Role of Phage Capsid in the Resistance to UV-C Radiations
Abstract
:1. Introduction
2. Results
2.1. In Silico 3D Models
2.2. UV-C Resistance Test
2.3. Hydrogen Peroxide Resistance Test
3. Discussion
4. Conclusions
5. Materials and Methods
5.1. Bacteriophages
5.2. Phages Production
5.3. In Silico 3D Modelling Analysis
- 1-AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS-50 (pC89);
- 1-AEGEFQRKLAAKLTDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS-60 (P9b);
- 1-AEGEFRWPPHFEWHFDDGDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS-64 (12III1).
5.4. Analysis of Amino Acids Involved in the Structure Capsid Interactions
5.5. Virus Irradiation
5.6. Hydrogen Peroxide Resistance Assay
5.7. Phage Titration (TU/mL)
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Acknowledgments
Conflicts of Interest
References
- Prasad, B.V.; Schmid, M.F. Principles of virus structural organization. Adv. Exp. Med. Biol. 2012, 726, 17–47. [Google Scholar] [CrossRef] [PubMed]
- Mateu, M.G. Virus engineering: Functionalization and stabilization. Protein Eng. Des. Sel. 2011, 24, 53–63. [Google Scholar] [CrossRef] [PubMed]
- Raeiszadeh, M.; Adeli, B. A Critical Review on Ultraviolet Disinfection Systems against COVID-19 Outbreak: Applicability, Validation, and Safety Considerations. ACS Photonics 2020, 7, 2941–2951. [Google Scholar] [CrossRef]
- Shining a light on COVID-19. Nat. Photonics 2020, 14, 337. [CrossRef]
- Petrenko, V.A.; Smith, G.P. Phages from landscape libraries as substitute antibodies. Protein Eng. 2000, 13, 589–592. [Google Scholar] [CrossRef] [Green Version]
- Morag, O.; Sgourakis, N.G.; Baker, D.; Goldbourt, A. The NMR-Rosetta capsid model of M13 bacteriophage reveals a quadrupled hydrophobic packing epitope. Proc. Natl. Acad. Sci. USA 2015, 112, 971–976. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Smith, G.P.; Petrenko, V.A. Phage display. Chem. Rev. 1997, 97, 391–410. [Google Scholar] [CrossRef]
- Wu, C.H.; Liu, I.J.; Lu, R.M.; Wu, H.C. Advancement and applications of peptide phage display technology in biomedical science. J. Biomed. Sci. 2016, 23, 8. [Google Scholar] [CrossRef] [Green Version]
- Rakonjac, J.; Bennett, N.J.; Spagnuolo, J.; Gagic, D.; Russel, M. Filamentous bacteriophage: Biology, phage display and nanotechnology applications. Curr. Issues Mol. Biol. 2011, 13, 51–76. [Google Scholar] [PubMed]
- Gillespie, J.W.; Yang, L.; De Plano, L.M.; Stackhouse, M.A.; Petrenko, V.A. Evolution of a landscape phage library in a mouse xenograft model of human breast cancer. Viruses 2019, 11, 988. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Han, L.; Liu, P.; Petrenko, V.A.; Liu, A.H. A Label-Free Electrochemical Impedance Cytosensor Based on Specific Peptide-Fused Phage Selected from Landscape Phage Library. Sci. Rep. 2016, 6, 10. [Google Scholar] [CrossRef] [Green Version]
- Han, L.; Wang, D.; Yan, L.; Petrenko, V.A.; Liu, A. Specific phages-based electrochemical impedimetric immunosensors for label-free and ultrasensitive detection of dual prostate-specific antigens. Sens. Actuators B Chem. 2019, 297, 126727. [Google Scholar] [CrossRef]
- Rizzo, M.G.; Carnazza, S.; De Plano, L.M.; Franco, D.; Nicolò, M.S.; Zammuto, V.; Petralia, S.; Calabrese, G.; Gugliandolo, C.; Conoci, S.; et al. Rapid detection of bacterial pathogens in blood through engineered phages-beads and integrated Real-Time PCR into MicroChip. Sens. Actuators B Chem. 2021, 329, 129227. [Google Scholar] [CrossRef]
- De Plano, L.M.; Fazio, E.; Rizzo, M.G.; Franco, D.; Carnazza, S.; Trusso, S.; Neri, F.; Guglielmino, S.P.P. Phage-based assay for rapid detection of bacterial pathogens in blood by Raman spectroscopy. J. Immunol. Methods 2019, 465, 45–52. [Google Scholar] [CrossRef] [PubMed]
- Yoo, S.Y.; Merzlyak, A.; Lee, S.W. Synthetic phage for tissue regeneration. Mediat. Inflamm. 2014, 192790. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bazan, J.; Całkosiński, I.; Gamian, A. Phage display-a powerful technique for immunotherapy: 1. Introduction and potential of therapeutic applications. Hum. Vaccines Immunother. 2012, 8, 1817–1828. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Petrenko, V.A.; Gillespie, J.W.; Xu, H.; O’Dell, T.; De Plano, L.M. Combinatorial avidity selection of mosaic landscape phages targeted at breast cancer cells-an alternative mechanism of directed molecular evolution. Viruses 2019, 11, 785. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Brown, K.C. Peptidic tumor targeting agents: The road from phage display peptide selections to clinical applications. Curr. Pharm. Des. 2010, 16, 1040–1054. [Google Scholar] [CrossRef] [Green Version]
- Hartman, E.C.; Jakobson, C.M.; Favor, A.H.; Lobba, M.J.; Álvarez-Benedicto, E.; Francis, M.B.; Tullman-Ercek, D. Quantitative characterization of all single amino acid variants of a viral capsid-based drug delivery vehicle. Nat. Commun. 2018, 9, 1385. [Google Scholar] [CrossRef] [Green Version]
- Han, L.; Shi, J.; Liu, A. Novel biotemplated MnO2 1D nanozyme with controllable peroxidase-like activity and unique catalytic mechanism and its application for glucose sensing. Sens. Actuators B Chem. 2017, 252, 919–926. [Google Scholar] [CrossRef]
- Han, L.; Shao, C.; Liang, B.; Liu, A. Genetically engineered phage-templated MnO2 nanowires: Synthesis and their application in electrochemical glucose biosensor operated at neutral pH condition. ACS Appl. Mater. Interfaces 2016, 8, 13768–13776. [Google Scholar] [CrossRef]
- Franco, D.; De Plano, L.M.; Rizzo, M.G.; Scibilia, S.; Lentini, G.; Fazio, E.; Neri, F.; Guglielmino, S.P.P.; Mezzasalma, A.M. Bio-hybrid gold nanoparticles as SERS probe for rapid bacteria cell identification. Spectrochim. Acta Part A Mol. Biomol. Spectrosc. 2020, 224, 117394. [Google Scholar] [CrossRef]
- De Plano, L.M.; Scibilia, S.; Rizzo, M.G.; Crea, S.; Franco, D.; Mezzasalma, A.M.; Guglielmino, S.P.P. One-step production of phage–silicon nanoparticles by PLAL as fluorescent nanoprobes for cell identification. Appl. Phys. A 2018, 124, 222. [Google Scholar] [CrossRef]
- Henry, K.A.; Arbabi-Ghahroudi, M.; Scott, J.K. Beyond phage display: Non-traditional applications of the filamentous bacteriophage as a vaccine carrier, therapeutic biologic, and bioconjugation scaffold. Front. Microbiol. 2015, 6, 755. [Google Scholar] [CrossRef] [Green Version]
- Mao, C.; Solis, D.J.; Reiss, B.D.; Kottmann, S.T.; Sweeney, R.Y.; Hayhurst, A.; Georgiou, G.; Iverson, B.; Belcher, A.M. Virus-based toolkit for the directed synthesis of magnetic and semiconducting nanowires. Science 2004, 303, 213–217. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Royston, E.; Lee, S.Y.; Culver, J.N.; Harris, M. Characterization of silica-coated tobacco mosaic virus. J. Colloid Interface Sci. 2006, 298, 706–712. [Google Scholar] [CrossRef]
- Rodriguez, R.A.; Bounty, S.; Beck, S.; Chan, C.; McGuire, C.; Linden, K.G. Photoreactivation of bacteriophages after UV disinfection: Role of genome structure and impacts of UV source. Water Res. 2014, 55, 143–149. [Google Scholar] [CrossRef]
- Bae, K.S.; Shin, G.A. Inactivation of various bacteriophages by different ultraviolet technologies: Development of a reliable virus indicator system for water reuse. Environ. Eng. Res. 2016, 21, 350–354. [Google Scholar] [CrossRef]
- Gehringer, P.; Eschweiler, H.; Leth, H.; Pribil, W.; Pfleger, S.; Cabaj, A.; Haider, T.; Sommer, R. Bacteriophages as viral indicators for radiation processing of water: A chemical approach. Appl. Radiat. Isot. 2003, 58, 651–656. [Google Scholar] [CrossRef]
- Fekete, A.; Kovács, G.; Hegedüs, M.; Módos, K.; Lammer, H. Biological responses to the simulated Martian UV radiation of bacteriophages and isolated DNA. J. Photochem. Photobiol. B 2008, 92, 110–116. [Google Scholar] [CrossRef] [PubMed]
- Rauth, A.M. The physical state of viral nucleic acid and the sensitivity of viruses to ultraviolet light. Biophys. J. 1965, 5, 257–273. [Google Scholar] [CrossRef] [Green Version]
- Kurosaki, Y.; Abe, H.; Morioka, H.; Hirayama, J.; Ikebuchi, K.; Kamo, N.; Nikaido, O.; Azuma, H.; Ikeda, H. Pyrimidine dimer formation and oxidative damage in M13 bacteriophage inactivation by ultraviolet C irradiation. Photochem. Photobiol. 2003, 78, 349–354. [Google Scholar] [CrossRef]
- Passaretti, P.; Sun, Y.; Dafforn, T.R.M.; Oppenheimer, P.G. Determination and characterisation of the surface charge properties of the bacteriophage M13 to assist bio-nanoengineering. RSC Adv. 2020, 10, 25385. [Google Scholar] [CrossRef]
- Nims, R.W.; Plavsics, M. Efficacy of electron beam for viral inactivation. J. Microb. Biochem. Technol. 2015, 7, 173–176. [Google Scholar] [CrossRef]
- Tom, E.F.; Molineux, I.J.; Paff, M.L.; Bull, J.J. Experimental evolution of UV resistance in a phage. Peer J. 2018, 6, e5190. [Google Scholar] [CrossRef] [PubMed]
- Sommer, R.; Pribil, W.; Appelt, S.; Gehringer, P.; Eschweiler, H.; Leth, H.; Cabaj, A.; Haider, T. Inactivation of bacteriophages in water by means of non-ionizing (UV-253.7 nm) and ionizing (gamma) radiation: A comparative approach. Water Res. 2001, 35, 3109–3116. [Google Scholar] [CrossRef]
- Horneck, G.; Klaus, D.M.; Mancinelli, R.L. Space microbiology. Microbiol. Mol. Biol. Rev. 2010, 74, 121–156. [Google Scholar] [CrossRef] [Green Version]
- Reisz, J.A.; Bansal, N.; Qian, J.; Zhao, W.; Furdui, C.M. Effects of ionizing radiation on biological molecules--mechanisms of damage and emerging methods of detection. Antioxid. Redox Signal. 2014, 21, 260–292. [Google Scholar] [CrossRef]
- Felici, F.; Castagnoli, L.; Musacchio, A.; Jappelli, R.; Cesareni, G. Selection of antibody ligands from a large library of oligopeptides express on a multivalente exposition vector. J. Mol. Biol. 2019, 222, 301–310. [Google Scholar] [CrossRef]
- Luzzago, A.; Felici, F. Construction of disulfide-constrained random peptide libraries displayed on phage coat protein VIII. Methods Mol. Biol. 1998, 87, 155–164. [Google Scholar] [CrossRef]
- Carnazza, S.; Foti, C.; Gioffrè, G.; Felici, F.; Guglielmino, S.P.P. Specific and selective probes for Pseudomonas aeruginosa from phage-displayed random peptide libraries. Biosens. Bioelectron. 2008, 23, 1137–1144. [Google Scholar] [CrossRef] [PubMed]
- De Plano, L.M.; Carnazza, S.; Franco, D.; Rizzo, M.G.; Conoci, S.; Petralia, S.; Nicoletti, A.; Zappia, M.; Campolo, M.; Esposito, E.; et al. Innovative IgG biomarkers based on phage display microbial amyloid mimotope for state and stage diagnosis in Alzheimer’s disease. ACS Chem. Neurosci. 2020, 11, 1013–1026. [Google Scholar] [CrossRef] [PubMed]
- Webb, B.; Sali, A. Comparative protein structure modeling using MODELLER. Curr. Protoc. Bioinform. 2014, 54, 5.6.1–5.6.37. [Google Scholar] [CrossRef] [Green Version]
- Gasteiger, E.; Hoogland, C.; Gattiker, A.; Duvaud, S.; Wilkins, M.R.; Appel, R.D.; Bairoch, A. Protein identification and analysis rools on the ExPASy server. In The Proteomics Protocols Handbook; Walker, J.M., Ed.; Springer Protocols Handbooks; Humana Press: Totowa, NJ, USA, 2005; pp. 571–607. [Google Scholar]
- Eisenstark, A.; Buzard, R.L.; Hartman, P.S. Inactivation of phage by near-ultraviolet radiation and hydrogen peroxide. Photochem. Photobiol. 1986, 44, 603–606. [Google Scholar] [CrossRef] [PubMed]
pC89 | P9b (QRKLAAKLT) | 12III1 (RWPPHFEWHFDD) | |||
---|---|---|---|---|---|
Wild-Type/ Wild-Type pVIIIs | Recombinant/ Wild-Type pVIIIs | Recombinant/ Recombinant pVIIIs | Recombinant/ Wild-Type pVIIIs | Recombinant/ Recombinant pVIIIs | |
H-bond | 43 | 42–43, 45–46, 49 | 1–2, 4–5, 7–10, 22–23, 31, 42, 45–46, 53 | 14 | 12–13, 40–42, 45–47, 49–54 |
Steric interactions | 21, 28, 32, 35–36, 39 | 1, 4–5, 7–8, 26–27, 30–31, 34, 37–46, 48–50, 52–53 | 1–12, 14–16, 18–20, 22–24, 26–28, 30–32, 34, 38, 41–43, 45–50, 53 | 13–17, 20, 31 | 9–14, 34, 38, 40–54 |
Phage | Exposed | 385 J/m2 | 770 J/m2 | 1540 J/m2 | 3080 J/m2 |
---|---|---|---|---|---|
pC89 | (4 ± 0.9) × 109 | (3 ± 1.7) × 107 | (2.2 ± 1.2) × 105 | (3.1 ± 1.3) × 10 | No TU |
P9b (QRKLAAKLT) | (3.9 ± 0.2) × 109 | (1.1 ± 0.6) × 109 | (2.6 ± 0.7) × 107 | (3.2 ± 1.3) × 105 | (1.4 ± 0.7) × 104 |
12III1 (RWPPHFEWHFDD) | (3.9 ± 0.9) × 109 | (1.8 ± 0.9) × 108 | (5.7 ± 1.4) × 106 | (1.2 ± 1) × 104 | (1.7 ± 0.9) × 102 |
Phage | Exposed | 30 Min | 60 Min | 90 Min |
---|---|---|---|---|
pC89 | (1.2 ± 0.2) × 1010 | (5 ± 0.4) × 109 | (2.5 ± 0.3) × 109 | (1.2 ± 0.2) × 109 |
P9b (QRKLAAKLT) | (4.0 ± 0.3) × 1010 | (3.2 ± 0.4) × 1010 | (3 ± 0.3) × 1010 | (2.8 ± 0.1) × 1010 |
12III1 (RWPPHFEWHFDD) | (3.4 ± 0.2) × 1010 | (1.7 ± 0.2) × 109 | (1.1 ± 0.2) × 109 | (5.7 ± 0.6) × 109 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Plano, L.M.D.; Franco, D.; Rizzo, M.G.; Zammuto, V.; Gugliandolo, C.; Silipigni, L.; Torrisi, L.; Guglielmino, S.P.P. Role of Phage Capsid in the Resistance to UV-C Radiations. Int. J. Mol. Sci. 2021, 22, 3408. https://doi.org/10.3390/ijms22073408
Plano LMD, Franco D, Rizzo MG, Zammuto V, Gugliandolo C, Silipigni L, Torrisi L, Guglielmino SPP. Role of Phage Capsid in the Resistance to UV-C Radiations. International Journal of Molecular Sciences. 2021; 22(7):3408. https://doi.org/10.3390/ijms22073408
Chicago/Turabian StylePlano, Laura Maria De, Domenico Franco, Maria Giovanna Rizzo, Vincenzo Zammuto, Concetta Gugliandolo, Letteria Silipigni, Lorenzo Torrisi, and Salvatore P. P. Guglielmino. 2021. "Role of Phage Capsid in the Resistance to UV-C Radiations" International Journal of Molecular Sciences 22, no. 7: 3408. https://doi.org/10.3390/ijms22073408