Next Article in Journal
Effects of Dietary Supplementation of L-Carnitine and Mannan-Oligosaccharides on Growth Performance, Selected Carcass Traits, Content of Basic and Mineral Components in Liver and Muscle Tissues, and Bone Quality in Turkeys
Next Article in Special Issue
Risk Factors for Epistaxis in Thoroughbred Flat Races in Japan (2001–2020)
Previous Article in Journal
Clinical Experiences and Mechanism of Action with the Use of Oxytocin Injection at Parturition in Domestic Animals: Effect on the Myometrium and Fetuses
Previous Article in Special Issue
The Reporting of Racehorse Fatalities in New Zealand Thoroughbred Flat Racing in the 2011/12–2021/22 Seasons
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Identification of Personality-Related Candidate Genes in Thoroughbred Racehorses Using a Bioinformatics-Based Approach Involving Functionally Annotated Human Genes

1
Nihon University Veterinary Research Center, Fujisawa 252-0880, Kanagawa, Japan
2
Genetic Analysis Department, Laboratory of Racing Chemistry, Utsunomiya 320-0851, Tochigi, Japan
*
Authors to whom correspondence should be addressed.
Animals 2023, 13(4), 769; https://doi.org/10.3390/ani13040769
Submission received: 15 October 2022 / Revised: 7 February 2023 / Accepted: 20 February 2023 / Published: 20 February 2023
(This article belongs to the Special Issue Health, Safety, and Welfare in Horse Racing)

Simple Summary

By using the Thoroughbred genome variant database to identify orthologues to personality-related human genes, we identified 18 potential personality-related genes in horses. These candidate genes have a total of 55 variants that cause amino acid substitutions when compared to the EquCab3.0 reference genome that may impact the function of the proteins encoded by these genes. Moreover, 15 of the 18 genes have not previously been linked to personality in horses, suggesting that this exploratory approach of related genes using human evidence can be useful for equine behavioral genetics. Although using this bioinformatics approach is less useful for investigating genes affecting personality in horses than it is in humans due to a lack of supporting personality research, this study highlights the potential for the identification of candidate genes. If future studies with equine behavioral datasets validate these potential personality–gene associations, this bioinformatics strategy may become important in the field of equine genetics.

Abstract

Considering the personality traits of racehorses (e.g., flightiness, anxiety, and affability) is considered essential to improve training efficiency and decrease accident frequency, especially when retraining for a second career that may involve contact with inexperienced personnel after retiring from racing. Studies on human personality-related genes are frequently conducted; however, such studies are rare in horses because a consistent methodology for personality evaluation is lacking. Using the recently published whole genome variant database of 101 Thoroughbred horses, we compared horse genes orthologous to human genes related to the Big Five personality traits, and identified 18 personality-related candidate genes in horses. These genes include 55 variants that involve non-synonymous substitutions that highly impact the encoded protein. Moreover, we evaluated the allele frequencies and functional impact on the proteins in terms of the difference in molecular weights and hydrophobicity levels between reference and altered amino acids. We identified 15 newly discovered genes that may affect equine personality, but their associations with personality are still unclear. Although more studies are required to compare genetic and behavioral information to validate this approach, it may be useful under limited conditions for personality evaluation.

1. Introduction

In the modern world, horses are used in various sports disciplines such as racing, show jumping, and dressage, as well as in various equine-assisted therapeutic and educational programs. Thoroughbred horses are mainly used in racing, but they have limited use after their retirement. In terms of animal welfare, international bodies such as the International Forum for the Aftercare of Racehorses (IFAR) have undertaken efforts to retrain racehorses and develop their post-retirement careers [1,2,3]. Personality and temperament are critical factors when selecting an appropriate individual for a specific purpose [4]. Since the learning ability of horses differs based on their personality and temperament, comprehensive knowledge of these aspects is crucial to improving the success of retraining [5,6]. Notably, no studies have investigated how temperament or personality influences performance or training.
Failures in the post-retirement transition from horseracing often occur in careers that involve greater contact with strangers or inexperienced personnel. One major problem for such horses is increased accident rates with inexperienced riders [7,8]. In other words, appropriate retraining is not conducted to capacitate the horse for amateurs. Therefore, carefully selecting horses for specific careers and setting a retraining direction in accordance with their intended use in their second career is expected to increase the rate of successful retraining.
Recently, twin or family research and whole-genome association studies have revealed human personality and related diseases to be partially controlled by genes [9,10,11]. The personality of horses may similarly be influenced by genetic factors, and additively by environmental factors [12,13]. For example, the equine ASIP genotype that influences coat color is associated with a self-reliant temperament [14], and a single nucleotide polymorphism (SNP) in the variable number of tandem repeats region of the equine DRD4 gene is significantly associated with curiosity and vigilance [15]. Moreover, the oxytocin and the dopaminergic pathways are associated with anxiety or fearfulness in horses, which constitute a temperament called “Neuroticism” in humans; oxytocin is also related to trainability [16,17]. Nine genes have been proposed to be personality-related candidate genes in horses [18]; however, few studies on each personality-related gene have been reported [15,19]. A lack of adequate methods for conducting personality-related research in horses is the primary reason for limited progress in this field when compared to the extensive research conducted in humans [20]. If equine personality genetics advance, a genetic test could be used to help select an ideal second career for retired racehorses, thus enabling more specialized retraining.
In humans, multiple personality-related genes have been identified by genome-wide association studies and the candidate gene approach. Recently, whole genome sequencing of 101 Thoroughbreds was performed, and the whole genome variant database of this population was published [21]. Therefore, we aimed to identify horse genes that are orthologous with human personality-related genes and develop a method for identifying equine personality-related gene candidates by referring to the variants of these genes extracted from the whole genome variant database.

2. Materials and Methods

In Figure 1, we show the referenced database, inputs and outputs, and our pipeline from methods to results.

2.1. Search for Personality-Related Candidate Genes in Horses

Firstly, human personality-related genes were identified using the search term “personality trait” in the National Center for Biotechnology Information (NCBI) gene database [22]. Subsequently, relevant articles dealing with the identified genes were collected; the articles discussed each facet of the Big Five personality traits: Agreeableness, Conscientiousness, Extraversion, Neuroticism, and Openness. These categories have been determined to be heritable in humans [23]. Horse genes orthologous to the identified human genes were searched against the NCBI gene database.

2.2. Search for DNA Variants in Equine Personality-Related Gene Candidates

The variants of each gene were sorted using a whole genome variant database of 101 Thoroughbreds that uses EquCab3.0 as a reference genome [21,24]. Variants causing non-synonymous substitution were selected as mutations likely to highly impact protein function. Variant information was checked using the Ensembl Genome Browser and the University of California Santa Cruz (UCSC) Genome Browser [25,26].

2.3. Characterization of Missense Mutations and Their Effects on Equine Personality

Based on variants’ codon mutations, the differences in molecular weights and hydrophobicity index levels of amino acids were manually calculated before and after substitutions. Furthermore, substitutions with a molecular weight difference ≥|40.00| Da and a hydrophobicity level ≥|1.00| were treated as highly significant [27]. Disulfide-bond and posttranslational modifications were investigated in regard to their effect on the conformation or function of encoded proteins.

3. Results

3.1. Search for Personality-Related Candidate Genes in Horses

Twenty-eight human personality-related genes were extracted from PubMed by searching the NCBI gene database. The horse orthologues for all 28 genes were found in the horse genome based on gene annotations obtained using Ensembl.
Among the 28 identified genes, ANKK1, APOE, BDNF, CNR1, COMT, DRD4, IL6, and SLC6A4 were associated with two or more personality traits. COMT was specifically associated with all personality traits. Among all the traits explored, Neuroticism was associated with the largest number of genes (23 genes), and Extraversion, Conscientiousness, Agreeableness, and Openness were associated with six, four, three, and four genes, respectively.

3.2. Search for DNA Variants in Equine Personality-Related Gene Candidates

After searching all variants of the 28 orthologues in the Thoroughbred variant database, 55 variants causing non-synonymous substitution in 18 different genes were extracted (Table S1). Among the 55 variants, 54 were SNPs that caused a substitution of one nucleotide for another, and one was an insertion that caused the mutation of a nucleotide to a long sequence of nucleotides. These mutations in horses were not found to be in corresponding locations in the human genome, as checked using the Ensembl and UCSC genome browsers.
SNPs in the coding region of ANKK1, which is associated with Neuroticism and Extraversion, were the most frequent (13) among the identified variants. In contrast, nine out of the ten genes excluded from the candidate search, which have no variants with non-synonymous substitutions, were associated with Neuroticism. Out of the 18 identified genes, in 15 the substitutions were principally related to major signaling pathways in the central nervous system, such as the intracellular signaling pathway, neurotransmission pathway, the hypothalamic–pituitary–adrenal axis, and intercellular connections. Additionally, APOE and BDNF, the neurotrophic-related factors related to the accumulation of amyloid beta in the brain, and PER3, which is related to the regulation of circadian rhythm, were identified as personality-related genes (Table 1).

3.3. Characterization of Missense Mutations and Their Effects on Equine Personality

Among the 55 identified variants, the 18 most frequent SNPs (37.50%) exhibited ≤ 0.05 minor allele frequency (MAF), whereas 0.3–0.7 alteration allele frequency was detected in 8 SNPs (16.67%). Notably, two SNPs located at chr11:44188160 and chr11:44188161 on SLC6A4 both exhibited a high frequency of 0.668 (Table 2, Figure 2).
Codon insertion was not registered for the variant located at chrX:36800238 on MAOA in either the Ensembl or the UCSC genome database; however, codon deletion was recorded at the same location in the European Variation Achieve database. Moreover, allele frequency data for MAOA, which is on a sex chromosome, were not published in the Thoroughbred variant database.
Variants involving missense mutations were summarized as Human Genome Variant Society protein nomenclature (HGVSp) based on their amino acid location and substitution. Differences in molecular weight and hydrophobicity index owing to substitutions were analyzed for each variant (Table 3). Eight variants registered a molecular weight difference of ≥|40.00| Da, and fifteen variants resulted in ≥|1.00| deviation in the hydrophobicity index. Moreover, two HGVSp were identified for the variants at chr3:31382147 and chr3:31845727 on CDH13. The codon locations vary in each splice variant.

4. Discussion

In this study, 28 human personality-related genes and their orthologous genes in horses were identified. Among them, 18 genes were detected that have 55 DNA polymorphisms annotated as non-synonymous substitutions in the whole genome variant database of a population of 101 Thoroughbreds. Missense mutations potentially influence the structure of proteins, thereby altering their functions. Therefore, these 18 genes were putative candidate genes affecting personality diversity in horses. Moreover, among these genes, BDNF, HTR2A, and MAOA were reported as candidates principally associated with personality in horses [13]. Collectively, candidate genes can be identified using this bioinformatics method.
Amino acid substitution significantly alters molecular weight, alters the primary and secondary structure, and influences the functional characteristics of proteins [28]. Eight variants were detected that cause significant changes in the molecular weight of amino acids encoded by seven genes, namely, ANKK1, APOE, CDH13, DGKH, FAAH, HSD11B1, and MAOA. Accordingly, these variants could influence the protein–protein interaction network and, therefore, pathways associated with personality.
Altered hydrophobicity levels can disrupt the configuration of amino acids, resulting in changes in protein conformation and native folding [29]. Fifteen variants of seven genes—ANKK1, APOE, CDH13, DRD2, FAAH, GABRA6, and MAOA—were identified, which significantly impacted the hydrophobicity of the resulting amino acids. Therefore, the protein transportation and intercellular signaling pathways regulated by these genes may be affected by these amino acid alterations.
Gain or loss of an amino acid that participates in posttranslational modifications can alter the activity or localization of the protein, thereby affecting horse personality diversity. The variant at chrX:36799409 in MAOA removes cysteine, which is susceptible to S-nitrosylation; therefore, the enzyme activity and expression level of monoamine oxidase A (MAOA) may also be affected [30]. Variants causing gain or loss of asparagine, which is susceptible to N-glycosylation, were detected in genes encoding MAOA, ankyrin repeat and kinase domain containing I protein (ANKK1), and period circadian protein homolog 3 protein (PER3) [31]. Changes in folded protein structure influence the enzymatic activity of MAOA and ANKK1 and the efficiency of transportation and signal transduction of PER3. Additionally, serine, tyrosine, and threonine are frequently subjected to phosphorylation, which plays a role in cell signal switching [32]; variants causing gain or loss of these amino acids were detected in MAOA, ANKK1, PER3, HSD11B1, NPY, CDH13, DGKH, GABRA6, P2RX7, COMT, HTR2A, and LEP. Hence, amino-acid-specific posttranslational modification influences protein function and may also likely contribute to horse personality diversity.
Notably, many of the identified genes were related to Neuroticism. This personality trait indicates a neuropathological characteristic [33] and has been linked to a depression-related phenotype [34]. Moreover, ANKK1 and PER3 were associated with Extraversion, NPY was associated with Conscientiousness, CDH13 and CNR1 were associated with Agreeableness, and DGKH was associated with Openness; each of these genes was also associated with Neuroticism, suggesting that they mediate a trade-off or compatibility between the two personality traits.
Among the 55 variants, the fact that 37.50% of the SNPs represented 5% or less MAF may not relate to the universal diversity of personality in the Thoroughbred population because allele frequency of variants with low harmfulness to an organism tends to increase via genetic drift [35]. Accordingly, the widely expanded SNPs (MAF: 0.3–0.5) may be more useful for comprehending the universal diversity of Thoroughbred personality.
A substitution from cysteine to arginine at chrX:36799409 on MAOA may result in the loss of a disulfide bridge, which is the primary covalent protein bond. Consequently, this substitution may exacerbate the Neuroticism trait associated with MAOA since it causes the protein conformation to become unstable [36,37]. Changes at loci including chr3:31845727 on CDH13, chr7:22331004 on ANKK1, chr2:12174492 on FAAH, and chrX:36799409 on MAOA, can cause changes in both the configuration of amino acids and the conformation of coded proteins, and may thus functionally impact molecular weights and hydrophobicity levels. In particular, SNPs at chr3:31845727 and chrX:36799409 may cause alterations in protein activity due to the loss of serine and cysteine, respectively. These SNPs can thus potentially increase or decrease the output intensities of the corresponding personalities.
Although personality has been reported to vary between horse breeds, this can likely be attributed to environmental differences that are involved in managing horses and the variation of variant distribution in the population due to selective pressures on each breed [38]. Therefore, variants in personality-related candidate genes are assumed to be at the same loci and serve the same function in other breeds as in Thoroughbreds.
An escape response that occurs due to a frightening stimulus can lead to injuries when riding a horse; however, desensitization training can reduce this response [39,40]. Selectively retraining horses with low Neuroticism can improve the efficiency of converting racehorses for general horse riding. MAOA, which is related to Neuroticism in humans, may be responsible for the difference in escape response that exists between sexes [41]. Furthermore, horses’ reactivity to humans is considered to be related to the Openness trait, with a facet of curiosity [42]. Openness should be evaluated when retraining horses for use in careers that involve being touched by inexperienced and passive personnel because horses with high Openness may tend to demonstrate behaviors that have the potential to harm humans, such as biting hands or pulling clothes.

5. Conclusions

We developed a novel bioinformatics approach to identify equine personality-related candidate genes using related knowledge of human genes and the genome variant database of 101 Thoroughbreds. This strategy could support research progress in using genetics to predict equine personality, and it is expected to trigger investigations into the associated protein functions. Moreover, this findings may aid in expanding the knowledge of the possibility of selecting a second career for Thoroughbred horses based on genetics. This research can thus be used to improve the health and welfare of horses. As of now, this bioinformatics approach should be treated as preliminary since these gene–personality associations in horses have not been confirmed. Therefore, more in vivo studies and functional analyses are needed to demonstrate the accuracy and strength of these associations.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ani13040769/s1, Table S1: Horse orthologous genes which have variants causing non-synonymous substitutions.

Author Contributions

Conceptualization, T.Y. and T.T.; Methodology, T.Y. and T.T.; Investigation, T.Y.; Resources, T.T. and A.O.; Data curation, A.O. and T.Y.; Writing—original draft preparation, T.Y.; Writing—review and editing, T.T., T.I., A.O. and T.S.; visualization, T.Y.; supervision, T.T. and T.Y.; project administration, T.T. and T.I.; funding acquisition, T.I. and T.S. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Data regarding human personality-related genes were collected via searches of the National Center for Biotechnology Information gene database [22]. Thoroughbred variant information was extracted from the Thoroughbred variant database [21]. Orthologous gene information and variant annotation were derived from the Ensembl Genome Browser [25] and UCSC Genome Browser [26].

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Holcomb, K.E.; Stull, C.L.; Kass, P.H. Characteristics of relinquishing and adoptive owners of horses associated with US nonprofit equine rescue organizations. J. Appl. Anim. Welf. Sci. 2012, 15, 21–31. [Google Scholar] [CrossRef] [Scilit]
  2. Holcomb, K.E.; Stull, C.L.; Kass, P.H. Unwanted horses: The role of nonprofit equine rescue and sanctuary organizations. J. Anim. Sci. 2010, 88, 4142–4150. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Crawford, K.L.; Finnane, A.; Greer, R.M.; Phillips, C.J.; Woldeyohannes, S.M.; Perkins, N.R.; Ahern, B.J. Appraising the welfare of Thoroughbred racehorses in training in Queensland, Australia: The incidence, risk factors and outcomes for horses after retirement from racing. Animals 2021, 11, 142. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Burattini, B.; Fenner, K.; Anzulewicz, A.; Romness, N.; McKenzie, J.; Wilson, B.; McGreevy, P. Age-related changes in the behaviour of domestic horses as reported by owners. Animals 2020, 10, 2321. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Valenchon, M.; Lévy, F.; Prunier, A.; Moussu, C.; Calandreau, L.; Lansade, L. Stress modulates instrumental learning performances in horses (Equus caballus) in interaction with temperament. PLoS ONE 2013, 8, e62324. [Google Scholar] [CrossRef] [Scilit]
  6. Lansade, L.; Coutureau, E.; Marchand, A.; Baranger, G.; Valenchon, M.; Calandreau, L. Dimensions of temperament modulate cue-controlled behavior: A study on Pavlovian to instrumental transfer in horses (Equus caballus). PLoS ONE 2013, 8, e64853. [Google Scholar] [CrossRef] [Scilit]
  7. Swanberg, J.E.; Clouser, J.M.; Westneat, S.C.; Marsh, M.W.; Reed, D.B. Occupational injuries on Thoroughbred horse farms: A description of Latino and non-Latino workers’ experiences. Int. J. Environ. Res. Public Health 2013, 10, 6500–6516. [Google Scholar] [CrossRef] [Scilit]
  8. Swanberg, J.E.; Clouser, J.M.; Bush, A.; Westneat, S. From the horse worker’s mouth: A detailed account of injuries experienced by Latino horse workers. J. Immigr. Minor. Health 2016, 18, 513–521. [Google Scholar] [CrossRef] [Scilit]
  9. Sallis, H.; Davey Smith, G.; Munafò, M.R. Genetics of biologically based psychological differences. Philos. Trans. R. Soc. Lond. B Biol. Sci. 2018, 373, 20170162. [Google Scholar] [CrossRef] [Scilit]
  10. Persson, B. Genotype-Environment Correlation and Its Relation to Personality—A Twin and Family Study. Twin Res. Hum. Genet. 2020, 23, 228–234. [Google Scholar] [CrossRef] [Scilit]
  11. Heilbronner, U.; Papiol, S.; Budde, M.; Andlauer, T.F.M.; Strohmaier, J.; Streit, F.; Frank, J.; Degenhardt, F.; Heilmann-Heimbach, S.; Witt, S.H.; et al. “The Heidelberg Five” personality dimensions: Genome-wide associations, polygenic risk for neuroticism, and psychopathology 20 years after assessment. Am. J. Med. Genet. B Neuropsychiatr. Genet. 2021, 186, 77–89. [Google Scholar] [CrossRef] [Scilit]
  12. Le Scolan, N.; Hausberger, M.; Wolff, A. Stability over situations in temperamental traits of horses as revealed by experimental and scoring approaches. Behav. Process. 1997, 41, 257–266. [Google Scholar] [CrossRef] [Scilit]
  13. Hausberger, M.; Bruderer, C.; Le Scolan, N.; Pierre, J.S. Interplay between environmental and genetic factors in temperament/personality traits in horses (Equus caballus). J. Comp. Psychol. 2004, 118, 434–446. [Google Scholar] [CrossRef] [Scilit]
  14. Jacobs, L.N.; Staiger, E.A.; Albright, J.D.; Brooks, S.A. The MC1R and ASIP Coat Color Loci May Impact Behavior in the Horse. J. Hered. 2016, 107, 214–219. [Google Scholar] [CrossRef] [Scilit]
  15. Momozawa, Y.; Takeuchi, Y.; Kusunose, R.; Kikusui, T.; Mori, Y. Association between equine temperament and polymorphisms in dopamine D4 receptor gene. Mamm. Genome 2005, 16, 538–544. [Google Scholar] [CrossRef] [Scilit]
  16. Roberts, K.; Hemmings, A.J.; Moore-Colyer, M.; Parker, M.O.; McBride, S.D. Neural modulators of temperament: A multivariate approach to personality trait identification in the horse. Physiol. Behav. 2016, 167, 125–131. [Google Scholar] [CrossRef] [Scilit]
  17. Kim, J.; Park, Y.; Kim, E.J.; Jung, H.; Yoon, M. Relationship between oxytocin and serotonin and the fearfulness, dominance, and trainability of horses. J. Anim. Sci. Technol. 2021, 63, 453–460. [Google Scholar] [CrossRef] [Scilit]
  18. Momozawa, Y.; Takeuchi, Y.; Tozaki, T.; Kikusui, T.; Hasegawa, T.; Raudsepp, T.; Chowdhary, B.P.; Kusunose, R.; Mori, Y. SNP detection and radiation hybrid mapping in horses of nine candidate genes for temperament. Anim. Genet. 2007, 38, 81–83. [Google Scholar] [CrossRef] [Scilit]
  19. Hori, Y.; Tozaki, T.; Nambo, Y.; Sato, F.; Ishimaru, M.; Inoue-Murayama, M.; Fujita, K. Evidence for the effect of serotonin receptor 1A gene (HTR1A) polymorphism on tractability in Thoroughbred horses. Anim. Genet. 2016, 47, 62–67. [Google Scholar] [CrossRef] [Scilit]
  20. Fenner, K.; Dashper, K.; Serpell, J.; McLean, A.; Wilkins, C.; Klinck, M.; Wilson, B.; McGreevy, P. The development of a novel questionnaire approach to the investigation of horse training, management, and behaviour. Animals 2020, 10, 1960. [Google Scholar] [CrossRef] [Scilit]
  21. Tozaki, T.; Ohnuma, A.; Kikuchi, M.; Ishige, T.; Kakoi, H.; Hirota, K.I.; Kusano, K.; Nagata, S.I. Rare and common variant discovery by whole-genome sequencing of 101 Thoroughbred racehorses. Sci. Rep. 2021, 11, 16057. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  22. Gene. National Library of Medicine (US), National Center for Biotechnology Information: Bethesda, MD, USA. 2004. Available online: https://www.ncbi.nlm.nih.gov/gene/ (accessed on 5 October 2022).
  23. Jang, K.L.; Livesley, W.J.; Vernon, P.A. Heritability of the big five personality dimensions and their facets: A twin study. J. Pers. 1996, 64, 577–591. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Kalbfleisch, T.S.; Rice, E.S.; DePriest, M.S., Jr.; Walenz, B.P.; Hestand, M.S.; Vermeesch, J.R.; O’Connell, B.L.; Fiddes, I.T.; Vershinina, A.O.; Saremi, N.F.; et al. Improved reference genome for the domestic horse increases assembly contiguity and composition. Commun. Biol. 2018, 1, 197. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Cunningham, F.; Allen, J.E.; Allen, J.; Alvarez-Jarreta, J.; Amode, M.R.; Armean, I.M.; Austine-Orimoloye, O.; Azov, A.G.; Barnes, I.; Bennett, R.; et al. Ensembl 2022. Nucleic Acids Res. 2022, 50, D988–D995. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Kent, W.J.; Sugnet, C.W.; Furey, T.S.; Roskin, K.M.; Pringle, T.H.; Zahler, A.M.; Haussler, D. The human genome browser at UCSC. Genome Res. 2002, 12, 996–1006. [Google Scholar] [CrossRef] [Scilit]
  27. Eisenberg, D.S.; Schwarz, E.E.; Komaromy, M.; Wall, R. Analysis of membrane and surface protein sequences with the hydrophobic moment plot. J. Mol. Biol. 1984, 179, 125–142. [Google Scholar] [CrossRef] [Scilit]
  28. Martin, G.G.; McIntosh, A.L.; Huang, H.; Gupta, S.; Atshaves, B.P.; Landrock, K.K.; Landrock, D.; Kier, A.B.; Schroeder, F. The human liver fatty acid binding protein T94A variant alters the structure, stability, and interaction with fibrates. Biochemistry 2013, 52, 9347–9357. [Google Scholar] [CrossRef] [Scilit]
  29. Taketomi, T.; Yasuda, T.; Morita, R.; Kim, J.; Shigeta, Y.; Eroglu, C.; Harada, R.; Tsuruta, F. Autism-associated mutation in Hevin/Sparcl1 induces endoplasmic reticulum stress through structural instability. Sci. Rep. 2022, 12, 11891. [Google Scholar] [CrossRef] [Scilit]
  30. Fujikawa, K.; Nakahara, K.; Takasugi, N.; Nishiya, T.; Ito, A.; Uchida, K.; Uehara, T. S-Nitrosylation at the active site decreases the ubiquitin-conjugating activity of ubiquitin-conjugating enzyme E2 D1 (UBE2D1), an ERAD-associated protein. Biochem. Biophys. Res. Commun. 2020, 524, 910–915. [Google Scholar] [CrossRef] [Scilit]
  31. Hirata, T.; Kizuka, Y. N-Glycosylation. Adv. Exp. Med. Biol. 2021, 1325, 3–24. [Google Scholar] [CrossRef] [Scilit]
  32. Hunter, T. Why nature chose phosphate to modify proteins. Philos. Trans. R. Soc. B Biol. Sci. 2012, 367, 2513–2516. [Google Scholar] [CrossRef] [Scilit]
  33. Terracciano, A.; Aschwanden, D.; Passamonti, L.; Toschi, N.; Stephan, Y.; Luchetti, M.; Lee, J.H.; Sesker, A.; O’Súilleabháin, P.S.; Sutin, A.R. Is neuroticism differentially associated with risk of Alzheimer’s disease, vascular dementia, and frontotemporal dementia? J. Psychiatr. Res. 2021, 138, 34–40. [Google Scholar] [CrossRef] [Scilit]
  34. Adams, M.J.; Howard, D.M.; Luciano, M.; Clarke, T.K.; Davies, G.; Hill, W.D.; Smith, D.; Deary, I.J.; 23andMe Research Team; Major Depressive Disorder Working Group of the Psychiatric Genomics Consortium; et al. Genetic stratification of depression by neuroticism: Revisiting a diagnostic tradition. Psychol. Med. 2020, 50, 2526–2535. [Google Scholar] [CrossRef] [Scilit]
  35. Pardiñas, A.F.; Holmans, P.; Pocklington, A.J.; Escott-Price, V.; Ripke, S.; Carrera, N.; Legge, S.E.; Bishop, S.; Cameron, D.; Hamshere, M.L.; et al. Common schizophrenia alleles are enriched in mutation-intolerant genes and in regions under strong background selection. Nat. Genet. 2018, 50, 381–389. [Google Scholar] [CrossRef] [Scilit]
  36. Ahmad, S.; Khan, H.; Shahab, U.; Rehman, S.; Rafi, Z.; Khan, M.Y.; Ansari, A.; Siddiqui, Z.; Ashraf, J.M.; Abdullah, S.M.; et al. Protein oxidation: An overview of metabolism of sulphur containing amino acid, cysteine. Front. Biosci. Schol. Ed. 2017, 9, 71–87. [Google Scholar] [CrossRef] [Scilit]
  37. Eley, T.C.; Tahir, E.; Angleitner, A.; Harriss, K.; McClay, J.; Plomin, R.; Riemann, R.; Spinath, F.; Craig, I. Association analysis of MAOA and COMT with neuroticism assessed by peers. Am. J. Med. Genet. B Neuropsychiatr. Genet. 2003, 120, 90–96. [Google Scholar] [CrossRef] [Scilit]
  38. Lloyd, A.S.; Martin, J.E.; Bornett-Gauci, H.L.I.; Wilkinson, R.G. Horse personality: Variation between breeds. Appl. Anim. Behav. Sci. 2008, 112, 369–383. [Google Scholar] [CrossRef] [Scilit]
  39. Christensen, J.W.; Rundgren, M.; Olsson, K. Training methods for horses: Habituation to a frightening stimulus. Equine Vet. J. 2006, 38, 439–443. [Google Scholar] [CrossRef] [Scilit]
  40. Riva, M.G.; Dai, F.; Huhtinen, M.; Minero, M.; Barbieri, S.; Dalla Costa, E. The Impact of Noise Anxiety on Behavior and Welfare of Horses from UK and US Owner’s Perspective. Animals 2022, 12, 1319. [Google Scholar] [CrossRef] [Scilit]
  41. Lee, K.E.; Kim, J.G.; Lee, H.; Kim, B.S. Behavioral and cardiac responses in mature horses exposed to a novel object. J. Anim. Sci. Technol. 2021, 63, 651–661. [Google Scholar] [CrossRef] [Scilit]
  42. Lansade, L.; Bouissou, M.-F. Reactivity to Humans: A Temperament Trait of Horses Which Is Stable across Time and Situations. Appl. Anim. Behav. Sci. 2008, 114, 492–508. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Methods pipeline. This shows the databases used in colored boxes, along with the inputs and outputs for each to the right side of each box. The sentences below the outputs show the objective for using each database. Finally, we list the items used to evaluate the importance of individual SNPs and their potential effect on personality.
Figure 1. Methods pipeline. This shows the databases used in colored boxes, along with the inputs and outputs for each to the right side of each box. The sentences below the outputs show the objective for using each database. Finally, we list the items used to evaluate the importance of individual SNPs and their potential effect on personality.
Animals 13 00769 g001
Figure 2. Distribution of alteration allele frequencies of the 18 most frequently identified horse personality-related genes. The histogram depicts the number of SNPs in each frequency hierarchy value. The total is 48 SNPs, and the maximum and minimum values of alteration allele frequency are 0.668 and 0.005, respectively.
Figure 2. Distribution of alteration allele frequencies of the 18 most frequently identified horse personality-related genes. The histogram depicts the number of SNPs in each frequency hierarchy value. The total is 48 SNPs, and the maximum and minimum values of alteration allele frequency are 0.668 and 0.005, respectively.
Animals 13 00769 g002
Table 1. Categories of biological function and the classification of equine personality-related gene candidates.
Table 1. Categories of biological function and the classification of equine personality-related gene candidates.
Biological FunctionGene
Intracellular signaling pathway DGKH, FAAH
Neurotransmission pathwayMonoamine neurotransmissionDopaminergic signaling systemANKK1, DRD2
Serotonergic signaling systemHTR2A, SLC6A4
Monoamine inactivation enzymeCOMT, MAOA
Amino acid neurotransmissionGABAergic signaling systemGABRA6
Endogenous cannabinoid signaling systemCNR1
Peptide neurotransmission LEP, NPY
Purinergic signaling system P2RX7
Hypothalamic–pituitary–adrenal axis HSD11B1
Neurotrophic-related factor APOE, BDNF
Intercellular connections CDH13
Circadian rhythm PER3
Table 2. Alleles and variant frequencies in the 18 most frequently identified equine personality-related genes.
Table 2. Alleles and variant frequencies in the 18 most frequently identified equine personality-related genes.
GeneChromosomePositionReference AlleleAlteration AlleleReference Allele FrequencyAlteration Allele Frequency
FAAH212167952GA0.9950.005
12174477GA0.9360.064
12174492GT0.9550.045
PER3243209639AG0.6830.317
43231315AG0.6780.322
43240108CA0.8220.178
CDH13331079056TC0.9110.089
31230472GA0.9550.045
31382147CT0.7570.243
31845727CT0.9950.005
NPY455899514CG0.8610.139
LEP483529565CT0.8910.109
HSD11B1525786262TG0.7670.233
ANKK1722319266AG0.7820.218
22319267TA0.7870.213
22319365GC0.7720.228
22319396TC0.9950.005
22319430GT0.9950.005
22319446AG0.7820.218
22319470GA0.7870.213
22326586AG0.6980.302
22327351GA0.6980.302
22329824CT0.9750.025
22330242GA0.9950.005
22331004CA0.9600.040
22331042GA0.9410.059
DRD2722348064TA0.9950.005
BDNF796310373AT0.8120.188
COMT8432351TC0.8420.158
434481AG0.8860.114
P2RX7824214858AG0.6440.356
APOE1015713778AG0.9950.005
15714427AG0.8320.168
15714824TG0.9950.005
CNR11041805559CT0.9460.054
SLC6A41144188160AG0.3320.668
44188161CT0.3320.668
44192165TC0.9850.015
44200439AC0.9700.030
GABRA61417329705AC0.9500.050
17329709CT0.8420.158
17329851AT0.7770.223
17329886TC0.9850.015
17338413AG0.6730.327
17343960CT0.9260.074
HTR2A1723797786AG0.9900.010
DGKH1727918092GT0.8320.168
28048492AG0.9850.015
MAOAX36799409TCNANA
36799613GANANA
36800118CGNANA
36800211TCNANA
36800238C*NANA
36800403GTNANA
36801932ACNANA
*: CATCTTTCCCGTTCTTGGGCTCCTCCCAAGTGTCGGTACTAGGGTCCGCCCCGCCATCAGTGCCAACTCCCC-CTGGAGTTCGGTACAAGG. Reference and alteration allele frequency: The values were extracted from the genome variant information database of 101 Thoroughbreds. The database uses EquCab3.0 as a reference sequence. NA: Not available. Data on allele frequencies of MAOA are lacking because this gene is on a sex chromosome, which is not published in the Thoroughbred variant database.
Table 3. Amino acid alterations and the differences in molecular weights and hydrophobicity levels caused by each variant.
Table 3. Amino acid alterations and the differences in molecular weights and hydrophobicity levels caused by each variant.
GeneChromosomePositionHGVSpAnnotationMolecular Weight
Difference
Hydrophobicity Index
Difference
FAAH212167952A96Vnon-synonymous coding28.060.46
12174477A13Vnon-synonymous coding28.060.46
12174492A8Dnon-synonymous coding44.01−1.52
PER3243209639L837Snon-synonymous coding−26.08−1.24
43231315V465Anon-synonymous coding−28.06−0.46
43240108K241Nnon-synonymous coding−14.070.72
CDH13331079056Y20Hnon-synonymous coding−26.04−0.66
31230472V95Inon-synonymous coding14.020.3
31382147R173W
R134W
non-synonymous coding30.033.34
31845727S696F
S657F
non-synonymous coding60.11.37
NPY455899514T139Snon-synonymous coding−14.03−0.13
LEP483529565T70Msplice site region
non-synonymous coding
30.090.69
HSD11B1525786262Y88Snon-synonymous coding−76.1−0.44
ANKK1722319266I10Vnon-synonymous coding−14.02−0.3
22319267I10Nnon-synonymous coding0.95−2.16
22319365E43Qnon-synonymous coding−0.981.22
22319396L53Pnon-synonymous coding−16.04−0.94
22319430E64Dnon-synonymous coding−14.03−0.16
22319446T70Anon-synonymous coding−30.030.67
22319470E78Knon-synonymous coding−0.94−0.76
22326586I287Vnon-synonymous coding−14.02−0.3
22327351R337Hnon-synonymous coding−19.052.13
22329824R411Wnon-synonymous coding30.033.34
22330242R550Qnon-synonymous coding−28.053.01
22331004A804Dnon-synonymous coding44.01−1.52
22331042E817Knon-synonymous coding−0.94−0.76
DRD2722348064K101Inon-synonymous coding−15.022.88
BDNF796310373H14Qnon-synonymous coding−90.88
COMT8432351T231Anon-synonymous coding−30.030.67
434481M159Tnon-synonymous coding−30.09−0.69
P2RX7824214858S589Gnon-synonymous coding−30.020.66
APOE1015713778Q17Rnon-synonymous coding28.05−3.01
15714427M100Vnon-synonymous coding−32.060.44
15714824V232Gnon-synonymous coding−42.08−0.6
CNR11041805559V263Inon-synonymous coding14.020.3
SLC6A41144188160V539Anon-synonymous coding−28.06−0.46
44188161V539Inon-synonymous coding14.020.3
44192165I408Vnon-synonymous coding−14.02−0.3
44200439D36Enon-synonymous coding14.030.16
GABRA61417329705I423Mnon-synonymous coding18.04−0.74
17329709R422Qnon-synonymous coding−28.053.01
17329851S375Tnon-synonymous coding14.030.13
17329886H363Rsplice site region
non-synonymous coding
19.05−2.13
17338413V352Anon-synonymous coding−28.06−0.46
17343960E30Knon-synonymous coding−0.94−0.76
HTR2A1723797786T39Anon-synonymous coding−30.030.67
DGKH1727918092S631Ynon-synonymous coding76.10.44
28048492V12Anon-synonymous coding−28.06−0.46
MAOAX36799409C24Rnon-synonymous coding53.04−2.82
36799613G92Snon-synonymous coding30.02−0.66
36800118A142G
A260G
non-synonymous coding−14.02−0.14
36800211L173P
L291P
non-synonymous coding−16.04−0.94
36800238*codon insertionNANA
36800403W237L
W355L
non-synonymous coding−73.060.25
36801932N307Tnon-synonymous coding−130.73
*: S182SSFPFLGSSQVSVLGSAPPSVPSSPWSSVQG or S300SSFPFLGSSQVSVLGSAPPSVPSSPWSSVQG. HGVSp: Label of differences in the coded amino acid compared to that of reference sequence recommended by Human Genome Variation Society, showing reference amino acid, mutated position on the reference sequence, and altered amino acid. Molecular weight difference: Differences of amino acids caused by variants were calculated as (altered molecular weight) − (reference molecular weight). Values with molecular weight difference ≥|40.00| Da are underlined. The data corresponding to the variant X:36800238 in MAOA are lacking due to the long sequence insertion. Hydrophobicity index difference: This difference, caused by the amino acid substitution, was calculated as (altered hydrophobicity level) − (reference hydrophobicity level). Values with a difference ≥|1.00| are underlined. NA: Not available. Data are lacking corresponding to the insertion in MAOA due to the long sequence insertion.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Yokomori, T.; Ohnuma, A.; Tozaki, T.; Segawa, T.; Itou, T. Identification of Personality-Related Candidate Genes in Thoroughbred Racehorses Using a Bioinformatics-Based Approach Involving Functionally Annotated Human Genes. Animals 2023, 13, 769. https://doi.org/10.3390/ani13040769

AMA Style

Yokomori T, Ohnuma A, Tozaki T, Segawa T, Itou T. Identification of Personality-Related Candidate Genes in Thoroughbred Racehorses Using a Bioinformatics-Based Approach Involving Functionally Annotated Human Genes. Animals. 2023; 13(4):769. https://doi.org/10.3390/ani13040769

Chicago/Turabian Style

Yokomori, Tamu, Aoi Ohnuma, Teruaki Tozaki, Takao Segawa, and Takuya Itou. 2023. "Identification of Personality-Related Candidate Genes in Thoroughbred Racehorses Using a Bioinformatics-Based Approach Involving Functionally Annotated Human Genes" Animals 13, no. 4: 769. https://doi.org/10.3390/ani13040769

APA Style

Yokomori, T., Ohnuma, A., Tozaki, T., Segawa, T., & Itou, T. (2023). Identification of Personality-Related Candidate Genes in Thoroughbred Racehorses Using a Bioinformatics-Based Approach Involving Functionally Annotated Human Genes. Animals, 13(4), 769. https://doi.org/10.3390/ani13040769

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop