Quorum Sensing in Bacillus thuringiensis Is Required for Completion of a Full Infectious Cycle in the Insect
Abstract
:1. Introduction
2. Kill: PlcR and Virulence
3. Survive: NprR and Necrotrophism
4. Resist: Rap and Sporulation
Locus tag a | Annotation b | % Identity with BXA0205 | Localization |
---|---|---|---|
BTB_6p00030 | rapK | 59% | pBTB_6p plasmid |
BTB_78p00160 | rapF | 52% | pBTB_78p plasmid |
BTB_c35690 | rapF2 | 51% | chromosome |
BTB_c10360 | rapF1 | 47% | chromosome |
BTB_9p00050 | rapI | 46% | pBTB_9p plasmid |
BTB_c10810 | rapI1 | 43% | chromosome |
BTB_c17720 | rap-like c | 45% | chromosome |
BTB_502p04160 | rapC | 42% | pBTB_502p plasmid |
Annotation a | Sequence | Length b |
---|---|---|
BXA0205Phr | MKKVMFSLIGLTAVFTFMFNASNVTDTQKALSEDKVVQYAH | 46 |
PhrK | MKKTILTLMGIITVFTLTLSNINTPKENKDPSIQKIMLMSD | 46 |
PhrF | MKKTLISLMGIVTILTFTIGLSNPGEVQKFIQTKVAASE | 44 |
PhrF2 | MIKKISSIVLGLSVLSIVSIGLNSSFTYQAGHADFPAPQRPDLVQSIDVSKDYNSTTTEKAL | 62 |
PhrF1 | MKRIISSSIGLIITVILLNGVNVSTDQLKVNTTSVIQYTHGEPWG | 45 |
PhrI | MMKKFSLILIGVACTTGIFFSQFNNSIQTHDAKEKNDIIQQYAHGKDI | 48 |
PhrI1 | MKKFRLAIVGTALVGVLSIGFNSSFTNQAVNIGDTGGAPARPDYVNIGDTGGAPARPDYVNIGDTGGAPA | 96 |
Phr-like c | MKKISLAILTFTCILAFGFNNFTESQQAKQLPKWDTDKQETHADL | 45 |
PhrC | MKKFKIALLGFVSVAVLSLGLNSGTETQKASSVTESPTHVIYYSHADVW | 49 |
5. PlcRa and Other PlcR-Like QS Systems in B. thuringiensis
6. Conclusions
Acknowledgments
Conflicts of Interest
References
- Deng, C.; Peng, Q.; Song, F.; Lereclus, D. Regulation of cry gene expression in Bacillus thuringiensis. Toxins 2014, 6, 2194–2209. [Google Scholar] [CrossRef]
- Sanahuja, G.; Banakar, R.; Twyman, R.M.; Capell, T.; Christou, P. Bacillus thuringiensis: A century of research, development and commercial applications. Plant Biotechnol. J. 2011, 9, 283–300. [Google Scholar] [CrossRef]
- Sanchis, V. From microbial sprays to insect-resistant transgenic plants: History of the biopesticide Bacillus thuringiensis. A review. Agron. Sustain. Dev. 2011, 31, 217–231. [Google Scholar] [CrossRef] [Green Version]
- Helgason, E.; Okstad, O.A.; Caugant, D.A.; Johansen, H.A.; Fouet, A.; Mock, M.; Hegna, I.; Kolsto, A.B. Bacillus anthracis, Bacillus cereus, and Bacillus thuringiensis—One species on the basis of genetic evidence. Appl. Environ. Microbiol. 2000, 66, 2627–2630. [Google Scholar] [CrossRef]
- Stenfors Arnesen, L.P.; Fagerlund, A.; Granum, P.E. From soil to gut: Bacillus cereus and its food poisoning toxins. FEMS Microbiol. Rev. 2008, 32, 579–606. [Google Scholar] [CrossRef]
- Agata, N.; Mori, M.; Ohta, M.; Suwan, S.; Ohtani, I.; Isobe, M. A novel dodecadepsipeptide, cereulide, isolated from Bacillus cereus causes vacuole formation in HEp-2 cells. FEMS Microbiol. Lett. 1994, 121, 31–34. [Google Scholar]
- Ehling-Schulz, M.; Svensson, B.; Guinebretiere, M.H.; Lindback, T.; Andersson, M.; Schulz, A.; Fricker, M.; Christiansson, A.; Granum, P.E.; Martlbauer, E.; et al. Emetic toxin formation of Bacillus cereus is restricted to a single evolutionary lineage of closely related strains. Microbiology 2005, 151, 183–197. [Google Scholar] [CrossRef]
- Castedo, E.; Castro, A.; Martin, P.; Roda, J.; Montero, C.G. Bacillus cereus prosthetic valve endocarditis. Ann. Thorac. Surg. 1999, 68, 2351–2352. [Google Scholar] [CrossRef]
- Chu, W.P.; Que, T.L.; Lee, W.K.; Wong, S.N. Meningoencephalitis caused by Bacillus cereus in a neonate. Hong Kong Med. J. 2001, 7, 89–92. [Google Scholar]
- Gaur, A.H.; Patrick, C.C.; McCullers, J.A.; Flynn, P.M.; Pearson, T.A.; Razzouk, B.I.; Thompson, S.J.; Shenep, J.L. Bacillus cereus bacteremia and meningitis in immunocompromised children. Clin. Infect. Dis. 2001, 32, 1456–1462. [Google Scholar] [CrossRef]
- Bottone, E.J. Bacillus cereus, a volatile human pathogen. Clin. Microbiol. Rev. 2010, 23, 382–398. [Google Scholar] [CrossRef]
- Gohar, M.; Faegri, K.; Perchat, S.; Ravnum, S.; Okstad, O.A.; Gominet, M.; Kolsto, A.B.; Lereclus, D. The PlcR virulence regulon of Bacillus cereus. PLoS One 2008, 3, e2793. [Google Scholar] [CrossRef]
- Salamitou, S.; Ramisse, F.; Brehelin, M.; Bourguet, D.; Gilois, N.; Gominet, M.; Hernandez, E.; Lereclus, D. The PlcR regulon is involved in the opportunistic properties of Bacillus thuringiensis and Bacillus cereus in mice and insects. Microbiology 2000, 146, 2825–2832. [Google Scholar]
- Callegan, M.C.; Kane, S.T.; Cochran, D.C.; Gilmore, M.S.; Gominet, M.; Lereclus, D. Relationship of PlcR-regulated factors to Bacillus endophthalmitis virulence. Infect. Immun. 2003, 71, 3116–3124. [Google Scholar] [CrossRef]
- Dubois, T.; Faegri, K.; Perchat, S.; Lemy, C.; Buisson, C.; Nielsen-LeRoux, C.; Gohar, M.; Jacques, P.; Ramarao, N.; Kolsto, A.B.; et al. Necrotrophism is a quorum-sensing-regulated lifestyle in Bacillus thuringiensis. PLoS Pathog. 2012, 8, e1002629. [Google Scholar] [CrossRef]
- Raymond, B.; Johnston, P.R.; Nielsen-LeRoux, C.; Lereclus, D.; Crickmore, N. Bacillus thuringiensis: An impotent pathogen? Trends Microbiol. 2010, 18, 189–194. [Google Scholar] [CrossRef]
- Olmedo, G.; Ninfa, E.G.; Stock, J.; Youngman, P. Novel mutations that alter the regulation of sporulation in Bacillus subtilis. Evidence that phosphorylation of regulatory protein SpoOA controls the initiation of sporulation. J. Mol. Biol. 1990, 215, 359–372. [Google Scholar] [CrossRef]
- Sonenshein, A.L. Control of sporulation initiation in Bacillus subtilis. Curr. Opin. Microbiol. 2000, 3, 561–566. [Google Scholar] [CrossRef]
- Strauch, M.; Webb, V.; Spiegelman, G.; Hoch, J.A. The SpoOA protein of Bacillus subtilis is a repressor of the abrB gene. Proc. Natl. Acad. Sci. USA 1990, 87, 1801–1805. [Google Scholar] [CrossRef]
- Lereclus, D.; Agaisse, H.; Gominet, M.; Chaufaux, J. Overproduction of encapsulated insecticidal crystal proteins in a Bacillus thuringiensis spo0A mutant. Biotechnology (N. Y.) 1995, 13, 67–71. [Google Scholar] [CrossRef]
- Ng, W.L.; Bassler, B.L. Bacterial quorum-sensing network architectures. Annu. Rev. Genet. 2009, 43, 197–222. [Google Scholar] [CrossRef]
- Rutherford, S.T.; Bassler, B.L. Bacterial quorum sensing: Its role in virulence and possibilities for its control. Cold Spring Harb. Perspect. Med. 2012, 2. [Google Scholar] [CrossRef]
- Ji, G.; Beavis, R.C.; Novick, R.P. Cell density control of staphylococcal virulence mediated by an octapeptide pheromone. Proc. Natl. Acad. Sci. USA 1995, 92, 12055–12059. [Google Scholar] [CrossRef]
- Novick, R.P.; Geisinger, E. Quorum sensing in Staphylococci. Ann. Rev. Genet. 2008, 42, 541–564. [Google Scholar] [CrossRef]
- Suzuki, A.; Mori, M.; Sakagami, Y.; Isogai, A.; Fujino, M.; Kitada, C.; Craig, R.A.; Clewell, D.B. Isolation and structure of bacterial sex pheromone, cPD1. Science 1984, 226, 849–850. [Google Scholar]
- Kozlowicz, B.K.; Bae, T.; Dunny, G.M. Enterococcus faecalis pheromone-responsive protein PrgX: Genetic separation of positive autoregulatory functions from those involved in negative regulation of conjugative plasmid transfer. Mol. Microbiol. 2004, 54, 520–532. [Google Scholar] [CrossRef]
- Cook, L.C.; Federle, M.J. Peptide pheromone signaling in Streptococcus and Enterococcus. FEMS Microbiol. Rev. 2014, 38, 473–492. [Google Scholar] [CrossRef]
- Perego, M.; Hoch, J.A. Cell-cell communication regulates the effects of protein aspartate phosphatases on the phosphorelay controlling development in Bacillus subtilis. Proc. Natl. Acad. Sci. USA 1996, 93, 1549–1553. [Google Scholar] [CrossRef]
- Lazazzera, B.A.; Solomon, J.M.; Grossman, A.D. An exported peptide functions intracellularly to contribute to cell density signaling in Bacillus subtilis. Cell 1997, 89, 917–925. [Google Scholar] [CrossRef]
- Perego, M. Forty years in the making: Understanding the molecular mechanism of peptide regulation in bacterial development. PLoS Biol. 2013, 11, e1001516. [Google Scholar] [CrossRef]
- Shi, K.; Brown, C.K.; Gu, Z.Y.; Kozlowicz, B.K.; Dunny, G.M.; Ohlendorf, D.H.; Earhart, C.A. Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis. Proc. Natl. Acad. Sci. USA 2005, 102, 18596–18601. [Google Scholar]
- Declerck, N.; Bouillaut, L.; Chaix, D.; Rugani, N.; Slamti, L.; Hoh, F.; Lereclus, D.; Arold, S.T. Structure of PlcR: Insights into virulence regulation and evolution of quorum sensing in Gram-positive bacteria. Proc. Natl. Acad. Sci. USA 2007, 104, 18490–18495. [Google Scholar]
- Baker, M.D.; Neiditch, M.B. Structural basis of response regulator inhibition by a bacterial anti-activator protein. PLoS Biol. 2011, 9, e1001226. [Google Scholar] [CrossRef]
- Gallego del Sol, F.; Marina, A. Structural basis of Rap phosphatase inhibition by Phr peptides. PLoS Biol. 2013, 11, e1001511. [Google Scholar] [CrossRef] [Green Version]
- Parashar, V.; Jeffrey, P.D.; Neiditch, M.B. Conformational change-induced repeat domain expansion regulates Rap phosphatase quorum-sensing signal receptors. PLoS Biol. 2013, 11, e1001512. [Google Scholar] [CrossRef]
- Grenha, R.; Slamti, L.; Nicaise, M.; Refes, Y.; Lereclus, D.; Nessler, S. Structural basis for the activation mechanism of the PlcR virulence regulator by the quorum-sensing signal peptide PapR. Proc. Natl. Acad. Sci. USA 2013, 110, 1047–1052. [Google Scholar]
- Zouhir, S.; Perchat, S.; Nicaise, M.; Perez, J.; Guimaraes, B.; Lereclus, D.; Nessler, S. Peptide-binding dependent conformational changes regulate the transcriptional activity of the quorum-sensor NprR. Nucl. Acids Res. 2013, 41, 7920–7933. [Google Scholar] [CrossRef]
- Lereclus, D.; Agaisse, H.; Gominet, M.; Salamitou, S.; Sanchis, V. Identification of a Bacillus thuringiensis gene that positively regulates transcription of the phosphatidylinositol-specific phospholipase C gene at the onset of the stationary phase. J. Bacteriol. 1996, 178, 2749–2756. [Google Scholar]
- Agaisse, H.; Gominet, M.; Okstad, O.A.; Kolsto, A.B.; Lereclus, D. PlcR is a pleiotropic regulator of extracellular virulence factor gene expression in Bacillus thuringiensis. Mol. Microbiol. 1999, 32, 1043–1053. [Google Scholar] [CrossRef]
- Gohar, M.; Okstad, O.A.; Gilois, N.; Sanchis, V.; Kolsto, A.B.; Lereclus, D. Two-dimensional electrophoresis analysis of the extracellular proteome of Bacillus cereus reveals the importance of the PlcR regulon. Proteomics 2002, 2, 784–791. [Google Scholar] [CrossRef]
- Slamti, L.; Lereclus, D. A cell-cell signaling peptide activates the PlcR virulence regulon in bacteria of the Bacillus cereus group. EMBO J. 2002, 21, 4550–4559. [Google Scholar] [CrossRef]
- Bouillaut, L.; Perchat, S.; Arold, S.; Zorrilla, S.; Slamti, L.; Henry, C.; Gohar, M.; Declerck, N.; Lereclus, D. Molecular basis for group-specific activation of the virulence regulator PlcR by PapR heptapeptides. Nucleic Acids Res. 2008, 36, 3791–3801. [Google Scholar] [CrossRef]
- Pomerantsev, A.P.; Pomerantseva, O.M.; Camp, A.S.; Mukkamala, R.; Goldman, S.; Leppla, S.H. PapR peptide maturation: Role of the NprB protease in Bacillus cereus 569 PlcR/PapR global gene regulation. FEMS Immunol. Med. Microbiol. 2009, 55, 361–377. [Google Scholar] [CrossRef]
- Gominet, M.; Slamti, L.; Gilois, N.; Rose, M.; Lereclus, D. Oligopeptide permease is required for expression of the Bacillus thuringiensis PlcR regulon and for virulence. Mol. Microbiol. 2001, 40, 963–975. [Google Scholar] [CrossRef]
- Slamti, L.; Lereclus, D. Specificity and polymorphism of the PlcR-PapR quorum-sensing system in the Bacillus cereus group. J. Bacteriol. 2005, 187, 1182–1187. [Google Scholar] [CrossRef]
- Frenzel, E.; Doll, V.; Pauthner, M.; Lucking, G.; Scherer, S.; Ehling-Schulz, M. CodY orchestrates the expression of virulence determinants in emetic Bacillus cereus by impacting key regulatory circuits. Mol. Microbiol. 2012, 85, 67–88. [Google Scholar] [CrossRef]
- Lindback, T.; Mols, M.; Basset, C.; Granum, P.E.; Kuipers, O.P.; Kovacs, A.T. CodY, a pleiotropic regulator, influences multicellular behaviour and efficient production of virulence factors in Bacillus cereus. Environ. Microbiol. 2012, 14, 2233–2246. [Google Scholar] [CrossRef]
- Sonenshein, A.L. CodY, a global regulator of stationary phase and virulence in Gram-positive bacteria. Curr. Opin. Microbiol. 2005, 8, 203–207. [Google Scholar] [CrossRef]
- Stenz, L.; Francois, P.; Whiteson, K.; Wolz, C.; Linder, P.; Schrenzel, J. The CodY pleiotropic repressor controls virulence in gram-positive pathogens. FEMS Immunol. Med. Microbiol. 2011, 62, 123–139. [Google Scholar] [CrossRef]
- Brillard, J.; Susanna, K.; Michaud, C.; Dargaignaratz, C.; Gohar, M.; Nielsen-Leroux, C.; Ramarao, N.; Kolsto, A.B.; Nguyen-the, C.; Lereclus, D.; et al. The YvfTU two-component system is involved in plcR expression in Bacillus cereus. BMC Microbiol. 2008, 8, 183. [Google Scholar] [CrossRef]
- Lereclus, D.; Agaisse, H.; Grandvalet, C.; Salamitou, S.; Gominet, M. Regulation of toxin and virulence gene transcription in Bacillus thuringiensis. Int. J. Med. Microbiol. 2000, 290, 295–299. [Google Scholar] [CrossRef]
- Chitlaru, T.; Gat, O.; Gozlan, Y.; Ariel, N.; Shafferman, A. Differential proteomic analysis of the Bacillus anthracis secretome: Distinct plasmid and chromosome CO2-dependent cross talk mechanisms modulate extracellular proteolytic activities. J. Bacteriol. 2006, 188, 3551–3571. [Google Scholar] [CrossRef]
- Perchat, S.; Dubois, T.; Zouhir, S.; Gominet, M.; Poncet, S.; Lemy, C.; Aumont-Nicaise, M.; Deutscher, J.; Gohar, M.; Nessler, S.; et al. A cell-cell communication system regulates protease production during sporulation in bacteria of the Bacillus cereus group. Mol. Microbiol. 2011, 82, 619–633. [Google Scholar] [CrossRef]
- Dubois, T.; Perchat, S.; Verplaetse, E.; Gominet, M.; Lemy, C.; Aumont-Nicaise, M.; Grenha, R.; Nessler, S.; Lereclus, D. Activity of the Bacillus thuringiensis NprR-NprX cell-cell communication system is co-ordinated to the physiological stage through a complex transcriptional regulation. Mol. Microbiol. 2013, 88, 48–63. [Google Scholar] [CrossRef]
- Dubois, T. Etude du systeème de communication cellulaire NprR-NprX au sein du groupe Bacillus cereus. Ph.D. Thesis, AgroParisTech, Jouy-en-Josas, France, 5 March 2012. [Google Scholar]
- Jiang, M.; Shao, W.; Perego, M.; Hoch, J.A. Multiple histidine kinases regulate entry into stationary phase and sporulation in Bacillus subtilis. Mol. Microbiol. 2000, 38, 535–542. [Google Scholar] [CrossRef]
- Burbulys, D.; Trach, K.A.; Hoch, J.A. Initiation of sporulation in Bacillus subtilis is controlled by a multicomponent phosphorelay. Cell 1991, 64, 545–552. [Google Scholar] [CrossRef]
- Perego, M.; Glaser, P.; Hoch, J.A. Aspartyl-phosphate phosphatases deactivate the response regulator components of the sporulation signal transduction system in Bacillus subtilis. Mol. Microbiol. 1996, 19, 1151–1157. [Google Scholar] [CrossRef]
- Fujita, M.; Losick, R. Evidence that entry into sporulation in Bacillus subtilis is governed by a gradual increase in the level and activity of the master regulator Spo0A. Genes Dev. 2005, 19, 2236–2244. [Google Scholar] [CrossRef]
- Core, L.; Perego, M. TPR-mediated interaction of RapC with ComA inhibits response regulator-DNA binding for competence development in Bacillus subtilis. Mol. Microbiol. 2003, 49, 1509–1522. [Google Scholar] [CrossRef]
- Ishikawa, S.; Core, L.; Perego, M. Biochemical characterization of aspartyl phosphate phosphatase interaction with a phosphorylated response regulator and its inhibition by a pentapeptide. J. Biol. Chem. 2002, 277, 20483–20489. [Google Scholar] [CrossRef]
- Stephenson, S.; Mueller, C.; Jiang, M.; Perego, M. Molecular analysis of Phr peptide processing in Bacillus subtilis. J. Bacteriol. 2003, 185, 4861–4871. [Google Scholar] [CrossRef]
- Lanigan-Gerdes, S.; Dooley, A.N.; Faull, K.F.; Lazazzera, B.A. Identification of subtilisin, Epr and Vpr as enzymes that produce CSF, an extracellular signalling peptide of Bacillus subtilis. Mol. Microbiol. 2007, 65, 1321–1333. [Google Scholar] [CrossRef]
- Perego, M. A peptide export-import control circuit modulating bacterial development regulates protein phosphatases of the phosphorelay. Proc. Natl. Acad. Sci. USA 1997, 94, 8612–8617. [Google Scholar] [CrossRef]
- Perego, M.; Brannigan, J.A. Pentapeptide regulation of aspartyl-phosphate phosphatases. Peptides 2001, 22, 1541–1547. [Google Scholar] [CrossRef]
- Mueller, J.P.; Bukusoglu, G.; Sonenshein, A.L. Transcriptional regulation of Bacillus subtilis glucose starvation-inducible genes: Control of gsiA by the ComP-ComA signal transduction system. J. Bacteriol. 1992, 174, 4361–4373. [Google Scholar]
- Molle, V.; Nakaura, Y.; Shivers, R.P.; Yamaguchi, H.; Losick, R.; Fujita, Y.; Sonenshein, A.L. Additional targets of the Bacillus subtilis global regulator CodY identified by chromatin immunoprecipitation and genome-wide transcript analysis. J. Bacteriol. 2003, 185, 1911–1922. [Google Scholar] [CrossRef]
- McQuade, R.S.; Comella, N.; Grossman, A.D. Control of a family of phosphatase regulatory genes(phr) by the alternate sigma factor sigma-H of Bacillus subtilis. J. Bacteriol. 2001, 183, 4905–4909. [Google Scholar] [CrossRef]
- Stephenson, K.; Hoch, J.A. Evolution of signalling in the sporulation phosphorelay. Mol. Microbiol. 2002, 46, 297–304. [Google Scholar] [CrossRef]
- Tzeng, Y.L.; Hoch, J.A. Molecular recognition in signal transduction: The interaction surfaces of the Spo0F response regulator with its cognate phosphorelay proteins revealed by alanine scanning mutagenesis. J. Mol. Biol. 1997, 272, 200–212. [Google Scholar] [CrossRef]
- Zapf, J.; Sen, U.; Madhusudan; Hoch, J.A.; Varughese, K.I. A transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in signal transduction. Structure 2000, 8, 851–862. [Google Scholar] [CrossRef]
- Brunsing, R.L.; La Clair, C.; Tang, S.; Chiang, C.; Hancock, L.E.; Perego, M.; Hoch, J.A. Characterization of sporulation histidine kinases of Bacillus anthracis. J. Bacteriol. 2005, 187, 6972–6981. [Google Scholar] [CrossRef]
- Bongiorni, C.; Stoessel, R.; Shoemaker, D.; Perego, M. Rap phosphatase of virulence plasmid pXO1 inhibits Bacillus anthracis sporulation. J. Bacteriol. 2006, 188, 487–498. [Google Scholar] [CrossRef]
- Petersen, T.N.; Brunak, S.; von Heijne, G.; Nielsen, H. SignalP 4.0: Discriminating signal peptides from transmembrane regions. Nat. Methods 2011, 8, 785–786. [Google Scholar] [CrossRef]
- Kall, L.; Krogh, A.; Sonnhammer, E.L. Advantages of combined transmembrane topology and signal peptide prediction—The Phobius web server. Nucl. Acids Res. 2007, 35, W429–W432. [Google Scholar] [CrossRef]
- Huillet, E.; Tempelaars, M.H.; Andre-Leroux, G.; Wanapaisan, P.; Bridoux, L.; Makhzami, S.; Panbangred, W.; Martin-Verstraete, I.; Abee, T.; Lereclus, D. PlcRa, a new quorum-sensing regulator from Bacillus cereus, plays a role in oxidative stress responses and cysteine metabolism in stationary phase. PLoS One 2012, 7, e51047. [Google Scholar]
- Tanous, C.; Soutourina, O.; Raynal, B.; Hullo, M.F.; Mervelet, P.; Gilles, A.M.; Noirot, P.; Danchin, A.; England, P.; Martin-Verstraete, I. The CymR regulator in complex with the enzyme CysK controls cysteine metabolism in Bacillus subtilis. J. Biol. Chem. 2008, 283, 35551–35560. [Google Scholar] [CrossRef]
- Zuber, P. Management of oxidative stress in Bacillus. Annu. Rev. Microbiol. 2009, 63, 575–597. [Google Scholar] [CrossRef]
- Mols, M.; Abee, T. Primary and secondary oxidative stress in Bacillus. Environ. Microbiol. 2011, 13, 1387–1394. [Google Scholar] [CrossRef]
- Newton, G.L.; Rawat, M.; La Clair, J.J.; Jothivasan, V.K.; Budiarto, T.; Hamilton, C.J.; Claiborne, A.; Helmann, J.D.; Fahey, R.C. Bacillithiol is an antioxidant thiol produced in Bacilli. Nat. Chem. Biol. 2009, 5, 625–627. [Google Scholar] [CrossRef]
- Nicely, N.I.; Parsonage, D.; Paige, C.; Newton, G.L.; Fahey, R.C.; Leonardi, R.; Jackowski, S.; Mallett, T.C.; Claiborne, A. Structure of the type III pantothenate kinase from Bacillus anthracis at 2.0 A resolution: Implications for coenzyme A-dependent redox biology. Biochemistry 2007, 46, 3234–3245. [Google Scholar] [CrossRef]
© 2014 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/).
Share and Cite
Slamti, L.; Perchat, S.; Huillet, E.; Lereclus, D. Quorum Sensing in Bacillus thuringiensis Is Required for Completion of a Full Infectious Cycle in the Insect. Toxins 2014, 6, 2239-2255. https://doi.org/10.3390/toxins6082239
Slamti L, Perchat S, Huillet E, Lereclus D. Quorum Sensing in Bacillus thuringiensis Is Required for Completion of a Full Infectious Cycle in the Insect. Toxins. 2014; 6(8):2239-2255. https://doi.org/10.3390/toxins6082239
Chicago/Turabian StyleSlamti, Leyla, Stéphane Perchat, Eugénie Huillet, and Didier Lereclus. 2014. "Quorum Sensing in Bacillus thuringiensis Is Required for Completion of a Full Infectious Cycle in the Insect" Toxins 6, no. 8: 2239-2255. https://doi.org/10.3390/toxins6082239