpus ✓✓✓✓
Cx. quinquefasciatus ✓ ✓✓✓✓
Cx. restuans ✓✓ ✓
Cx. salinarius ✓✓ ✓
Cx. tarsalis ✓✓ ✓
Cx. erraticus ✓
Cs. dugesi *
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Ortega-Morales, A.I.; Hernández-Triana, L.M.; Garza-Hernández, J.A.; Ramírez-Huicochea, C.M.; Martínez-Gaona, A.J.; Quijano-Barraza, J.M.; González-Acosta, C.; Correa-Morales, F. The Mosquitoes of Morelos, Mexico: DNA Barcodes, Distribution, Ecology and the Resurrection of the Name Culiseta dugesi Dyar and Knab (Diptera: Culicidae). Diversity 2024, 16, 261. https://doi.org/10.3390/d16050261

AMA Style

Ortega-Morales AI, Hernández-Triana LM, Garza-Hernández JA, Ramírez-Huicochea CM, Martínez-Gaona AJ, Quijano-Barraza JM, González-Acosta C, Correa-Morales F. The Mosquitoes of Morelos, Mexico: DNA Barcodes, Distribution, Ecology and the Resurrection of the Name Culiseta dugesi Dyar and Knab (Diptera: Culicidae). Diversity. 2024; 16(5):261. https://doi.org/10.3390/d16050261

Chicago/Turabian Style

Ortega-Morales, Aldo I., Luis M. Hernández-Triana, Javier A. Garza-Hernández, Carlos M. Ramírez-Huicochea, Andrés J. Martínez-Gaona, J. Manuel Quijano-Barraza, Cassandra González-Acosta, and Fabián Correa-Morales. 2024. "The Mosquitoes of Morelos, Mexico: DNA Barcodes, Distribution, Ecology and the Resurrection of the Name Culiseta dugesi Dyar and Knab (Diptera: Culicidae)" Diversity 16, no. 5: 261. https://doi.org/10.3390/d16050261

APA Style

Ortega-Morales, A. I., Hernández-Triana, L. M., Garza-Hernández, J. A., Ramírez-Huicochea, C. M., Martínez-Gaona, A. J., Quijano-Barraza, J. M., González-Acosta, C., & Correa-Morales, F. (2024). The Mosquitoes of Morelos, Mexico: DNA Barcodes, Distribution, Ecology and the Resurrection of the Name Culiseta dugesi Dyar and Knab (Diptera: Culicidae). Diversity, 16(5), 261. https://doi.org/10.3390/d16050261

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop