Next Article in Journal
Synergy, Additive Effects, and Antagonism of Drugs with Plant Bioactive Compounds
Previous Article in Journal
32nd Annual GP2A Medicinal Chemistry Conference
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

The Design and Cell-Free Protein Synthesis of a Pembrolizumab Single-Chain Variable Fragment

Department of Chemical Engineering, Brigham Young University, Provo, UT 84602, USA
*
Author to whom correspondence should be addressed.
Drugs Drug Candidates 2025, 4(1), 3; https://doi.org/10.3390/ddc4010003
Submission received: 1 January 2025 / Revised: 11 January 2025 / Accepted: 15 January 2025 / Published: 20 January 2025
(This article belongs to the Section Biologics)

Abstract

Background/Objectives: Cancer is a leading cause of death. However, recently developed immunotherapies have shown significant promise to improve cancer treatment outcomes and survival rates. Pembrolizumab, a cancer immunotherapy drug, enables a strong T-cell response specifically targeting cancer cells to improve patient outcomes in more than 16 types of cancer. The increasing demand for pembrolizumab, the highest selling drug in 2023, increases global dependence on drug production, which can be vulnerable to supply chain disruptions. Methods: Cell-free protein synthesis (CFPS) is a rapid in vitro protein production method that could provide the production of an immunotherapy drug in an emergency and could facilitate on-demand production of the therapeutic at the point of care if needed. Furthermore, CFPS has potential as a production platform of biosimilars, as the patent for pembrolizumab is set to expire in 2028. Results: This work presents the design, synthesis, and target-binding affinity of a novel single-chain variable fragment of pembrolizumab (Pem-scFv) using CFPS. The CFPS production of Pem-scFv also enables the direct optimization of synthesis reaction composition and expression conditions. The conditions of 30 °C, 35% (v/v) cell extract, and an oxidizing redox environment resulted in the highest Pem-scFv soluble yield of 442 µg/mL. An affinity assay demonstrated significant binding between the CFPS-produced Pem-scFv and the PD-1 target. Computational simulations of Pem-scFv folding and binding corroborate the experimental results.

1. Introduction

Cancer is a leading cause of death [1]. Immunotherapy harnesses the human immune system to fight cancer, often resulting in improved patient survival and quality of life compared to traditional chemotherapies [2,3]. The immune system has natural mechanisms to destroy cancerous cells, but some cancer cells evade the immune system because of an overabundance of a PD-L1 ligand on the cancer cell surface. PD-L1 binds to the PD-1 receptor of T-cells, causing T-cell inactivation against the cancer cell [4]. Pembrolizumab, also known as Keytruda® (Merck and Co., Inc., Rahway, NJ, USA), is a full-length monoclonal antibody (mAb) that disrupts the interaction of PD-L1 and PD-1, which enables T-cells to recognize and destroy cancer cells that could otherwise evade eradication [5,6].
The breakthrough success of pembrolizumab as an immunotherapy drug has contributed to FDA approval for the treatment of more than 16 types of cancers [6,7]. Laboratory research and more than 150 ongoing clinical trials involving pembrolizumab continue to expand the beneficial impact of the drug [6]. The treatment success has increased the demand for pembrolizumab, which was the highest selling drug globally in the year 2023, and it is anticipated to further increase in the coming years [8]. The increasing demand and dependence on pembrolizumab creates a vulnerability to supply chain disruption and potential shortages of pembrolizumab, which is on the World Health Organization’s list of essential medicines [9]. Furthermore, cold-chain transport and/or storage required for current production methods may be a concern for supply and stockpiling, particularly in developing countries [10,11].
This work presents the design, synthesis, and target-binding affinity of a pembrolizumab derivative (Pem-scFv) using an in vitro, or “cell-free”, protein synthesis approach (CFPS). Since the CFPS production method does not require cold-chain transport and storage, it is thus well suited for on-demand and/or point-of-care production in an emergency where local or widespread shortages occur [12].
As a streamlined alternative to mAbs, single-chain variable fragments (scFv) are antibody derivatives containing an antigen-binding region [13]. ScFvs have been proven to have excellent tumor penetration, exhibit negligible immunogenicity, and are straightforward to design and synthesize with robust, low-cost systems such as the one described in this work [14]. The synthesis of scFv products tends to be less expensive than mAbs and less time-intensive [15,16]. The future for scFv therapeutics is bright, with the first scFv obtaining FDA approval in 2019 [17].
This work presents the design of a single-chain variable fragment (scFv) fusion protein derived from the variable light (VL) and heavy chains (VH) of pembrolizumab [18]. It is important to note that the development of a pembrolizumab scFv has recently been reported by other researchers [13,19,20,21,22]. However, to our knowledge, this work presents a novel Pem-scFv sequence, and we report this sequence herein.
The CFPS system is amenable to precise control of the reaction environment for specific optimization of Pem-scFv. Prior studies have leveraged the versatility of CFPS to optimize the production of antibodies [23,24,25,26]. The in vivo production of a different Pem-scFv has been recorded in E. coli [27], but to our knowledge this is the first time that the production of Pem-scFv by CFPS has been reported. With the CFPS method, soluble protein yields of up to 442 µg/mL of the novel Pem-scFv fusion protein were observed. The specific interaction of this Pem-scFv with PD-1 was confirmed by a custom binding affinity assay. Furthermore, the results indicate that the two disulfide bonds in the variable chains of pembrolizumab play a vital role in the binding affinity of Pem-scFv with PD-1.
To corroborate the experimental Pem-scFv characterization, this work used ColabFold to predict, in silico, (1) the structure of Pem-scFv and (2) its interaction with PD-1 [28,29,30,31]. UCSF Chimera was then used to superimpose the simulated protein complex and the crystal structure of Pem with PD-1 to assess structural homology by computing root mean square deviation (RMSD) [32]. Computational models of superimposed protein structures have been reported for studying cancer, antibiotic resistance, influenza, SARS-CoV-2, and biofuels, where RMSD can be a useful metric of structural deviations from a template [32,33,34,35,36,37].

2. Results

2.1. Optimization of Pem-scFv Synthesis

This work’s novel Pem-scFv with a C-terminal HIS-tag was designed (Figure 1A, sequence reported in the methods section) and successfully synthesized by CFPS (Figure 1B). The versatile tunability of the CFPS reaction environment enabled initial synthesis experiments to include cell extract enriched with overexpressed GroEL/ES chaperones to encourage soluble product conformations. Aiming to increase the soluble production levels of Pem-scFv, three reaction condition parameters were selected for further optimization: (1) the redox condition, (2) the temperature, and (3) the reaction concentration of E. coli extract. The Pem-scFv contains disulfide bonds, and the redox condition likely impacts protein solubility and stability. Furthermore, the high protein translation rates of the system at 37 °C may overwhelm the GroEL/ES chaperones. To minimize this risk, reduced temperatures and increased chaperone concentrations were used in this work.
The highest soluble Pem-scFv yield (442 μg/mL) was obtained under more oxidizing conditions to assist disulfide bond formation (IAM treatment to inhibit natural reductase and the inclusion of a 4 mM GSSG/1 mM GSH buffer) at the lower temperature of 30 °C and with the higher concentration of cell extract (35% v/v) (Figure 1C). Changing the conditions from traditional CFPS conditions of 37 °C and naturally reducing redox conditions (no IAM treatment or glutathione buffer added) to 30 °C and oxidizing conditions resulted in a 10-fold increase in soluble Pem-scFv (yields increased from 41 μg/mL to 442 μg/mL per Figure 1C). For reference, the horizontal blue bars in Figure 1C report the p-value ranges between conditions as determined by an unpaired two-sample t-test. By comparing the data in Figure 1C, dropping the temperature has the greatest impact in soluble expression capabilities; however, increasing the percentage of extract and changing the redox potential also significantly increased soluble production yields. Finally, while a ~1000% increase in soluble production yields was obtained, it is important to note that the theoretical maximum soluble production yield is higher, considering total yields of Pem-scFv for all conditions ranged from ~800 to ~1100 μg/mL (Figure 1C). Thus, while 442 μg/mL is substantial and high enough to be a viable method for producing this therapeutic, continued engineering of this CFPS system could theoretically increase the soluble Pem-scFv yield.

2.2. Full-Length Pem-scFv Production

To verify full-length production of Pem-scFv, the soluble Pem-scFv protein produced by CFPS was analyzed by SDS-PAGE and autoradiography. As shown in Figure 1C, a single band was observed that aligned with the 33 kDa band of the protein marker lane. While this is ~10% higher than the estimated Pem-scFv molecular weight of 29 kDa, it is within the error acceptable for SDS-PAGE analysis by the manufacturer and that reported in the literature [38]. Importantly, fragments or truncated protein bands were not detected, suggesting full-length protein production.

2.3. Binding Affinity Assay

A custom pull-down binding affinity assay was designed and conducted to detect specific binding between Pem-scFv and PD-1. His-tagged PD-1 was immobilized on Ni-NTA resin, and radiolabeled CFPS protein product was incubated with the immobilized PD-1. Unbound protein was washed away, and the remaining amount of radiolabeled protein was measured by scintillation counting. If the Pem-scFv/PD-1 binding is specific, then Pem-scFv will bind to a column with immobilized PD-1, but a control sfGFP protein will not bind to the column (Figure 2A).
Pem-scFv was expressed by CFPS using the optimized temperature and extract percentage conditions reported in Figure 1C (30 °C and 35% extract) under both oxidizing and reducing conditions. During synthesis, C14-leucine was added to the CFPS reaction to radiolabel the Pem-scFv to enable tracking during the binding assay. A parallel reaction synthesized sfGFP as a negative control for the binding assay. Separate DNA constructs of both the Pem-scFv and sfGFP were created that lacked the histidine tag, and proteins expressed using these tag-less variants were expressed for the binding assay.
The Pem-scFv produced under oxidizing conditions had the highest amount of radiolabeled protein that was eluted from the PD-1 column (Figure 2C). The level of binding was ~10 times greater than the control sfGFP, which bound at levels statistically indistinguishable from the background (p-value > 0.05, 95% CI: 32.14 ± 72.54, overlapping with the background). Pem-scFv produced under reducing conditions bound to the column at levels more than 5 times greater than the control sfGFP but only ~50% as efficiently as the Pem-scFv produced under oxidizing conditions (Figure 2C), indicating the potential importance of the protein’s disulfide bonds. To confirm that Pem-scFv bound to PD-1 and not the Ni-NTA resin, parallel columns with Ni-NTA resin but no PD-1 (Figure 2B) indeed show background levels of bound Pem-scFv (white bars in Figure 2C).
Overall, these results indicate that the Pem-scFv designed as part of this work and synthesized with an optimized CFPS system has specific binding affinity for PD-1. Additional optimization of the CFPS environment may further improve soluble expression and PD-1 binding efficiency. However, here we demonstrate the utility of a CFPS system in optimizing the production conditions of a novel scFv analogue of pembrolizumab, a cancer immunotherapeutic currently in high demand.

2.4. Pem-scFv Folding and Binding Simulations

As an independent method to study the novel Pem-scFv reported in this work, in silico protein structural simulations produced by ColabFold generated a three-dimensional model of Pem-scFv and PD-1 using the respective amino acid sequences (Figure 3A) [31]. The complex is predicted with high confidence to assume the conformation shown in Figure 3A. The predicted local distance difference test (plDDT) score is a per-residue spatial confidence metric, and the Pem-scFv and PD-1 simulated complex has confidence greater than 90% for a large portion of the structure. A plDDT less than 50% is associated with disordered protein domains in some cases [39,40], so it is encouraging that the predicted Pem-scFv structure shown in Figure 3A does not have large regions of low plDDT.
UCSF Chimera 1.16 was used to visualize the simulated complex and compare its structural homology with the reported crystal structure for pembrolizumab Fab and PD-1 (PDB: 5GGS) [41]. The simulated complex and the crystal structure complex are highly similar, as evidenced by superimposing the structures (Figure 3B) to obtain root mean square deviations of 0.404 angstroms and 1.005 angstroms for matching the Pem-scFv structure with the heavy-chain and light-chain domains, respectively.
While this predicted binding region homology does not unequivocally mean that the pembrolizumab and Pem-scFv share identical protein–protein binding interactions with PD-1, the simulation results corroborate our empirically supported hypothesis that this work’s novel Pem-scFv exhibits binding affinity for PD-1.

3. Discussion

The gene fragment for the Pem-scFv fusion protein was designed with T7 promoter, ribosome-binding site, Pem-scFv, HIS-tag, and T7 terminator regions (Figure 1A, sequence reported in the Methods section). The novel Pem-scFv region is composed of the variable heavy- and light-chain regions of pembrolizumab, fused together by a flexible glycine and serine-rich linker. The novelty of this work’s pembrolizumab derivative lies in the selection of the exact portions of the VH and VL regions of the monoclonal antibody that were incorporated into the fusion protein combined with the choice of linker and the use of a histidine tag. No other reported work has published this sequence, to our knowledge. The high demand for pembrolizumab creates a dependency on production, making the accessibility of the drug vulnerable to supply chain disruptions. The CFPS production system demonstrated in this work has the potential to help mitigate this risk and maintain uninterrupted treatment for the many cancer patients who rely on pembrolizumab [42,43,44]. The CFPS system also has potential as a production platform for biosimilars. For this application, it is important to note that the CFPS system employed has been successfully scaled up from the µL scale to the L scale, with little difference in yields for the on-demand bulk synthesis of proteins, in just a few hours [45]. Additionally, the reagents required can be stockpiled and lyophilized for long-term storage to rapidly address a supply chain limitation [46,47]. The structure of our gene fragment is designed to facilitate the expression of the novel Pem-scFv using CFPS, as well as its subsequent purification, allowing for characterization of the fusion protein. CFPS production comes with distinct advantages over in vivo production in terms of speed and versatility [26,48].
CFPS reaction conditions were readily adjusted to optimize the soluble yield of Pem-scFv and improve specific binding to PD-1. The amount of cell extract varied due to the following reasons. Higher cell extract concentrations provide a higher concentration of RNA polymerase, ribosomes, and other cofactors necessary for transcription and translation, which can increase the overall yields of the system. However, more importantly, higher extract concentrations provide higher concentrations of GroEL/ES chaperones to assist in the correct folding of Pem-scFv and thus higher soluble yields and a lower percentage of aggregated product. The GroEL chaperonin and its cofactor GroES work to isolate, encapsulate, and fold Pem-scFv. GroEL/ES provide an isolated and balanced hydrophobic/hydrophilic environment to facilitate correct folding and reduce the probability of kinetically trapped misfolded protein and aggregation with the mechanism extensively studied and described in a recent review article [49]. In prior work, GroEL/ES-enriched cell extract enabled improved protein product solubility in cell-free expression systems [50,51].
To further improve the soluble percentage of Pem-scFv produced, the temperature could be further reduced; however, this can result in a significant decrease in overall yields, which may not justify the approach. Future work exploring the addition of crowding agents such as Ficoll, dextran, or polyethylene glycol in CFPS, which has improved solubility for a number of different proteins, could also be explored [52,53]. Perhaps the most straightforward approach is further increasing the percentage of extract to increase the concentration of chaperones. Furthermore, GroEL/ES chaperones could be purified and added at a higher concentration, and other chaperones could be added such as DnaK [54].
To complement the experimental work, the Pem-scFv sequence was screened using in silico structural simulations for similarity to the known pembrolizumab-binding domain. With a high level of confidence, ColabFold predicts a Pem-scFv structure resembling a known crystal structure of the pembrolizumab-binding domain. The simulation results support the hypothesis that the Pem-scFv sequence can fold into a conformation resembling the pembrolizumab crystal structure and that Pem-scFv can bind to PD-1 in a homologous conformation, although the binding affinity is not predicted from the simulation.
While scFv proteins typically have a shorter half-life than full-length antibodies, the Pem-scFv has notable desirable properties [55,56]. Macromolecular therapeutics have a propensity to accumulate in solid tumors by the enhanced permeability and retention (EPR) effect [57]. Although undersized compared to other therapeutics, scFvs benefit from the EPR effect. Thus, the application of scFv technology to pembrolizumab is particularly attractive since pembrolizumab is used to treat many solid tumors [58]. If efforts are needed to improve size and retention properties, PEGylation is a noteworthy option for future study [59].
Other researchers have recently designed an scFv and reported that its binding affinity with PD-1 is greater than the binding affinity of the full-length pembrolizumab with PD-1 [13], which is an encouraging finding for the field of scFv development. While the Pem-scFv presented in this work has not had rigorous binding affinity comparisons with full-length pembrolizumab, this report provides encouraging preliminary results on the synthesis of a pembrolizumab scFv in an optimized CFPS environment and the preliminary scFv target-binding properties. Additionally, we observed that Pem-scFv expressed under reducing conditions had a significantly reduced binding efficiency to PD-1 than Pem-scFv expressed under oxidizing conditions. Since oxidizing environments are known to promote disulfide bond formation [60], this would indicate that the disulfide bonds of the fusion protein are important to the mechanism behind the binding of pembrolizumab to PD-1.

4. Materials and Methods

4.1. Pem-scFv Gene Design

The Pem-scFv gene was designed by combining the variable heavy-chain region of pembrolizumab (PDB: 5B8C), a 20-amino-acid linker composed of (GGGGS)4, and the variable light-chain region (Figure 1A). The Pem-scFv gene was codon optimized for E. coli expression by the Thermofisher gene optimizer tool and cloned into a pTwist high copy number (pMB1 origin), kanamycin-resistant plasmid by Twist Bioscience (San Francisco, CA, USA) under T7 promoter control. The complete DNA sequence of the expression cassette of Pem-scFv is included in the Supplementary Materials. The gene-containing plasmid was transformed into E. coli XL1-blue chemically competent cells. The cells were grown in 200 mL TB media overnight, and the plasmid was isolated using Qiagen Plasmid Maxi Kit (Valencia, CA, USA).
For the binding affinity assay, a variant of Pem-scFv, lacking the HIS-tag, was created with QuickChange Mutagenesis II (QCSdM) (Agilent Technologies, Santa Clara, CA, USA) per the manufacturer’s instructions and previously reported primer design criteria [61]. The forward primer sequence was CCTGTATTTTCAGTAACTGCCACCGCTGAGC. The reverse primer sequence was CAGTTACTGAAAATACAGGTTCTCGCTGGTTTTGATTTC. A PCR reaction with Q5 polymerase was conducted using the primers and the original HIS-tag Pem-scFv plasmid template. The product was incubated with Dpn1 at 37 °C and ligated. Then, XL-1 Blue chemically competent cells (Agilent Technologies, Santa Clara, CA, USA) were used to transform the mutated plasmid gene. Colony PCR was conducted to determine the success of the QCSdM. Following the confirmation of the successful QCSdM and transformation, plasmid DNA was extracted from cultured cells using a Qiagen Plasmid Maxi Kit (Valencia, CA, USA).

4.2. Extract Preparation

Cell extracts for the experiments outlined were prepared from BL21-StarTM (DE3) cells harboring the pOFX plasmid, which was generously gifted by Dr. Dong-Myung Kim (Chungnam National University). Extract preparation was performed as previously described [62].

4.3. Pem-scFv Cell-Free Protein Synthesis Reactions

In vitro synthesis of Pem-scFv was conducted in 1.5 mL micro-centrifuge tubes with a liquid reaction volume of 25–40 µL. Cell-free protein synthesis (CFPS) reactions were conducted for five hours in an incubator, with shaking at 280 RPM at either 30 °C or 37 °C. The components of all the cell-free protein synthesis reactions that were conducted in this study are the following: 13 to 18 mM Mg(GLU)2, 5 µM C-14 Leucine (Moravek Inc., Brea, CA, USA), 12 nM plasmid containing the gene for the protein of interest, a PANOx-SP small-molecule mixture prepared as described previously [63,64], and 25 to 35% E. coli pOFX cell extract containing the GroEL/ES-folding chaperones.
To facilitate proper disulfide bond formation, the redox potential of cell-free reactions can be modified to a more oxidizing condition by adding 1 mM GSH, 4 mM GSSG, and 0.025 mM iodoacetamide (IAM) [65]. Those molar quantities were employed for more oxidizing CFPS experiments in this study. Prior to the combination of all the components in the reaction vessel, the cell extract was treated with the IAM, a disulfide bond-inhibiting agent, at room temperature for 30 min. IAM was added in order to inhibit the activity of reductases that are typically present in typical conditions [65]. Following IAM treatment, 1 mM GSH and 4 mM GSSG were added to the reaction mixture.
For the quantification of protein production yields, 5 µM C-14 Leucine was added to each CFPS reaction. After the synthesis reaction, 2 µL of the reaction mix was pipetted on filter paper and washed 3 times with 5% TCA, which precipitates proteins. Following the TCA washes, the spotted filter papers were placed independently into vials, inundated with 5 mL of EcoLume™ Liquid Scintillation Cocktail (MP Biomedicals, Irvine, CA, USA), and then processed using a Beckman LS 6000TA liquid scintillation counter. The percentage of C-14 Leucine that precipitates on the paper is proportional to the percentage of leucine that is translated into protein, and, thus, given the molecular weight of the target protein and number of leucines in it, a protein yield concentration can be calculated [63]. This procedure has been described in detail previously [66].
To determine that full-length Pem-scFv was produced, 3.2 µL of the soluble protein was analyzed on a NuPAGE 10% Bis-Tris Gel (Invitrogen, Carlsbad, CA, USA) according to manufacturer’s instructions followed by film autoradiography with a development time of 2 days as described previously [67].

4.4. Binding Affinity Assay

A total of 3 µg of pure HIS-tagged PD-1 (Sino Biological, Beijing, China, 10377-H03H) was suspended in water, equilibrated with an equilibration buffer (1× PBS and 10 mM imidazole), and incubated with 5 μL of Ni-NTA resin (Thermofisher, Rockford, IL, USA). As a negative control, this process was also performed with the Ni-NTA resin without adding PD-1.
The solution was added to a Costar® Spin-X® microcentrifuge 0.22 µm pore spin column (Corning, Tewksbury, MA, USA), and unbound PD-1 was removed by centrifugation (700× g for 2 min) and 2 subsequent washes with wash buffer (10 mM imidazole in 1× PBS). Then, radiolabeled CFPS reaction product (Pem-scFv or sfGFP as a negative control) was incubated with the immobilized PD-1 on ice and occasionally agitated for 30 min. The combined solution was passed through the column, washed five times with the wash buffer, and then eluted with an elution buffer (1× PBS and 500 mM imidazole). The elution run-through was passed through the column twice more after the first time. The radiolabeled protein content in the collected samples was assessed by scintillation counting, as described above.

4.5. Pem-scFv-Folding and -Binding Simulations

ColabFold protein-folding simulations were generated during November 2022 with the online interface hosted by Google, “ColabFold: AlphaFold2 using MMseqs2” [31]. The following simulation parameters were used for the ColabFold simulations: template mode = “none”, msa_mode = “MMseqs2 (UniRef + Environmental)”, pair_mode = “unpaired + paired”, model_type = “AlphaFold2-multimer-v2”, num_recycles = “24”, dip = “200”. The query sequence was the Pem-scFv and PD-1 (PDB: 5GGS) sequences, separated by a colon as follows: MQVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSEIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKTSENLYFQHHHHHH:DSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERR.

4.6. UCSF Chimera Structural Visualization and Calculations

UCSF Chimera 1.16 was used to superimpose the simulated Pem-scFv and PD-1 complex on the crystal structure for pembrolizumab Fab and PD-1 (PDB: 5GGS) [41]. The Matchmaker and Match Align tools were used with default parameters to compute root mean square deviation (RMSD) between the crystal structure domains of the light and heavy chains of PDB: 5GGS and Pem-scFv [32].

5. Conclusions

Here, we report the design and production of a novel Pem-scFv sequence using a cell-free protein synthesis system. The CFPS in vitro synthesis of Pem-scFv, or other therapeutics, could be a beneficial alternative production method as a contingency for on-demand use during localized or widespread drug shortages. Future work with Pem-scFv produced by CFPS must rigorously characterize the Pem-scFv binding affinity and develop purification protocols prior to in vivo studies, clinical trials, and clinical use as an on-demand drug. However, this work represents important progress towards increasing patient access to on-demand therapeutics during drug shortages, as well as showcasing the ability of CFPS to facilitate the expression and characterization of novel scFv candidates.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ddc4010003/s1, Figure S1: The original scanned image of an autoradiogram used in Figure 1C.

Author Contributions

Conceptualization, L.E.E. and B.C.B.; methodology, L.E.E. and B.C.B.; software, L.E.E. and T.J.F.; validation, L.E.E. and M.S.; formal analysis, L.E.E., T.J.F. and M.S.; investigation, L.E.E., T.J.F. and M.S.; resources, B.C.B.; data curation, L.E.E., T.J.F. and M.S.; writing—original draft preparation, L.E.E., T.J.F. and B.C.B.; writing—review and editing, L.E.E., T.J.F., M.S. and B.C.B.; visualization, L.E.E., T.J.F. and B.C.B.; supervision, B.C.B.; project administration, B.C.B.; funding acquisition, B.C.B. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by the Brigham Young University Simmons Center for Cancer Research.

Institutional Review Board Statement

Not applicable.

Data Availability Statement

The raw data supporting the conclusions of this article will be made available by the authors on request.

Acknowledgments

We thank Dong-Myung Kim (Chungnam National University) for the generous gift of the pOFX plasmid. We also thank J. Porter Hunt and Andrew D. Nelson for their advice in gene design and Joseph P. Talley for assistance with proof reading. Molecular graphics and analyses were performed with UCSF Chimera 1.16, which was developed by the Resource for Biocomputing, Visualization, and Informatics at the University of California, San Francisco, with support from NIH P41-GM103311. Biorender.com was used for Figure 1 and Figure 2.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Wang, H.; Naghavi, M.; Allen, C.; Barber, R.M.; Bhutta, Z.A.; Carter, A.; Casey, D.C.; Charlson, F.J.; Chen, A.Z.; Coates, M.M. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980–2015: A systematic analysis for the Global Burden of Disease Study 2015. Lancet 2016, 388, 1459–1544. [Google Scholar] [CrossRef] [PubMed]
  2. Esfahani, K.; Roudaia, L.; Buhlaiga, N.; Del Rincon, S.; Papneja, N.; Miller, W. A review of cancer immunotherapy: From the past, to the present, to the future. Curr. Oncol. 2020, 27, 87–97. [Google Scholar] [CrossRef]
  3. Moreno, C.; Haynie, C.; Cheever, A.; Weber, K.S. Alternative CAR therapies: Recent approaches in engineering chimeric antigen receptor immune cells to combat cancer. Biomedicines 2022, 10, 1493. [Google Scholar] [CrossRef] [PubMed]
  4. Topalian, S.L.; Drake, C.G.; Pardoll, D.M. Immune checkpoint blockade: A common denominator approach to cancer therapy. Cancer Cell 2015, 27, 450–461. [Google Scholar] [CrossRef] [PubMed]
  5. McDermott, J.; Jimeno, A. Pembrolizumab: PD-1 inhibition as a therapeutic strategy in cancer. Drugs Today 2015, 51, 7–20. [Google Scholar] [CrossRef] [PubMed]
  6. Kim, M.S.; Prasad, V. Pembrolizumab for all. J. Cancer Res. Clin. Oncol. 2023, 149, 1357–1360. [Google Scholar] [CrossRef] [PubMed]
  7. Food and Drug Administration. Hematology/Oncology (Cancer) Approvals & Safety Notifications; FDA: Montgomery County, MD, USA, 2018. [Google Scholar]
  8. Urquhart, L. Top companies and drugs by sales in 2020. Nat. Rev. Drug Discov. 2021, 20, 253. [Google Scholar] [CrossRef] [PubMed]
  9. WHO. WHO Model List of Essential Medicines-22nd List, 2021; WHO: Geneva, Switzerland, 2021. [Google Scholar]
  10. Keytruda: Full Prescribing Information. Available online: https://www.accessdata.fda.gov/drugsatfda_docs/label/2016/125514s012lbl.pdf (accessed on 9 July 2024).
  11. Keytruda Annex I Summary of Product Characteristics. Available online: https://ec.europa.eu/health/documents/community-register/2017/20170616137940/anx_137940_en.pdf (accessed on 9 July 2024).
  12. Wilding, K.M.; Zhao, E.L.; Earl, C.C.; Bundy, B.C. Thermostable lyoprotectant-enhanced cell-free protein synthesis for on-demand endotoxin-free therapeutic production. New Biotechnol. 2019, 53, 73–80. [Google Scholar] [CrossRef]
  13. Davis, Z.; Felices, M.; Lenvik, T.R.; Badal, S.; Hinderlie, P.; Blazar, B.R.; Vallera, D.A.; Miller, J.S. PD-1 is expressed at low levels on all peripheral blood natural killer cells but is a significant suppressor of NK function against PD-1 ligand expressing tumor targets. Blood 2019, 134, 621. [Google Scholar] [CrossRef]
  14. Bates, A.; Power, C.A. David vs. Goliath: The structure, function, and clinical prospects of antibody fragments. Antibodies 2019, 8, 28. [Google Scholar] [CrossRef]
  15. Stech, M.; Hust, M.; Schulze, C.; Dübel, S.; Kubick, S. Cell-free eukaryotic systems for the production, engineering, and modification of scFv antibody fragments. Eng. Life Sci. 2014, 14, 387–398. [Google Scholar] [CrossRef] [PubMed]
  16. Kanter, G.; Yang, J.; Voloshin, A.; Levy, S.; Swartz, J.R.; Levy, R. Cell-free production of scFv fusion proteins: An efficient approach for personalized lymphoma vaccines. Blood 2007, 109, 3393–3399. [Google Scholar] [CrossRef]
  17. Yuan, S.; Yu, B.; Liu, H.-M. New drug approvals for 2019: Synthesis and clinical applications. Eur. J. Med. Chem. 2020, 205, 112667. [Google Scholar] [CrossRef] [PubMed]
  18. Nelson, A.L. Antibody fragments: Hope and hype. MAbs 2010, 2, 77–83. [Google Scholar] [CrossRef]
  19. Harrasser, M.; Gohil, S.H.; Lau, H.; Della Peruta, M.; Muczynski, V.; Patel, D.; Miranda, E.; Grigoriadis, K.; Grigoriadis, A.; Granger, D.; et al. Inducible localized delivery of an anti-PD-1 scFv enhances anti-tumor activity of ROR1 CAR-T cells in TNBC. Breast Cancer Res. 2022, 24, 39. [Google Scholar] [CrossRef] [PubMed]
  20. Davis, Z.; Felices, M.; Lenvik, T.; Badal, S.; Walker, J.T.; Hinderlie, P.; Riley, J.L.; Vallera, D.A.; Blazar, B.R.; Miller, J.S. Low-density PD-1 expression on resting human natural killer cells is functional and upregulated after transplantation. Blood Adv. 2021, 5, 1069–1080. [Google Scholar] [CrossRef]
  21. Eichholz, K.; Fukazawa, Y.; Peterson, C.W.; Haeseleer, F.; Medina, M.; Hoffmeister, S.; Duell, D.M.; Varco-Merth, B.D.; Dross, S.; Park, H.; et al. Anti–PD-1 chimeric antigen receptor T cells efficiently target SIV-infected CD4+ T cells in germinal centers. J. Clin. Investig. 2024, 134, e169309. [Google Scholar] [CrossRef] [PubMed]
  22. Fernandes, R.A.; Su, L.; Nishiga, Y.; Ren, J.; Bhuiyan, A.M.; Cheng, N.; Kuo, C.J.; Picton, L.K.; Ohtsuki, S.; Majzner, R.G.; et al. Immune receptor inhibition through enforced phosphatase recruitment. Nature 2020, 586, 779–784. [Google Scholar] [CrossRef] [PubMed]
  23. Martin, R.W.; Majewska, N.I.; Chen, C.X.; Albanetti, T.E.; Jimenez, R.B.C.; Schmelzer, A.E.; Jewett, M.C.; Roy, V. Development of a CHO-based cell-free platform for synthesis of active monoclonal antibodies. ACS Synth. Biol. 2017, 6, 1370–1379. [Google Scholar] [CrossRef] [PubMed]
  24. Oh, I.S.; Lee, J.C.; Lee, M.S.; Chung, J.H.; Kim, D.M. Cell-free production of functional antibody fragments. Bioprocess Biosyst. Eng. 2010, 33, 127–132. [Google Scholar] [CrossRef]
  25. Cai, Q.; Hanson, J.A.; Steiner, A.R.; Tran, C.; Masikat, M.R.; Chen, R.; Zawada, J.F.; Sato, A.K.; Hallam, T.J.; Yin, G. A simplified and robust protocol for immunoglobulin expression in E scherichia coli cell-free protein synthesis systems. Biotechnol. Prog. 2015, 31, 823–831. [Google Scholar] [CrossRef]
  26. Stamatis, C.; Farid, S.S. Process economics evaluation of cell-free synthesis for the commercial manufacture of antibody drug conjugates. Biotechnol. J. 2021, 16, 2000238. [Google Scholar] [CrossRef] [PubMed]
  27. Horita, S.; Nomura, Y.; Sato, Y.; Shimamura, T.; Iwata, S.; Nomura, N. High-resolution crystal structure of the therapeutic antibody pembrolizumab bound to the human PD-1. Sci. Rep. 2016, 6, 35297. [Google Scholar] [CrossRef] [PubMed]
  28. Dill, K.A.; MacCallum, J.L. The protein-folding problem, 50 years on. Science 2012, 338, 1042–1046. [Google Scholar] [CrossRef]
  29. Senior, A.W.; Evans, R.; Jumper, J.; Kirkpatrick, J.; Sifre, L.; Green, T.; Qin, C.; Žídek, A.; Nelson, A.W.; Bridgland, A. Improved protein structure prediction using potentials from deep learning. Nature 2020, 577, 706–710. [Google Scholar] [CrossRef] [PubMed]
  30. Jumper, J.; Evans, R.; Pritzel, A.; Green, T.; Figurnov, M.; Ronneberger, O.; Tunyasuvunakool, K.; Bates, R.; Žídek, A.; Potapenko, A. Highly accurate protein structure prediction with AlphaFold. Nature 2021, 596, 583–589. [Google Scholar] [CrossRef] [PubMed]
  31. Mirdita, M.; Schütze, K.; Moriwaki, Y.; Heo, L.; Ovchinnikov, S.; Steinegger, M. ColabFold: Making protein folding accessible to all. Nat. Methods 2022, 19, 679–682. [Google Scholar] [CrossRef]
  32. Meng, E.C.; Pettersen, E.F.; Couch, G.S.; Huang, C.C.; Ferrin, T.E. Tools for integrated sequence-structure analysis with UCSF Chimera. BMC Bioinform. 2006, 7, 339. [Google Scholar] [CrossRef] [PubMed]
  33. Hart, J.R.; Liu, X.; Pan, C.; Liang, A.; Ueno, L.; Xu, Y.; Quezada, A.; Zou, X.; Yang, S.; Zhou, Q. Nanobodies and chemical cross-links advance the structural and functional analysis of PI3Kα. Proc. Natl. Acad. Sci. USA 2022, 119, e2210769119. [Google Scholar] [CrossRef]
  34. Deering, R.W.; Whalen, K.E.; Alvarez, I.; Daffinee, K.; Beganovic, M.; LaPlante, K.L.; Kishore, S.; Zhao, S.; Cezairliyan, B.; Yu, S. Identification of a bacteria-produced benzisoxazole with antibiotic activity against multi-drug resistant Acinetobacter baumannii. J. Antibiot. 2021, 74, 370–380. [Google Scholar] [CrossRef] [PubMed]
  35. Miner, J.C.; Lappala, A.; Fenimore, P.W.; Fischer, W.M.; McMahon, B.H.; Hengartner, N.W.; Sanbonmatsu, K.Y.; Tung, C.-S. Modeling the Influenza A NP-vRNA-Polymerase Complex in Atomic Detail. Biomolecules 2021, 11, 124. [Google Scholar] [CrossRef] [PubMed]
  36. Stukalov, A.; Girault, V.; Grass, V.; Karayel, O.; Bergant, V.; Urban, C.; Haas, D.A.; Huang, Y.; Oubraham, L.; Wang, A. Multilevel proteomics reveals host perturbations by SARS-CoV-2 and SARS-CoV. Nature 2021, 594, 246–252. [Google Scholar] [CrossRef] [PubMed]
  37. Buhrman, G.; Enriquez, P.; Dillard, L.; Baer, H.; Truong, V.; Grunden, A.M.; Rose, R.B. Structure, Function, and Thermal Adaptation of the Biotin Carboxylase Domain Dimer from Hydrogenobacter thermophilus 2-Oxoglutarate Carboxylase. Biochemistry 2021, 60, 324–345. [Google Scholar] [CrossRef] [PubMed]
  38. Rath, A.; Glibowicka, M.; Nadeau, V.G.; Chen, G.; Deber, C.M. Detergent binding explains anomalous SDS-PAGE migration of membrane proteins. Proc. Natl. Acad. Sci. USA 2009, 106, 1760–1765. [Google Scholar] [CrossRef]
  39. Wheeler, R.J. A resource for improved predictions of Trypanosoma and Leishmania protein three-dimensional structure. PLoS ONE 2021, 16, e0259871. [Google Scholar] [CrossRef] [PubMed]
  40. Guo, H.-B.; Perminov, A.; Bekele, S.; Kedziora, G.; Farajollahi, S.; Varaljay, V.; Hinkle, K.; Molinero, V.; Meister, K.; Hung, C.; et al. AlphaFold2 models indicate that protein sequence determines both structure and dynamics. Sci. Rep. 2022, 12, 10696. [Google Scholar] [CrossRef]
  41. Lee, J.Y.; Lee, H.T.; Shin, W.; Chae, J.; Choi, J.; Kim, S.H.; Lim, H.; Won Heo, T.; Park, K.Y.; Lee, Y.J. Structural basis of checkpoint blockade by monoclonal antibodies in cancer immunotherapy. Nat. Commun. 2016, 7, 13354. [Google Scholar] [CrossRef] [PubMed]
  42. Plimack, E.R.; Bellmunt, J.; Gupta, S.; Berger, R.; Montgomery, R.B.; Heath, K.; Juco, J.; Emancipator, K.; Pathiraja, K.; Lunceford, J.K.; et al. Pembrolizumab (MK-3475) for advanced urothelial cancer: Updated results and biomarker analysis from KEYNOTE-012. J. Clin. Oncol. 2015, 33, 4502. [Google Scholar] [CrossRef]
  43. Hamid, O.; Robert, C.; Daud, A.; Hodi, F.; Hwu, W.; Kefford, R.; Wolchok, J.; Hersey, P.; Joseph, R.; Weber, J.; et al. Five-year survival outcomes for patients with advanced melanoma treated with pembrolizumab in KEYNOTE-001. Ann. Oncol. 2019, 30, 582–588. [Google Scholar] [CrossRef]
  44. Lim, S.H.; Sun, J.M.; Lee, S.H.; Ahn, J.S.; Park, K.; Ahn, M.J. Pembrolizumab for the treatment of non-small cell lung cancer. Expert Opin. Biol. Ther. 2016, 16, 397–406. [Google Scholar] [CrossRef]
  45. Noireaux, V.; Libchaber, A. A vesicle bioreactor as a step toward an artificial cell assembly. Proc. Natl. Acad. Sci. USA 2004, 101, 17669–17674. [Google Scholar] [CrossRef]
  46. Adiga, R.; Al-Adhami, M.; Andar, A.; Borhani, S.; Brown, S.; Burgenson, D.; Cooper, M.A.; Deldari, S.; Frey, D.D.; Ge, X.; et al. Point-of-care production of therapeutic proteins of good-manufacturing-practice quality. Nat. Biomed. Eng. 2018, 2, 675–686. [Google Scholar] [CrossRef] [PubMed]
  47. Hunt, J.P.; Yang, S.O.; Wilding, K.M.; Bundy, B.C. The growing impact of lyophilized cell-free protein expression systems. Bioengineered 2017, 8, 325–330. [Google Scholar] [CrossRef] [PubMed]
  48. Stech, M.; Kubick, S. Cell-free synthesis meets antibody production: A review. Antibodies 2015, 4, 12–33. [Google Scholar] [CrossRef]
  49. Hayer-Hartl, M.; Bracher, A.; Hartl, F.U. The GroEL–GroES chaperonin machine: A nano-cage for protein folding. Trends Biochem. Sci. 2016, 41, 62–76. [Google Scholar] [CrossRef] [PubMed]
  50. Smith, M.T.; Hawes, A.K.; Shrestha, P.; Rainsdon, J.M.; Wu, J.C.; Bundy, B.C. Alternative fermentation conditions for improved Escherichia coli-based cell-free protein synthesis for proteins requiring supplemental components for proper synthesis. Process Biochem. 2014, 49, 217–222. [Google Scholar] [CrossRef]
  51. Soltani, M.; Hunt, J.P.; Bundy, B.C. Rapid RNase Inhibitor Production to Enable Low-cost, On-demand Cell-Free Protein Synthesis Biosensor use in Human Body Fluids. Biotechnol. Bioeng. 2021, 118, 3973–3983. [Google Scholar] [CrossRef] [PubMed]
  52. Ge, X.; Luo, D.; Xu, J. Cell-free protein expression under macromolecular crowding conditions. PLoS ONE 2011, 6, e28707. [Google Scholar] [CrossRef]
  53. Niwa, T.; Sugimoto, R.; Watanabe, L.; Nakamura, S.; Ueda, T.; Taguchi, H. Large-scale analysis of macromolecular crowding effects on protein aggregation using a reconstituted cell-free translation system. Front. Microbiol. 2015, 6, 1113. [Google Scholar] [CrossRef]
  54. Niwa, T.; Kanamori, T.; Ueda, T.; Taguchi, H. Global analysis of chaperone effects using a reconstituted cell-free translation system. Proc. Natl. Acad. Sci. USA 2012, 109, 8937–8942. [Google Scholar] [CrossRef]
  55. Hutt, M.; Färber-Schwarz, A.; Unverdorben, F.; Richter, F.; Kontermann, R.E. Plasma half-life extension of small recombinant antibodies by fusion to immunoglobulin-binding domains. J. Biol. Chem. 2012, 287, 4462–4469. [Google Scholar] [CrossRef]
  56. Ahmad, Z.A.; Yeap, S.K.; Ali, A.M.; Ho, W.Y.; Alitheen, N.B.M.; Hamid, M. scFv antibody: Principles and clinical application. Clin. Dev. Immunol. 2012, 2012, 980250. [Google Scholar] [CrossRef]
  57. Maeda, H.; Wu, J.; Sawa, T.; Matsumura, Y.; Hori, K. Tumor vascular permeability and the EPR effect in macromolecular therapeutics: A review. J. Control. Release 2000, 65, 271–284. [Google Scholar] [CrossRef] [PubMed]
  58. Du Rusquec, P.; de Calbiac, O.; Robert, M.; Campone, M.; Frenel, J.S. Clinical utility of pembrolizumab in the management of advanced solid tumors: An evidence-based review on the emerging new data. Cancer Manag. Res. 2019, 11, 4297. [Google Scholar] [CrossRef] [PubMed]
  59. Smith, A.K.; Soltani, M.; Wilkerson, J.W.; Timmerman, B.D.; Zhao, E.L.; Bundy, B.C.; Knotts IV, T.A. Coarse-grained simulation of PEGylated and tethered protein devices at all experimentally accessible surface residues on β-lactamase for stability analysis and comparison. J. Chem. Phys. 2021, 154, 075102. [Google Scholar] [CrossRef] [PubMed]
  60. Woycechowsky, K.J.; Raines, R.T. Native disulfide bond formation in proteins. Curr. Opin. Chem. Biol. 2000, 4, 533–539. [Google Scholar] [CrossRef] [PubMed]
  61. Liu, H.; Naismith, J.H. An efficient one-step site-directed deletion, insertion, single and multiple-site plasmid mutagenesis protocol. BMC Biotechnol. 2008, 8, 91. [Google Scholar] [CrossRef]
  62. Salehi, A.S.; Smith, M.T.; Bennett, A.M.; Williams, J.B.; Pitt, W.G.; Bundy, B.C. Cell-free protein synthesis of a cytotoxic cancer therapeutic: Onconase production and a just-add-water cell-free system. Biotechnol. J. 2016, 11, 274–281. [Google Scholar] [CrossRef]
  63. Bundy, B.C.; Swartz, J.R. Site-specific incorporation of p-propargyloxyphenylalanine in a cell-free environment for direct protein− protein click conjugation. Bioconjugate Chem. 2010, 21, 255–263. [Google Scholar] [CrossRef] [PubMed]
  64. Jewett, M.C.; Swartz, J.R. Mimicking the Escherichia coli cytoplasmic environment activates long-lived and efficient cell-free protein synthesis. Biotechnol. Bioeng. 2004, 86, 19–26. [Google Scholar] [CrossRef] [PubMed]
  65. Bundy, B.C.; Swartz, J.R. Efficient disulfide bond formation in virus-like particles. J. Biotechnol. 2011, 154, 230–239. [Google Scholar] [CrossRef] [PubMed]
  66. Swartz, J.R.; Jewett, M.C.; Woodrow, K.A. Cell-free protein synthesis with prokaryotic combined transcription-translation. In Recombinant Gene Expression; Springer: Berlin/Heidelberg, Germany, 2004; pp. 169–182. [Google Scholar]
  67. Hunt, J.P.; Barnett, R.J.; Robinson, H.; Soltani, M.; Nelson, J.A.D.; Bundy, B.C. Rapid sensing of clinically relevant glutamine concentrations in human serum with metabolically engineered E. coli-based cell-free protein synthesis. J. Biotechnol. 2020, 325, 389–394. [Google Scholar] [CrossRef] [PubMed]
Figure 1. (A) The structure of the Pem-scFv gene designed as part of this work is depicted with T7P (T7 promoter), RBS (ribosome-binding site), VHC (variable heavy chain), L (linker), VLC (variable light chain), H (HIS-tag), and T7T (T7 terminator) regions. The sequences of the VLC and VHC for Pem-scFv are identical to the VLC and VHC regions in pembrolizumab. (B) The Pem-scFv gene contained in the pTwist plasmid backbone was expressed in a cell-free system using cell extract, amino acids, and energy. (C) CFPS yields under varying conditions with an accompanying autoradiogram of a protein gel. The error bars represent one standard deviation in either direction of the sample mean. The blue bars represent the soluble yield of Pem-scFv product. The white bars signify the total yield—both soluble and insoluble protein product. The horizontal bars indicate that a two-sample unpaired t-test was conducted. An (*) indicates that the resulting p-value < 0.01. A p-value < 0.055 is indicated by (**). The autoradiogram of the protein gel is shown with the Pem-scFv products of a CFPS reaction under both oxidizing and reducing conditions at 30 °C with 35% (v/v) cell extract. The autoradiogram image is cropped and horizontally compressed from a larger scan of the developed autoradiogram (Figure S1) provided in the Supplementary Materials.
Figure 1. (A) The structure of the Pem-scFv gene designed as part of this work is depicted with T7P (T7 promoter), RBS (ribosome-binding site), VHC (variable heavy chain), L (linker), VLC (variable light chain), H (HIS-tag), and T7T (T7 terminator) regions. The sequences of the VLC and VHC for Pem-scFv are identical to the VLC and VHC regions in pembrolizumab. (B) The Pem-scFv gene contained in the pTwist plasmid backbone was expressed in a cell-free system using cell extract, amino acids, and energy. (C) CFPS yields under varying conditions with an accompanying autoradiogram of a protein gel. The error bars represent one standard deviation in either direction of the sample mean. The blue bars represent the soluble yield of Pem-scFv product. The white bars signify the total yield—both soluble and insoluble protein product. The horizontal bars indicate that a two-sample unpaired t-test was conducted. An (*) indicates that the resulting p-value < 0.01. A p-value < 0.055 is indicated by (**). The autoradiogram of the protein gel is shown with the Pem-scFv products of a CFPS reaction under both oxidizing and reducing conditions at 30 °C with 35% (v/v) cell extract. The autoradiogram image is cropped and horizontally compressed from a larger scan of the developed autoradiogram (Figure S1) provided in the Supplementary Materials.
Ddc 04 00003 g001
Figure 2. Pem-scFv affinity assay to assess binding with PD-1. (A) Pem-scFv is anticipated to bind to PD-1 (represented by green clamp) immobilized to Ni-NTA (Ni) beads, and sfGFP (light green bar) is anticipated to flow through. (B) Pem-scFv is anticipated to flow through a column with Ni beads without immobilized PD-1. (C) Concentrations of radiolabeled protein present in the elution solution are normalized per 50 µg of added protein to column. The elution volumes ranged from 11 to 16 μL. The 3 solid blue bars report elution results from PD-1-immobilized Ni beads. The 2 white bars report Pem-scFv elution results from negative control Ni beads that did not contain PD-1.
Figure 2. Pem-scFv affinity assay to assess binding with PD-1. (A) Pem-scFv is anticipated to bind to PD-1 (represented by green clamp) immobilized to Ni-NTA (Ni) beads, and sfGFP (light green bar) is anticipated to flow through. (B) Pem-scFv is anticipated to flow through a column with Ni beads without immobilized PD-1. (C) Concentrations of radiolabeled protein present in the elution solution are normalized per 50 µg of added protein to column. The elution volumes ranged from 11 to 16 μL. The 3 solid blue bars report elution results from PD-1-immobilized Ni beads. The 2 white bars report Pem-scFv elution results from negative control Ni beads that did not contain PD-1.
Ddc 04 00003 g002
Figure 3. Structural representations of a computationally predicted structure for the recombinant Pem-scFV presented in this work and its comparison to a published crystal structure of a pembrolizumab Fab and PD-1. (A) The simulated fold of Pem-scFv and its interaction with PD-1 predicted by ColabFold [31]. The ribbon diagram is colored according to the predicted local distance difference test (plDDT), which is a per-residue confidence metric, where dark blue signifies greater than 90% confidence and red indicates less than 50% confidence, as shown in the legend. (B) The ColabFold predicted structure complex of Pem-scFV (dark blue) and PD-1 (orange) superimposed on the crystal structure (PDB: 5GGS) of a pembrolizumab Fab (light blue) bound to PD-1 (tan). The overall root mean square deviation (RMSD) scores are 0.404 angstroms and 1.005 angstroms for the heavy-chain and light-chain domains, respectively.
Figure 3. Structural representations of a computationally predicted structure for the recombinant Pem-scFV presented in this work and its comparison to a published crystal structure of a pembrolizumab Fab and PD-1. (A) The simulated fold of Pem-scFv and its interaction with PD-1 predicted by ColabFold [31]. The ribbon diagram is colored according to the predicted local distance difference test (plDDT), which is a per-residue confidence metric, where dark blue signifies greater than 90% confidence and red indicates less than 50% confidence, as shown in the legend. (B) The ColabFold predicted structure complex of Pem-scFV (dark blue) and PD-1 (orange) superimposed on the crystal structure (PDB: 5GGS) of a pembrolizumab Fab (light blue) bound to PD-1 (tan). The overall root mean square deviation (RMSD) scores are 0.404 angstroms and 1.005 angstroms for the heavy-chain and light-chain domains, respectively.
Ddc 04 00003 g003
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Ebbert, L.E.; Free, T.J.; Soltani, M.; Bundy, B.C. The Design and Cell-Free Protein Synthesis of a Pembrolizumab Single-Chain Variable Fragment. Drugs Drug Candidates 2025, 4, 3. https://doi.org/10.3390/ddc4010003

AMA Style

Ebbert LE, Free TJ, Soltani M, Bundy BC. The Design and Cell-Free Protein Synthesis of a Pembrolizumab Single-Chain Variable Fragment. Drugs and Drug Candidates. 2025; 4(1):3. https://doi.org/10.3390/ddc4010003

Chicago/Turabian Style

Ebbert, Landon E., Tyler J. Free, Mehran Soltani, and Bradley C. Bundy. 2025. "The Design and Cell-Free Protein Synthesis of a Pembrolizumab Single-Chain Variable Fragment" Drugs and Drug Candidates 4, no. 1: 3. https://doi.org/10.3390/ddc4010003

APA Style

Ebbert, L. E., Free, T. J., Soltani, M., & Bundy, B. C. (2025). The Design and Cell-Free Protein Synthesis of a Pembrolizumab Single-Chain Variable Fragment. Drugs and Drug Candidates, 4(1), 3. https://doi.org/10.3390/ddc4010003

Article Metrics

Back to TopTop