Conformational Entropy as a Potential Liability of Computationally Designed Antibodies
Abstract
:1. Introduction
2. Materials and Methods
2.1. Simulation Details
2.2. Analysis
3. Results
3.1. Metadynamics Simulations of the sdAbs
3.2. The Designed Antibodies Exhibit High Conformational Entropy
3.3. Conformational Flexibility in the Complementarity-Determining Regions
4. Discussion
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Kaplon, H.; Chenoweth, A.; Crescioli, S.; Reichert, J.M. Antibodies to Watch in 2022. mAbs 2022, 14, 2014296. [Google Scholar] [CrossRef] [PubMed]
- Taylor, P.C.; Adams, A.C.; Hufford, M.M.; de la Torre, I.; Winthrop, K.; Gottlieb, R.L. Neutralizing Monoclonal Antibodies for Treatment of COVID-19. Nat. Rev. Immunol. 2021, 21, 382–393. [Google Scholar] [CrossRef] [PubMed]
- Lu, R.M.; Hwang, Y.C.; Liu, I.J.; Lee, C.C.; Tsai, H.Z.; Li, H.J.; Wu, H.C. Development of Therapeutic Antibodies for the Treatment of Diseases. J. Biomed. Sci. 2020, 27, 1. [Google Scholar] [CrossRef] [PubMed]
- Lonberg, N.; Taylor, L.D.; Harding, F.A.; Trounstine, M.; Higgins, K.M.; Schramm, S.R.; Kuo, C.C.; Mashayekh, R.; Wymore, K.; McCabe, J.G.; et al. Antigen-Specific Human Antibodies from Mice Comprising Four Distinct Genetic Modifications. Nature 1994, 368, 856–859. [Google Scholar] [CrossRef]
- Jakobovits, A.; Amado, R.G.; Yang, X.; Roskos, L.; Schwab, G. From XenoMouse Technology to Panitumumab, the First Fully Human Antibody Product from Transgenic Mice. Nat. Biotechnol. 2007, 25, 1134–1143. [Google Scholar] [CrossRef] [PubMed]
- Huang, J.; Doria-Rose, N.A.; Longo, N.S.; Laub, L.; Lin, C.L.; Turk, E.; Kang, B.H.; Migueles, S.A.; Bailer, R.T.; Mascola, J.R.; et al. Isolation of Human Monoclonal Antibodies from Peripheral Blood B Cells. Nat. Protoc. 2013, 8, 1907–1915. [Google Scholar] [CrossRef] [Green Version]
- Winter, G.; Griffiths, A.D.; Hawkins, R.E.; Hoogenboom, H.R. Making Antibodies by Phage Display Technology. Annu. Rev. Immunol. 1994, 12, 433–455. [Google Scholar] [CrossRef]
- Jain, T.; Sun, T.; Durand, S.; Hall, A.; Houston, N.R.; Nett, J.H.; Sharkey, B.; Bobrowicz, B.; Caffry, I.; Yu, Y.; et al. Biophysical Properties of the Clinical-Stage Antibody Landscape. Appl. Biol. Sci. 2017, 114, 944–949. [Google Scholar] [CrossRef] [Green Version]
- Narayanan, H.; Dingfelder, F.; Butté, A.; Lorenzen, N.; Sokolov, M.; Arosio, P. Machine Learning for Biologics: Opportunities for Protein Engineering, Developability, and Formulation. Trends Pharmacol. Sci. 2021, 42, 151–165. [Google Scholar] [CrossRef]
- Zhang, Y.; Wu, L.; Gupta, P.; Desai, A.A.; Smith, M.D.; Rabia, L.A.; Ludwig, S.D.; Tessier, P.M. Physicochemical Rules for Identifying Monoclonal Antibodies with Drug-like Specificity. Mol. Pharm. 2020, 17, 2555–2569. [Google Scholar] [CrossRef]
- Raybould, M.I.J.; Marks, C.; Krawczyk, K.; Taddese, B.; Nowak, J.; Lewis, A.P.; Bujotzek, A.; Shi, J.; Deane, C.M. Five Computational Developability Guidelines for Therapeutic Antibody Profiling. Biophys. Comput. Biol. 2019, 116, 4025–4030. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ahmed, L.; Gupta, P.; Martin, K.P.; Scheer, J.M.; Nixon, A.E.; Kumar, S. Intrinsic Physicochemical Profile of Marketed Antibody-Based Biotherapeutics. Biophys. Comput. Biol. 2021, 118, e2020577118. [Google Scholar] [CrossRef] [PubMed]
- Wolf Pérez, A.M.; Lorenzen, N.; Vendruscolo, M.; Sormanni, P. Assessment of Therapeutic AntibodyTherapeutic Antibodies DevelopabilityDevelopability by Combinations of In Vitro and In SilicoIn Silico Methods. In Therapeutic Antibodies: Methods and Protocols; Houen, G., Ed.; Methods in Molecular Biology; Springer: Berlin/Heidelberg, Germany, 2021; pp. 57–113. [Google Scholar] [CrossRef]
- Khetan, R.; Curtis, R.; Deane, C.M.; Hadsund, J.T.; Kar, U.; Krawczyk, K.; Kuroda, D.; Robinson, S.A.; Sormanni, P.; Tsumoto, K.; et al. Current Advances in Biopharmaceutical Informatics: Guidelines, Impact and Challenges in the Computational Developability Assessment of Antibody Therapeutics. mAbs 2022, 14, 2020082. [Google Scholar] [CrossRef] [PubMed]
- Sormanni, P.; Aprile, F.A.; Vendruscolo, M. Third Generation Antibody Discovery Methods: In Silico Rational Design. Chem. Soc. Rev. 2018, 47, 9137–9157. [Google Scholar] [CrossRef]
- Mason, D.M.; Friedensohn, S.; Weber, C.R.; Jordi, C.; Wagner, B.; Meng, S.M.; Ehling, R.A.; Bonati, L.; Dahinden, J.; Gainza, P.; et al. Optimization of Therapeutic Antibodies by Predicting Antigen Specificity from Antibody Sequence via Deep Learning. Nat. Biomed. Eng. 2021, 5, 600–612. [Google Scholar] [CrossRef]
- Yang, C.; Sesterhenn, F.; Bonet, J.; van Aalen, E.A.; Scheller, L.; Abriata, L.A.; Cramer, J.T.; Wen, X.; Rosset, S.; Georgeon, S.; et al. Bottom-up de Novo Design of Functional Proteins with Complex Structural Features. Nat. Chem. Biol. 2021, 17, 492–500. [Google Scholar] [CrossRef]
- Quijano-Rubio, A.; Yeh, H.W.; Park, J.; Lee, H.; Langan, R.A.; Boyken, S.E.; Lajoie, M.J.; Cao, L.; Chow, C.M.; Miranda, M.C.; et al. De Novo Design of Modular and Tunable Protein Biosensors. Nature 2021, 591, 482–487. [Google Scholar] [CrossRef]
- Baran, D.; Pszolla, M.G.; Lapidoth, G.D.; Norn, C.; Dym, O.; Unger, T.; Albeck, S.; Tyka, M.D.; Fleishman, S.J. Principles for Computational Design of Binding Antibodies. Biophys. Comput. Biol. 2017, 114, 10900–10905. [Google Scholar] [CrossRef] [Green Version]
- Sormanni, P.; Aprile, F.A.; Vendruscolo, M. Rational Design of Antibodies Targeting Specific Epitopes within Intrinsically Disordered Proteins. Biophys. Comput. Biol. 2015, 112, 9902–9907. [Google Scholar] [CrossRef] [Green Version]
- Berman, H.M.; Westbrook, J.; Feng, Z.; Gilliland, G.; Bhat, T.N.; Weissig, H.; Shindyalov, I.N.; Bourne, P.E. The Protein Data Bank. Nucleic Acids Res. 2020, 28, 235–242. [Google Scholar] [CrossRef] [Green Version]
- Aprile, F.A.; Sormanni, P.; Perni, M.; Arosio, P.; Linse, S.; Knowles, T.P.J.; Dobson, C.M.; Vendruscolo, M. Selective Targeting of Primary and Secondary Nucleation Pathways in Aβ42 Aggregation Using a Rational Antibody Scanning Method. Mol. Neurosci. 2017, 3, e1700488. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Aprile, F.A.; Sormanni, P.; Podpolny, M.; Chhangur, S.; Needham, L.M.; Ruggeri, F.S.; Perni, M.; Limbocker, R.; Heller, G.T.; Sneideris, T.; et al. Rational Design of a Conformation-Specific Antibody for the Quantification of Aβ Oligomers. Biophys. Comput. Biol. 2020, 117, 13509–13518. [Google Scholar] [CrossRef] [PubMed]
- Rangel, M.A.; Bedwell, A.; Costanzi, E.; Ricagno, S.; Frydman, J.; Vendruscolo, M.; Sormanni, P. Fragment-Based Computational Design of Antibodies Targeting Structured Epitopes. bioRxiv 2022. [Google Scholar] [CrossRef]
- Fernández-Quintero, M.L.; Pomarici, N.D.; Math, B.A.; Kroell, K.B.; Waibl, F.; Bujotzek, A.; Georges, G.; Liedl, K.R. Antibodies Exhibit Multiple Paratope States Influencing VH–VL Domain Orientations. Commun. Biol. 2020, 3, 589. [Google Scholar] [CrossRef]
- Park, Y.J.; Budiarto, T.; Wu, M.; Pardon, E.; Steyaert, J.; Hol, W.G.J. The Structure of the C-terminal Domain of the Largest Editosome Interaction Protein and Its Role in Promoting RNA Binding by RNA-editing Ligase L2. Nucleic Acids Res. 2012, 40, 6966–6977. [Google Scholar] [CrossRef]
- Abraham, M.J.; Murtola, T.; Schulz, R.; Páll, S.; Smith, J.C.; Hess, B.; Lindahl, E. GROMACS: High Performance Molecular Simulations through Multi-Level Parallelism from Laptops to Supercomputers. SoftwareX 2015, 1–2, 19–25. [Google Scholar] [CrossRef] [Green Version]
- PLUMED consortium. Promoting Transparency and Reproducibility in Enhanced Molecular Simulations. Nat. Methods 2019, 16, 670–673. [Google Scholar] [CrossRef] [Green Version]
- Tribello, G.A.; Bonomi, M.; Branduardi, D.; Camilloni, C.; Bussi, G. PLUMED 2: New Feathers for an Old Bird. Comput. Phys. Commun. 2014, 185, 604–613. [Google Scholar] [CrossRef] [Green Version]
- Huang, J.; Rauscher, S.; Nawrocki, G.; Ran, T.; Feig, M.; de Groot, B.L.; Grubmüller, H.; MacKerell, A.D. CHARMM36m: An Improved Force Field for Folded and Intrinsically Disordered Proteins. Nat. Methods 2017, 14, 71–73. [Google Scholar] [CrossRef] [Green Version]
- Jorgensen, W.L.; Chandrasekhar, J.; Madura, J.D.; Impey, R.W.; Klein, M.L. Comparison of Simple Potential Functions for Simulating Liquid Water. J. Chem. Phys. 1983, 79, 926–935. [Google Scholar] [CrossRef]
- Webb, B.; Sali, A. Comparative Protein Structure Modeling Using MODELLER. Curr. Protoc. Bioinform. 2016, 54, 5.6.1–5.6.37. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bussi, G.; Donadio, D.; Parrinello, M. Canonical Sampling through Velocity-Rescaling. J. Chem. Phys. 2007, 126, 014101. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Berendsen, H.J.C.; Postma, J.P.M.; van Gunsteren, W.F.; DiNola, A.; Haak, J.R. Molecular Dynamics with Coupling to an External Bath. J. Chem. Phys. 1984, 81, 3684–3690. [Google Scholar] [CrossRef] [Green Version]
- Parrinello, M.; Rahman, A. Polymorphic Transitions in Single Crystals: A New Molecular Dynamics Method. J. Appl. Phys. 1981, 52, 7182–7190. [Google Scholar] [CrossRef]
- Hess, B. P-LINCS: A Parallel Linear Constraint Solver for Molecular Simulation. J. Chem. Theory Comput. 2008, 4, 116–122. [Google Scholar] [CrossRef]
- Essmann, U.; Perera, L.; Berkowitz, M.L.; Darden, T.; Lee, H.; Pedersen, L.G. A Smooth Particle Mesh Ewald Method. J. Chem. Phys. 1995, 103, 8577–8593. [Google Scholar] [CrossRef] [Green Version]
- Pfaendtner, J.; Bonomi, M. Efficient Sampling of High-Dimensional Free-Energy Landscapes with Parallel Bias Metadynamics. J. Chem. Theory Comput. 2015, 11, 5062–5067. [Google Scholar] [CrossRef]
- Barducci, A.; Bussi, G.; Parrinello, M. Well-Tempered Metadynamics: A Smoothly Converging and Tunable Free-Energy Method. Phys. Rev. Lett. 2008, 100, 020603. [Google Scholar] [CrossRef] [Green Version]
- Raiteri, P.; Laio, A.; Gervasio, F.L.; Micheletti, C.; Parrinello, M. Efficient Reconstruction of Complex Free Energy Landscapes by Multiple Walkers Metadynamics. J. Phys. Chem. B 2006, 110, 3533–3539. [Google Scholar] [CrossRef]
- Tiwary, P.; Parrinello, M. A Time-Independent Free Energy Estimator for Metadynamics. J. Phys. Chem. B 2015, 119, 736–742. [Google Scholar] [CrossRef]
- Daura, X.; Gademann, K.; Jaun, B.; Seebach, D.; van Gunsteren, W.F.; Mark, A.E. Peptide Folding: When Simulation Meets Experiment. Chemistry 1999, 38, 236–240. [Google Scholar] [CrossRef]
- Pedregosa, F.; Varoquaux, G.; Gramfort, A.; Michel, V.; Thirion, B.; Grisel, O.; Blondel, M.; Prettenhofer, P.; Weiss, R.; Dubourg, V.; et al. Scikit-Learn: Machine Learning in Python. J. Mach. Learn. Res. 2011, 12, 2825–2830. [Google Scholar]
- Bock, H.H. Information and Entropy in Cluster Analysis. In Proceedings of the First US/Japan Conference on the Frontiers of Statistical Modeling: An Informational Approach: Volume 2 Multivariate Statistical Modeling; Bozdogan, H., Sclove, S.L., Gupta, A.K., Haughton, D., Kitagawa, G., Ozaki, T., Tanabe, K., Eds.; Springer: Amsterdam, The Netherlands, 1994; pp. 115–147. [Google Scholar] [CrossRef]
- Kraml, J.; Hofer, F.; Quoika, P.K.; Kamenik, A.S.; Liedl, K.R. X-Entropy: A Parallelized Kernel Density Estimator with Automated Bandwidth Selection to Calculate Entropy. J. Chem. Inf. Model. 2021, 61, 1533–1538. [Google Scholar] [CrossRef] [PubMed]
- Fernández-Quintero, M.L.; Seidler, C.A.; Liedl, K.R. T-Cell Receptor Variable β Domains Rigidify During Affinity Maturation. Sci. Rep. 2020, 10, 4472. [Google Scholar] [CrossRef]
- Kelow, S.P.; Adolf-Bryfogle, J.; Dunbrack, R.L. Hiding in Plain Sight: Structure and Sequence Analysis Reveals the Importance of the Antibody DE Loop for Antibody-Antigen Binding. mAbs 2020, 12, 1840005. [Google Scholar] [CrossRef]
- Fernández-Quintero, M.L.; Loeffler, J.R.; Bacher, L.M.; Waibl, F.; Seidler, C.A.; Liedl, K.R. Local and Global Rigidification Upon Antibody Affinity Maturation. Front. Mol. Biosci. 2020, 7. [Google Scholar] [CrossRef]
- Kulenkampff, K.; Wolf Perez, A.M.; Sormanni, P.; Habchi, J.; Vendruscolo, M. Quantifying Misfolded Protein Oligomers as Drug Targets and Biomarkers in Alzheimer and Parkinson Diseases. Nat. Rev. Chem. 2021, 5, 277–294. [Google Scholar] [CrossRef]
- Jeliazkov, J.R.; Sljoka, A.; Kuroda, D.; Tsuchimura, N.; Katoh, N.; Tsumoto, K.; Gray, J.J. Repertoire Analysis of Antibody CDR-H3 Loops Suggests Affinity Maturation Does Not Typically Result in Rigidification. Front. Immunol. 2018, 9, 413. [Google Scholar] [CrossRef] [Green Version]
- Ovchinnikov, V.; Louveau, J.E.; Barton, J.P.; Karplus, M.; Chakraborty, A.K. Role of Framework Mutations and Antibody Flexibility in the Evolution of Broadly Neutralizing Antibodies. Elife 2018, 7, e33038. [Google Scholar] [CrossRef] [Green Version]
- Bhat, T.N.; Bentley, G.A.; Boulot, G.; Greene, M.I.; Tello, D.; Dall’Acqua, W.; Souchon, H.; Schwarz, F.P.; Mariuzza, R.A.; Poljak, R.J. Bound Water Molecules and Conformational Stabilization Help Mediate an Antigen-Antibody Association. Proc. Natl. Acad. Sci. USA 1994, 91, 1089–1093. [Google Scholar] [CrossRef] [Green Version]
- Shiroishi, M.; Yokota, A.; Tsumoto, K.; Kondo, H.; Nishimiya, Y.; Horii, K.; Matsushima, M.; Ogasahara, K.; Yutani, K.; Kumagai, I. Structural Evidence for Entropic Contribution of Salt Bridge Formation to a Protein Antigen-Antibody Interaction: THE CASE OF HEN LYSOZYME-HyHEL-10 Fv COMPLEX*. J. Biol. Chem. 2001, 276, 23042–23050. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pietrucci, F.; Laio, A. A Collective Variable for the Efficient Exploration of Protein Beta-Sheet 18 Structures: Application to SH3 and GB1. J. Chem. Theory Comput. 2009, 5, 2197–2201. [Google Scholar] [CrossRef] [PubMed]
sdAb | Sequence |
---|---|
DesAbO | MEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIGWVRRAPGKGEEWVASIYPTNGYTRYADSV |
KGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAAGSESAFGRAEEEAAAWGQGTLVTVSS | |
DesAb-HSA-D3 | QVQLQESGGGLVQAGGSLRLSCAASGELYALISMGWFRQAPGKEREFVAAISRNGANTYYTDSVK |
GRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADKFASPDGVVTIMTNEYDYWGQGTQVTVSS | |
Nb10 | QVQLQESGGGLVQAGGSLRLSCAASGRTSSLYSMGWFRQAPGKEREFVAAISRNGANTYYTDSVK |
GRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADRFPTMEVVTIMTNEYDYWGQGTQVTVSS |
sdAb | CDR1 | CDR2 | CDR3 | HV4 |
---|---|---|---|---|
DesAbO | GFNIKDTYIG (27–36) | SIYPTNGYTR (51–60) | SESAFGRAEEEA (101–113) | TSKNT (75–80) |
DesAb-HSA-D3 | GELYALISMG (27–36) | AISRNGANTY (51–60) | DKFASPDGVVTIMTNEYDY (99–118) | NAKNT (74–79) |
Nb10 | GRTSSLYSMG (27–36) | AISRNGANTY (51–60) | RFPTMEVVTIMTNEYDYW (99–118) | NAKNT (74–79) |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Löhr, T.; Sormanni, P.; Vendruscolo, M. Conformational Entropy as a Potential Liability of Computationally Designed Antibodies. Biomolecules 2022, 12, 718. https://doi.org/10.3390/biom12050718
Löhr T, Sormanni P, Vendruscolo M. Conformational Entropy as a Potential Liability of Computationally Designed Antibodies. Biomolecules. 2022; 12(5):718. https://doi.org/10.3390/biom12050718
Chicago/Turabian StyleLöhr, Thomas, Pietro Sormanni, and Michele Vendruscolo. 2022. "Conformational Entropy as a Potential Liability of Computationally Designed Antibodies" Biomolecules 12, no. 5: 718. https://doi.org/10.3390/biom12050718