New High-Affinity Peptide Ligands for Kv1.2 Channel: Selective Blockers and Fluorescent Probes
Abstract
1. Introduction
2. Materials and Methods
2.1. Reagents
2.2. Construction of Expression Plasmids
2.3. Recombinant Peptide Toxins and HgTx-G
2.4. CD Spectrum Measurements and Analysis
2.5. Cell Culture and Transfection
2.6. Electrophysiology Measurements
2.7. Confocal Microscopy
2.8. Quantitative Analysis of Fluorescent Images
2.9. Molecular Modeling
3. Results
3.1. Design of Fluorescent Kv1.2 Channels with Increased Localization in Plasma Membrane
3.2. Intracellular Localization of Kv1.2 Channels
3.3. Electrophysiology Study of K-Kv1.2
3.4. Genetically Encoded Fluorescent Ligand of Kv1.2 Channel
3.5. K-Kv1.2 and HgTx-G as Components of an Analytical System
3.6. Study of Ce Peptides
3.7. Molecular Modeling of Peptide-Channel Complexes
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Dwenger, M.M.; Ohanyan, V.; Navedo, M.F.; Nystoriak, M.A. Coronary Microvascular Kv1 Channels as Regulatory Sensors of Intracellular Pyridine Nucleotide Redox Potential. Microcirculation 2018, 25, e12426. [Google Scholar] [CrossRef] [PubMed]
- Shah, N.H.; Aizenman, E. Voltage-Gated Potassium Channels at the Crossroads of Neuronal Function, Ischemic Tolerance, and Neurodegeneration. Transl. Stroke Res. 2014, 5, 38–58. [Google Scholar] [CrossRef]
- Pérez-Verdaguer, M.; Capera, J.; Serrano-Novillo, C.; Estadella, I.; Sastre, D.; Felipe, A. The Voltage-Gated Potassium Channel Kv1.3 Is a Promising Multitherapeutic Target against Human Pathologies. Expert. Opin. Ther. Targets 2016, 20, 577–591. [Google Scholar] [CrossRef] [PubMed]
- Cheng, S.; Jiang, D.; Lan, X.; Liu, K.; Fan, C. Voltage-Gated Potassium Channel 1.3: A Promising Molecular Target in Multiple Disease Therapy. Biomed. Pharmacother. 2024, 175, 116651. [Google Scholar] [CrossRef] [PubMed]
- Zhao, W.; Chen, Y. Progress in Research of KV1.1 and KV1.3 Channels as Therapeutic Targets. Curr. Top. Med. Chem. 2016, 16, 1877–1885. [Google Scholar] [CrossRef]
- Zhao, Y.; Chen, Z.; Cao, Z.; Li, W.; Wu, Y. Diverse Structural Features of Potassium Channels Characterized by Scorpion Toxins as Molecular Probes. Molecules 2019, 24, 2045. [Google Scholar] [CrossRef] [PubMed]
- Kuzmenkov, A.I.; Grishin, E.V.; Vassilevski, A.A. Diversity of Potassium Channel Ligands: Focus on Scorpion Toxins. Biochemistry 2015, 80, 1764–1799. [Google Scholar] [CrossRef] [PubMed]
- Aissaoui, D.; Mlayah-Bellalouna, S.; Jebali, J.; Abdelkafi-Koubaa, Z.; Souid, S.; Moslah, W.; Othman, H.; Luis, J.; ElAyeb, M.; Marrakchi, N.; et al. Functional Role of Kv1.1 and Kv1.3 Channels in the Neoplastic Progression Steps of Three Cancer Cell Lines, Elucidated by Scorpion Peptides. Int. J. Biol. Macromol. 2018, 111, 1146–1155. [Google Scholar] [CrossRef] [PubMed]
- Varga, Z.; Tajti, G.; Panyi, G. The Kv1.3 K+ Channel in the Immune System and Its “Precision Pharmacology” Using Peptide Toxins. Biol. Futur. 2021, 72, 75–83. [Google Scholar] [CrossRef] [PubMed]
- Mendes, L.C.; Viana, G.M.M.; Nencioni, A.L.A.; Pimenta, D.C.; Beraldo-Neto, E. Scorpion Peptides and Ion Channels: An Insightful Review of Mechanisms and Drug Development. Toxins 2023, 15, 238. [Google Scholar] [CrossRef] [PubMed]
- Wulff, H.; Christophersen, P.; Colussi, P.; Chandy, K.G.; Yarov-Yarovoy, V. Antibodies and Venom Peptides: New Modalities for Ion Channels. Nat. Rev. Drug Discov. 2019, 18, 339–357. [Google Scholar] [CrossRef] [PubMed]
- Harvey, A.L. Twenty Years of Dendrotoxins. Toxicon 2001, 39, 15–26. [Google Scholar] [CrossRef] [PubMed]
- Zenker, J.; Poirot, O.; Charles, A.S.d.P.; Arnaud, E.; Médard, J.J.; Lacroix, C.; Kuntzer, T.; Chrast, R. Altered Distribution of Juxtaparanodal Kv1.2 Subunits Mediates Peripheral Nerve Hyperexcitability in Type 2 Diabetes Mellitus. J. Neurosci. 2012, 32, 7493–7498. [Google Scholar] [CrossRef] [PubMed]
- Southan, A.P.; Robertson, B. Patch-Clamp Recordings from Cerebellar Basket Cell Bodies and Their Presynaptic Terminals Reveal an Asymmetric Distribution of Voltage-Gated Potassium Channels. J. Neurosci. 1998, 18, 948–955. [Google Scholar] [CrossRef]
- Sharma, K.; Kang, K.W.; Seo, Y.W.; Glowatzki, E.; Yi, E. Low-Voltage Activating K+ Channels in Cochlear Afferent Nerve Fiber Dendrites. Exp. Neurobiol. 2022, 31, 243–259. [Google Scholar] [CrossRef]
- Bagchi, B.; Al-Sabi, A.; Kaza, S.; Scholz, D.; O’Leary, V.B.; Dolly, J.O.; Ovsepian, S.V. Disruption of Myelin Leads to Ectopic Expression of K(V)1.1 Channels with Abnormal Conductivity of Optic Nerve Axons in a Cuprizone-Induced Model of Demyelination. PLoS ONE 2014, 9, e87736. [Google Scholar] [CrossRef] [PubMed]
- Martel, P.; Leo, D.; Fulton, S.; Bérard, M.; Trudeau, L.E. Role of Kv1 Potassium Channels in Regulating Dopamine Release and Presynaptic D2 Receptor Function. PLoS ONE 2011, 6, e20402. [Google Scholar] [CrossRef]
- Meneses, D.; Vega, A.V.; Torres-Cruz, F.M.; Barral, J. KV1 and KV3 Potassium Channels Identified at Presynaptic Terminals of the Corticostriatal Synapses in Rat. Neural Plast. 2016, 2016, 8782518. [Google Scholar] [CrossRef] [PubMed]
- Xiao, Y.; Yang, J.; Ji, W.; He, Q.; Mao, L.; Shu, Y. A- and D-Type Potassium Currents Regulate Axonal Action Potential Repolarization in Midbrain Dopamine Neurons. Neuropharmacology 2021, 185, 108399. [Google Scholar] [CrossRef]
- Koschak, A.; Bugianesi, R.M.; Mitterdorfer, J.; Kaczorowski, G.J.; Garcia, M.L.; Knaus, H.G. Subunit Composition of Brain Voltage-Gated Potassium Channels Determined by Hongotoxin-1, a Novel Peptide Derived from Centruroides Limbatus Venom. J. Biol. Chem. 1998, 273, 2639–2644. [Google Scholar] [CrossRef]
- Helms, L.M.H.; Felix, J.P.; Bugianesi, R.M.; Garcia, M.L.; Stevens, S.; Leonard, R.J.; Knaus, H.G.; Koch, R.; Wanner, S.G.; Kaczorowski, G.J.; et al. Margatoxin Binds to a Homomultimer of K(V)1.3 Channels in Jurkat Cells. Comparison with K(V)1.3 Expressed in CHO Cells. Biochemistry 1997, 36, 3737–3744. [Google Scholar] [CrossRef]
- Legros, C.; Schulze, C.; Garcia, M.L.; Bougis, P.E.; Martin-Eauclaire, M.F.; Pongs, O. Engineering-Specific Pharmacological Binding Sites for Peptidyl Inhibitors of Potassium Channels into KcsA. Biochemistry 2002, 41, 15369–15375. [Google Scholar] [CrossRef]
- Pragl, B.; Koschak, A.; Trieb, M.; Obermair, G.; Kaufmann, W.A.; Gerster, U.; Blanc, E.; Hahn, C.; Prinz, H.; Schütz, G.; et al. Synthesis, Characterization, and Application of Cy-Dye- and Alexa-Dye-Labeled Hongotoxin(1) Analogues. The First High Affinity Fluorescence Probes for Voltage-Gated K+ Channels. Bioconjug. Chem. 2002, 13, 416–425. [Google Scholar] [CrossRef]
- Orlov, N.A.; Ignatova, A.A.; Kryukova, E.V.; Yakimov, S.A.; Kirpichnikov, M.P.; Nekrasova, O.V.; Feofanov, A.V. Combining MKate2-Kv1.3 Channel and Atto488-Hongotoxin for the Studies of Peptide Pore Blockers on Living Eukaryotic Cells. Toxins 2022, 14, 858. [Google Scholar] [CrossRef]
- Orlov, N.A.; Kryukova, E.V.; Efremenko, A.V.; Yakimov, S.A.; Toporova, V.A.; Kirpichnikov, M.P.; Nekrasova, O.V.; Feofanov, A.V. Interactions of the Kv1.1 Channel with Peptide Pore Blockers: A Fluorescent Analysis on Mammalian Cells. Membranes 2023, 13, 645. [Google Scholar] [CrossRef]
- William, M.R.; Fuchs, J.R.; Green, J.T.; Morielli, A.D. Cellular Mechanisms and Behavioral Consequences of Kv1.2 Regulation in the Rat Cerebellum. J. Neurosci. 2012, 32, 9228–9237. [Google Scholar] [CrossRef]
- Krylov, N.A.; Tabakmakher, V.M.; Yureva, D.A.; Vassilevski, A.A.; Kuzmenkov, A.I. Kalium 3.0 Is a Comprehensive Depository of Natural, Artificial, and Labeled Polypeptides Acting on Potassium Channels. Protein Sci. 2023, 32, e4776. [Google Scholar] [CrossRef] [PubMed]
- Wang, X.; Umetsu, Y.; Gao, B.; Ohki, S.; Zhu, S. Mesomartoxin, a New K v 1. 2-Selective Scorpion Toxin Interacting with the Channel Selectivity Filter. Biochem. Pharmacol. 2015, 93, 232–239. [Google Scholar] [CrossRef]
- Kuzmenkov, A.I.; Nekrasova, O.V.; Peigneur, S.; Tabakmakher, V.M.; Gigolaev, A.M.; Fradkov, A.F.; Kudryashova, K.S.; Chugunov, A.O.; Efremov, R.G.; Tytgat, J.; et al. K V 1.2 Channel-Specific Blocker from Mesobuthus Eupeus Scorpion Venom: Structural Basis of Selectivity. Neuropharmacology 2018, 143, 228–238. [Google Scholar] [CrossRef]
- Shakeel, K.; Olamendi-Portugal, T.; Naseem, M.U.; Becerril, B.; Zamudio, F.Z.; Delgado-Prudencio, G.; Possani, L.D.; Panyi, G. Of Seven New K+ Channel Inhibitor Peptides of Centruroides Bonito, α-KTx 2.24 Has a Picomolar Affinity for Kv1.2. Toxins 2023, 15, 506. [Google Scholar] [CrossRef] [PubMed]
- Gigolaev, A.M.; Pinheiro-Junior, E.L.; Peigneur, S.; Tytgat, J.; Vassilevski, A.A. KV1.2-Selective Peptide with High Affinity. J. Evol. Biochem. Physiol. 2022, 58, 2048–2057. [Google Scholar] [CrossRef]
- Tropea, J.E.; Cherry, S.; Waugh, D.S. Expression and Purification of Soluble His(6)-Tagged TEV Protease. Methods Mol. Biol. 2009, 498, 297–307. [Google Scholar] [CrossRef]
- Nekrasova, O.; Kudryashova, K.; Fradkov, A.; Yakimov, S.; Savelieva, M.; Kirpichnikov, M.; Feofanov, A. Straightforward Approach to Produce Recombinant Scorpion Toxins—Pore Blockers of Potassium Channels. J. Biotechnol. 2017, 241, 127–135. [Google Scholar] [CrossRef] [PubMed]
- Orlov, N.A.; Yakimov, S.A.; Nekrasova, O.V.; Feofanov, A.V. Recombinant Peptides Ce1 and Ce4 from the Venom of Scorpion Centruroides Elegans and Their Interactions with Hybrid Channels KcsA-Kv1.x (x = 1, 3, 6). Mosc. Univ. Biol. Sci. Bull. 2022, 77, 119–125. [Google Scholar] [CrossRef]
- Nekrasova, O.V.; Primak, A.L.; Ignatova, A.A.; Novoseletsky, V.N.; Geras’kina, O.V.; Kudryashova, K.S.; Yakimov, S.A.; Kirpichnikov, M.P.; Arseniev, A.S.; Feofanov, A.V. N-Terminal Tagging with GFP Enhances Selectivity of Agitoxin 2 to Kv1.3-Channel Binding Site. Toxins 2020, 12, 802. [Google Scholar] [CrossRef]
- Provencher, S.W.; Glöckner, J. Estimation of Globular Protein Secondary Structure from Circular Dichroism. Biochemistry 1981, 20, 33–37. [Google Scholar] [CrossRef] [PubMed]
- Berman, H.M.; Westbrook, J.; Feng, Z.; Gilliland, G.; Bhat, T.N.; Weissig, H.; Shindyalov, I.N.; Bourne, P.E. The Protein Data Bank. Nucleic Acids Res. 2000, 28, 235–242. [Google Scholar] [CrossRef] [PubMed]
- Varadi, M.; Bertoni, D.; Magana, P.; Paramval, U.; Pidruchna, I.; Radhakrishnan, M.; Tsenkov, M.; Nair, S.; Mirdita, M.; Yeo, J.; et al. AlphaFold Protein Structure Database in 2024: Providing Structure Coverage for over 214 Million Protein Sequences. Nucleic Acids Res. 2024, 52, D368–D375. [Google Scholar] [CrossRef] [PubMed]
- Mirdita, M.; Schütze, K.; Moriwaki, Y.; Heo, L.; Ovchinnikov, S.; Steinegger, M. ColabFold: Making Protein Folding Accessible to All. Nat. Methods 2022, 19, 679–682. [Google Scholar] [CrossRef]
- Jo, S.; Cheng, X.; Lee, J.; Kim, S.; Park, S.J.; Patel, D.S.; Beaven, A.H.; Lee, K.I.; Rui, H.; Park, S.; et al. CHARMM-GUI 10 Years for Biomolecular Modeling and Simulation. J. Comput. Chem. 2017, 38, 1114–1124. [Google Scholar] [CrossRef] [PubMed]
- Lindahl, E.; Bjelkmar, P.; Larsson, P.; Cuendet, M.A.; Hess, B. Implementation of the CHARMM Force Field in GROMACS: Analysis of Protein Stability Effects from Correction Maps, Virtual Interaction Sites, and Water Models. J. Chem. Theory Comput. 2010, 6, 459–466. [Google Scholar] [CrossRef]
- Páll, S.; Zhmurov, A.; Bauer, P.; Abraham, M.; Lundborg, M.; Gray, A.; Hess, B.; Lindahl, E. Heterogeneous Parallelization and Acceleration of Molecular Dynamics Simulations in GROMACS. J. Chem. Phys. 2020, 153, 134110. [Google Scholar] [CrossRef]
- Kozakov, D.; Hall, D.R.; Xia, B.; Porter, K.A.; Padhorny, D.; Yueh, C.; Beglov, D.; Vajda, S. The ClusPro Web Server for Protein-Protein Docking. Nat. Protoc. 2017, 12, 255–278. [Google Scholar] [CrossRef]
- Zhu, J.; Gomez, B.; Watanabe, I.; Thornhill, W.B. Amino Acids in the Pore Region of Kv1 Potassium Channels Dictate Cell-Surface Protein Levels: A Possible Trafficking Code in the Kv1 Subfamily. Biochem. J. 2005, 388, 355–362. [Google Scholar] [CrossRef] [PubMed]
- Li, D.; Takimoto, K.; Levitan, E.S. Surface Expression of Kv1 Channels Is Governed by a C-Terminal Motif. J. Biol. Chem. 2000, 275, 11597–11602. [Google Scholar] [CrossRef]
- Zhu, J.; Watanabe, I.; Gomez, B.; Thornhill, W.B. Determinants Involved in Kv1 Potassium Channel Folding in the Endoplasmic Reticulum, Glycosylation in the Golgi, and Cell Surface Expression. J. Biol. Chem. 2001, 276, 39419–39427. [Google Scholar] [CrossRef] [PubMed]
- Manganas, L.N.; Wang, Q.; Scannevin, R.H.; Antonucci, D.E.; Rhodes, K.J.; Trimmer, J.S. Identification of a Trafficking Determinant Localized to the Kv1 Potassium Channel Pore. Proc. Natl. Acad. Sci. USA 2001, 98, 14055–14059. [Google Scholar] [CrossRef]
- Kuzmenkov, A.I.; Nekrasova, O.V.; Kudryashova, K.S.; Peigneur, S.; Tytgat, J.; Stepanov, A.V.; Kirpichnikov, M.P.; Grishin, E.V.; Feofanov, A.V.; Vassilevski, A.A. Fluorescent Protein-Scorpion Toxin Chimera Is a Convenient Molecular Tool for Studies of Potassium Channels. Sci. Rep. 2016, 6, 33314. [Google Scholar] [CrossRef]
- Denisova, K.R.; Orlov, N.A.; Yakimov, S.A.; Kryukova, E.A.; Dolgikh, D.A.; Kirpichnikov, M.P.; Feofanov, A.V.; Nekrasova, O.V. GFP-Margatoxin, a Genetically Encoded Fluorescent Ligand to Probe Affinity of Kv1.3 Channel Blockers. Int. J. Mol. Sci. 2022, 23, 1724. [Google Scholar] [CrossRef]
- Primak, A.L.; Orlov, N.A.; Peigneur, S.; Tytgat, J.; Ignatova, A.A.; Denisova, K.R.; Yakimov, S.A.; Kirpichnikov, M.P.; Nekrasova, O.V.; Feofanov, A.V. AgTx2-GFP, Fluorescent Blocker Targeting Pharmacologically Important Kv1.x (x = 1, 3, 6) Channels. Toxins 2023, 15, 229. [Google Scholar] [CrossRef]
- Cormack, B.P.; Valdivia, R.H.; Falkow, S. FACS-Optimized Mutants of the Green Fluorescent Protein (GFP). Gene 1996, 173, 33–38. [Google Scholar] [CrossRef] [PubMed]
- Bartok, A.; Toth, A.; Somodi, S.; Szanto, T.G.; Hajdu, P.; Panyi, G.; Varga, Z. Margatoxin Is a Non-Selective Inhibitor of Human Kv1.3 K+ Channels. Toxicon 2014, 87, 6–16. [Google Scholar] [CrossRef] [PubMed]
- Rauer, H.; Lanigan, M.D.; Pennington, M.W.; Aiyar, J.; Ghanshani, S.; Cahalan, M.D.; Norton, R.S.; George Chandy, K. Structure-Guided Transformation of Charybdotoxin Yields an Analog That Selectively Targets Ca(2+)-Activated over Voltage-Gated K(+) Channels. J. Biol. Chem. 2000, 275, 1201–1208. [Google Scholar] [CrossRef]
- Takacs, Z.; Toups, M.; Kollewe, A.; Johnson, E.; Cuello, L.G.; Driessens, G.; Biancalana, M.; Koide, A.; Ponte, C.G.; Perozo, E.; et al. A Designer Ligand Specific for Kv1.3 Channels from a Scorpion Neurotoxin-Based Library. Proc. Natl. Acad. Sci. USA 2009, 106, 22211–22216. [Google Scholar] [CrossRef]
- Olamendi-Portugal, T.; Somodi, S.; Fernández, J.A.; Zamudio, F.Z.; Becerril, B.; Varga, Z.; Panyi, G.; Gáspár, R.; Possani, L.D. Novel Alpha-KTx Peptides from the Venom of the Scorpion Centruroides Elegans Selectively Blockade Kv1.3 over IKCa1 K+ Channels of T Cells. Toxicon 2005, 46, 418–429. [Google Scholar] [CrossRef]
- Bhuyan, R.; Seal, A. Molecular Dynamics of Kv1.3 Ion Channel and Structural Basis of Its Inhibition by Scorpion Toxin-OSK1 Derivatives. Biophys. Chem. 2015, 203, 1–11. [Google Scholar] [CrossRef] [PubMed]
- Chen, P.C.; Kuyucak, S. Developing a Comparative Docking Protocol for the Prediction of Peptide Selectivity Profiles: Investigation of Potassium Channel Toxins. Toxins 2012, 4, 110–138. [Google Scholar] [CrossRef] [PubMed]
- Xie, C.; Kessi, M.; Yin, F.; Peng, J. Roles of KCNA2 in Neurological Diseases: From Physiology to Pathology. Mol. Neurobiol. 2024, 61, 8491–8517. [Google Scholar] [CrossRef] [PubMed]
- Shi, G.; Nakahira, K.; Hammond, S.; Rhodes, K.J.; Schechter, L.E.; Trimmer, J.S. Beta Subunits Promote K+ Channel Surface Expression through Effects Early in Biosynthesis. Neuron 1996, 16, 843–852. [Google Scholar] [CrossRef]
- Dwenger, M.M.; Raph, S.M.; Baba, S.P.; Moore, J.B.; Nystoriak, M.A. Diversification of Potassium Currents in Excitable Cells via Kvβ Proteins. Cells 2022, 11, 2230. [Google Scholar] [CrossRef] [PubMed]
- Duménieu, M.; Oulé, M.; Kreutz, M.R.; Lopez-Rojas, J. The Segregated Expression of Voltage-Gated Potassium and Sodium Channels in Neuronal Membranes: Functional Implications and Regulatory Mechanisms. Front. Cell Neurosci. 2017, 11, 115. [Google Scholar] [CrossRef] [PubMed]
- Hetz, C.; Zhang, K.; Kaufman, R.J. Mechanisms, Regulation and Functions of the Unfolded Protein Response. Nat. Rev. Mol. Cell Biol. 2020, 21, 421–438. [Google Scholar] [CrossRef] [PubMed]
- Nesti, E.; Everill, B.; Morielli, A.D. Endocytosis as a Mechanism for Tyrosine Kinase-Dependent Suppression of a Voltage-Gated Potassium Channel. Mol. Biol. Cell 2004, 15, 4073–4088. [Google Scholar] [CrossRef]
- Styles, F.L.; Al-Owais, M.M.; Scragg, J.L.; Chuntharpursat-Bon, E.; Hettiarachchi, N.T.; Lippiat, J.D.; Minard, A.; Bon, R.S.; Porter, K.; Sukumar, P.; et al. Kv1.3 Voltage-Gated Potassium Channels Link Cellular Respiration to Proliferation through a Non-Conducting Mechanism. Cell Death Dis. 2021, 12, 372. [Google Scholar] [CrossRef]
- Ramaswami, M.; Gautam, M.; Kamb, A.; Rudy, B.; Tanouye, M.A.; Mathew, M.K. Human Potassium Channel Genes: Molecular Cloning and Functional Expression. Mol. Cell Neurosci. 1990, 1, 214–223. [Google Scholar] [CrossRef]
- Akhtar, S.; Shamotienko, O.; Papakosta, M.; Ali, F.; Oliver Dolly, J. Characteristics of Brain Kv1 Channels Tailored to Mimic Native Counterparts by Tandem Linkage of Alpha Subunits: Implications for K+ Channelopathies. J. Biol. Chem. 2002, 277, 16376–16382. [Google Scholar] [CrossRef] [PubMed]
- Scholle, A.; Dugarmaa, S.; Zimmer, T.; Leonhardt, M.; Koopmann, R.; Engeland, B.; Pongs, O.; Benndorf, K. Rate-Limiting Reactions Determining Different Activation Kinetics of Kv1.2 and Kv2.1 Channels. J. Membr. Biol. 2004, 198, 103–112. [Google Scholar] [CrossRef] [PubMed]
- Al-Sabi, A.; Kaza, S.K.; Oliver Dolly, J.; Wang, J. Pharmacological Characteristics of Kv1.1- and Kv1.2-Containing Channels Are Influenced by the Stoichiometry and Positioning of Their α Subunits. Biochem. J. 2013, 454, 101–108. [Google Scholar] [CrossRef]
- Grissmer, S.; Nguyen, A.N.; Aiyar, J.; Hanson, D.C.; Mather, R.J.; Gutman, G.A.; Karmilowicz, M.J.; Auperin, D.D.; Chandy, K.G. Pharmacological Characterization of Five Cloned Voltage-Gated K+ Channels, Types Kv1.1, 1.2, 1.3, 1.5, and 3.1, Stably Expressed in Mammalian Cell Lines. Mol. Pharmacol. 1994, 45, 1227–1234. [Google Scholar]
- Rezazadeh, S.; Kurata, H.T.; Claydon, T.W.; Kehl, S.J.; Fedida, D. An Activation Gating Switch in Kv1.2 Is Localized to a Threonine Residue in the S2-S3 Linker. Biophys. J. 2007, 93, 4173–4186. [Google Scholar] [CrossRef]
- Ranjan, R.; Logette, E.; Marani, M.; Herzog, M.; Tâche, V.; Scantamburlo, E.; Buchillier, V.; Markram, H. A Kinetic Map of the Homomeric Voltage-Gated Potassium Channel (Kv) Family. Front. Cell Neurosci. 2019, 13, 358. [Google Scholar] [CrossRef] [PubMed]
- Luna-Ramírez, K.; Bartok, A.; Restano-Cassulini, R.; Quintero-Hernández, V.; Coronas, F.I.V.; Christensen, J.; Wright, C.E.; Panyi, G.; Possani, L.D. Structure, Molecular Modeling, and Function of the Novel Potassium Channel Blocker Urotoxin Isolated from the Venom of the Australian Scorpion Urodacus Yaschenkoi. Mol. Pharmacol. 2014, 86, 28–41. [Google Scholar] [CrossRef] [PubMed]
Notation | Nucleotide Sequence 1 |
---|---|
Kcna2-f1 | 5′-TTCTCAGATCTATGACAGTGGCCACCGGAGACCCA-3′ |
Kcna2-r1 | 5′-TTCTCAAGCTTAGACATCAGTTAACATTTTGGTAATATTC-3′ |
Kcna2m1-f1 | 5′-GGCAGTCGTCACCATGACAACTG TAGGCTATG-3′ |
Kcna2m1-r1 | 5′-CAGTTGTCATGGTGACGACTGCC CACCAGAAGG-3′ |
Kcna2m2-f1 | 5′-GTGTAAATAACAGTCTGGAGGACTTTAG AGAGGAAAAC-3′ |
Kcna2m2-r1 | 5′-CTAAAGTCCTCCAGACTGTTATTTACAC CCTCCTGGAT-3′ |
Hg-f1 | 5′-TTCTCGGTACCGAAAACCTGTATTTTCAG-3′ |
Hg-r1 | 5′-TTCTCGGATCCATGCGGATAACATTTGCATT-3′ |
Peptide | Amino Acid Sequence | Identity, % | Kap, nM | ||||
---|---|---|---|---|---|---|---|
HgTx1 | MgTx | Kv1.2 | Kv1.1 | Kv1.3 | |||
Ce1 | 1 10 20 30 | 77 | 77 | 0.010 ± 0.002 | 11 ± 5 $ | 13 ± 8 & | |
TVINVKCTSPKQCLKPCKDLYGPHAGAKCMNGKCKCYNN * CEEEEECCCGGGHHHHHHHHHTTTEEEEEETTEEEEEEC | |||||||
Ce4 | TIINVKCTSPKQCLLPCKEIYGIHAGAKCMNGKCKCYKI CEEEEECCTTTTHHHHHHHHHTTTEEEEEETTEEEEEEC | 77 | 80 | 0.030 ± 0.010 | >300 & | 30 ± 10 & | |
HgTx1 | TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH CEEEEECCTTTTHHHHHHHHHTTTTEEEEETTEEEEECC | 100 | 90 | 0.020 ± 0.010 | 0.03 ± 0.02 $ | 0.2 ± 0.1 # | |
MgTx | TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH CEEEEETTTGGGGTTGGGTTTTTTEEECTBTTEEEEEEC | 90 | 100 | 0.014 ± 0.010 | 0.3 ± 0.2 $ | 1.4 ± 0.7 & |
Channel | Amino Acid Sequence of the Peptide Binding Site * | |
---|---|---|
Kv1.1 | 346 | 386 |
FAEAEEAESHFSSIPDAFWWAVVSMTTVGYGDMYPVTIGGK | ||
Kv1.2 | 348 | 388 |
FAEADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGK | ||
Kv1.3 | 418 | 458 |
FAEADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGK |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Ignatova, A.A.; Kryukova, E.V.; Novoseletsky, V.N.; Kazakov, O.V.; Orlov, N.A.; Korabeynikova, V.N.; Larina, M.V.; Fradkov, A.F.; Yakimov, S.A.; Kirpichnikov, M.P.; et al. New High-Affinity Peptide Ligands for Kv1.2 Channel: Selective Blockers and Fluorescent Probes. Cells 2024, 13, 2096. https://doi.org/10.3390/cells13242096
Ignatova AA, Kryukova EV, Novoseletsky VN, Kazakov OV, Orlov NA, Korabeynikova VN, Larina MV, Fradkov AF, Yakimov SA, Kirpichnikov MP, et al. New High-Affinity Peptide Ligands for Kv1.2 Channel: Selective Blockers and Fluorescent Probes. Cells. 2024; 13(24):2096. https://doi.org/10.3390/cells13242096
Chicago/Turabian StyleIgnatova, Anastasia A., Elena V. Kryukova, Valery N. Novoseletsky, Oleg V. Kazakov, Nikita A. Orlov, Varvara N. Korabeynikova, Maria V. Larina, Arkady F. Fradkov, Sergey A. Yakimov, Mikhail P. Kirpichnikov, and et al. 2024. "New High-Affinity Peptide Ligands for Kv1.2 Channel: Selective Blockers and Fluorescent Probes" Cells 13, no. 24: 2096. https://doi.org/10.3390/cells13242096
APA StyleIgnatova, A. A., Kryukova, E. V., Novoseletsky, V. N., Kazakov, O. V., Orlov, N. A., Korabeynikova, V. N., Larina, M. V., Fradkov, A. F., Yakimov, S. A., Kirpichnikov, M. P., Feofanov, A. V., & Nekrasova, O. V. (2024). New High-Affinity Peptide Ligands for Kv1.2 Channel: Selective Blockers and Fluorescent Probes. Cells, 13(24), 2096. https://doi.org/10.3390/cells13242096