Alternative Antibiotics in Dentistry: Antimicrobial Peptides
Abstract
:1. Introduction to Oral Microbiome and Oral Infections
2. Traditional Antibiotics and Alternatives
2.1. Overview of Mechanism of Action and Resistance
2.2. Opportunities for Alternative Approaches
2.3. Chlorohexidine
2.4. Calcium Hydroxide
3. Antimicrobial Peptides
3.1. Characteristics
3.1.1. Charge
3.1.2. Hydrophobicity
3.1.3. Amphiphilicity
3.1.4. Structure
3.2. Mechanisms of Action
3.3. Classification Based on Source
3.3.1. Origin
3.3.2. Cathelicidins
3.3.3. Defensins
3.3.4. Histatins
3.4. De Novo Peptides
- Cyclization of linear regions;
- D-amino acid substitution to take advantage of enzyme-substrate specificity to evade protease recognition and subsequent degradation;
- Replacing hydrophobic residues studies the effects of hydrophobicity and amphiphilicity on cytotoxicity.
3.5. AMP Resistance
4. Conclusions and Future Directions
- Modify the composition of biofilms on tooth, soft tissue and prosthetic surfaces, the goal being to reverse dysbiosis without destroying the commensal flora. Novel AMP-inspired antimicrobials have also been investigated as ways to reduce Candida growth on denture surfaces [193]. It is conceivable that a healthy individual can use biofilm-modifying AMPs as part of a preventive regimen.
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Bik, E.M.; Long, C.D.; Armitage, G.C.; Loomer, P.; Emerson, J.; Mongodin, E.F.; Nelson, K.E.; Gill, S.R.; Fraser-Liggett, C.M.; Relman, D.A. Bacterial diversity in the oral cavity of 10 healthy individuals. ISME J. 2010, 4, 962–974. [Google Scholar] [CrossRef] [PubMed]
- Ding, T.; Schloss, P.D. Dynamics and associations of microbial community types across the human body. Nature 2014, 509, 357–360. [Google Scholar] [CrossRef] [PubMed]
- Deo, P.N.; Deshmukh, R. Oral microbiome: Unveiling the fundamentals. J. Oral Maxillofac. Pathol. 2019, 23, 122–128. [Google Scholar] [CrossRef]
- Burcham, Z.M.; Garneau, N.L.; Comstock, S.S.; Tucker, R.M.; Knight, R.; Metcalf, J.L.; Miranda, A.; Reinhart, B.; Meyers, D.; Woltkamp, D.; et al. Patterns of Oral Microbiota Diversity in Adults and Children: A Crowdsourced Population Study. Sci. Rep. 2020, 10, 2133. [Google Scholar] [CrossRef] [PubMed]
- Dominguez-Bello, M.G.; Costello, E.K.; Contreras, M.; Magris, M.; Hidalgo, G.; Fierer, N.; Knight, R. Delivery mode shapes the acquisition and structure of the initial microbiota across multiple body habitats in newborns. Proc. Natl. Acad. Sci. USA 2010, 107, 11971–11975. [Google Scholar] [CrossRef]
- Sakwinska, O.; Foata, F.; Berger, B.; Brüssow, H.; Combremont, S.; Mercenier, A.; Dogra, S.; Soh, S.E.; Yen, J.C.K.; Heong, G.Y.S.; et al. Does the maternal vaginal microbiota play a role in seeding the microbiota of neonatal gut and nose? Benef. Microbes 2017, 8, 763–778. [Google Scholar] [CrossRef] [PubMed]
- Marsh, P.D. Role of the Oral Microflora in Health. Microb. Ecol. Health Dis. 2000, 12, 130–137. [Google Scholar] [CrossRef]
- Costello, E.K.; Carlisle, E.M.; Bik, E.M.; Morowitz, M.J.; Relman, D.A. Microbiome assembly across multiple body sites in low-birthweight infants. mBio 2013, 4, e00782. [Google Scholar] [CrossRef] [PubMed]
- Bearfield, C.; Davenport, E.S.; Sivapathasundaram, V.; Allaker, R.P. Possible association between amniotic fluid micro-organism infection and microflora in the mouth. BJOG 2002, 109, 527–533. [Google Scholar] [CrossRef] [PubMed]
- Aagaard, K.; Ma, J.; Antony, K.M.; Ganu, R.; Petrosino, J.; Versalovic, J. The placenta harbors a unique microbiome. Sci. Transl. Med. 2014, 6, 237ra265. [Google Scholar] [CrossRef] [PubMed]
- Blum, J.; Silva, M.; Byrne, S.J.; Butler, C.A.; Adams, G.G.; Reynolds, E.C.; Dashper, S.G. Temporal development of the infant oral microbiome. Crit. Rev. Microbiol. 2022, 1–13. [Google Scholar] [CrossRef] [PubMed]
- Zaura, E.; Nicu, E.A.; Krom, B.P.; Keijser, B.J.F. Acquiring and maintaining a normal oral microbiome: Current perspective. Front. Cell. Infect. Microbiol. 2014, 4, 85. [Google Scholar] [CrossRef] [PubMed]
- Mager, D.L.; Ximenez-Fyvie, L.A.; Haffajee, A.D.; Socransky, S.S. Distribution of selected bacterial species on intraoral surfaces. J. Clin. Periodontol. 2003, 30, 644–654. [Google Scholar] [CrossRef]
- Bowen, W.H.; Burne, R.A.; Wu, H.; Koo, H. Oral Biofilms: Pathogens, Matrix, and Polymicrobial Interactions in Microenvironments. Trends Microbiol. 2018, 26, 229–242. [Google Scholar] [CrossRef] [PubMed]
- Marsh, P.D.; Devine, D.A. How is the development of dental biofilms influenced by the host? J. Clin. Periodontol. 2011, 38, 28–35. [Google Scholar] [CrossRef]
- Hajishengallis, G. Periodontitis: From microbial immune subversion to systemic inflammation. Nat. Rev. Immunol. 2015, 15, 30–44. [Google Scholar] [CrossRef] [PubMed]
- Li, X.; Kolltveit, K.M.; Tronstad, L.; Olsen, I. Systemic Diseases Caused by Oral Infection. Clin. Microbiol. Rev. 2000, 13, 547–558. [Google Scholar] [CrossRef] [PubMed]
- Vieira Colombo, A.P.; Magalhães, C.B.; Hartenbach, F.A.R.R.; Martins do Souto, R.; Maciel da Silva-Boghossian, C. Periodontal-disease-associated biofilm: A reservoir for pathogens of medical importance. Microb. Pathog. 2016, 94, 27–34. [Google Scholar] [CrossRef] [PubMed]
- Cugini, C.; Shanmugam, M.; Landge, N.; Ramasubbu, N. The Role of Exopolysaccharides in Oral Biofilms. J. Dent. Res. 2019, 98, 739–745. [Google Scholar] [CrossRef]
- Vu, B.; Chen, M.; Crawford, R.J.; Ivanova, E.P. Bacterial extracellular polysaccharides involved in biofilm formation. Molecules 2009, 14, 2535–2554. [Google Scholar] [CrossRef] [PubMed]
- Granato, E.T.; Meiller-Legrand, T.A.; Foster, K.R. The Evolution and Ecology of Bacterial Warfare. Curr. Biol. 2019, 29, R521–R537. [Google Scholar] [CrossRef] [PubMed]
- Figueiredo, A.R.T.; Kramer, J. Cooperation and Conflict within the Microbiota and Their Effects on Animal Hosts. Front. Ecol. Evol. 2020, 8, 132. [Google Scholar] [CrossRef]
- Kouzuma, A.; Kato, S.; Watanabe, K. Microbial interspecies interactions: Recent findings in syntrophic consortia. Front. Microbiol. 2015, 6, 477. [Google Scholar] [CrossRef]
- Jalali, F.; Ellett, F.; Balani, P.; Duncan, M.J.; Dewhirst, F.E.; Borisy, G.G.; Irimia, D. No man’s land: Species-specific formation of exclusion zones bordering Actinomyces graevenitzii microcolonies in nanoliter cultures. Microbiologyopen 2021, 10, e1137. [Google Scholar] [CrossRef]
- Mark Welch, J.L.; Dewhirst, F.E.; Borisy, G.G. Biogeography of the Oral Microbiome: The Site-Specialist Hypothesis. Annu. Rev. Microbiol. 2019, 73, 335–358. [Google Scholar] [CrossRef] [PubMed]
- de Beer, D.; Stoodley, P.; Roe, F.; Lewandowski, Z. Effects of biofilm structures on oxygen distribution and mass transport. Biotechnol. Bioeng. 1994, 43, 1131–1138. [Google Scholar] [CrossRef] [PubMed]
- Yin, W.; Wang, Y.; Liu, L.; He, J. Biofilms: The Microbial “Protective Clothing” in Extreme Environments. Int. J. Mol. Sci. 2019, 20, 3423. [Google Scholar] [CrossRef] [PubMed]
- Roy, R.; Tiwari, M.; Donelli, G.; Tiwari, V. Strategies for combating bacterial biofilms: A focus on anti-biofilm agents and their mechanisms of action. Virulence 2018, 9, 522–554. [Google Scholar] [CrossRef] [PubMed]
- Clutterbuck, A.L.; Cochrane, C.A.; Dolman, J.; Percival, S.L. Evaluating antibiotics for use in medicine using a poloxamer biofilm model. Ann. Clin. Microbiol. Antimicrob. 2007, 6, 2. [Google Scholar] [CrossRef] [PubMed]
- Khan, Z.A.; Siddiqui, M.F.; Park, S. Current and Emerging Methods of Antibiotic Susceptibility Testing. Diagnostics 2019, 9, 49. [Google Scholar] [CrossRef] [PubMed]
- Sepandj, F.; Ceri, H.; Gibb, A.; Read, R.; Olson, M. Minimum Inhibitory Concentration (MIC) versus Minimum Biofilm Eliminating Concentration (MBEC) in Evaluation of Antibiotic Sensitivity of Gram-negative Bacilli Causing Peritonitis. Perit. Dial. Int. 2004, 24, 65–67. [Google Scholar] [CrossRef] [PubMed]
- Pettit, R.K.; Weber, C.A.; Pettit, G.R. Application of a high throughput Alamar blue biofilm susceptibility assay to Staphylococcus aureus biofilms. Ann. Clin. Microbiol. Antimicrob. 2009, 8, 28. [Google Scholar] [CrossRef] [PubMed]
- Koban, I.; Matthes, R.; Hübner, N.-O.; Welk, A.; Sietmann, R.; Lademann, J.; Kramer, A.; Kocher, T. XTT assay of ex vivo saliva biofilms to test antimicrobial influences. GMS Krankenh. Interdiszip. 2012, 7, Doc06. [Google Scholar] [CrossRef]
- Olson, M.E.; Ceri, H.; Morck, D.W.; Buret, A.G.; Read, R.R. Biofilm bacteria: Formation and comparative susceptibility to antibiotics. Can. J. Vet. Res. 2002, 66, 86–92. [Google Scholar] [PubMed]
- Stewart, P.S. Antimicrobial Tolerance in Biofilms. Microbiol. Spectr. 2015, 3, 3. [Google Scholar] [CrossRef] [PubMed]
- Gebreyohannes, G.; Nyerere, A.; Bii, C.; Sbhatu, D.B. Challenges of intervention, treatment, and antibiotic resistance of biofilm-forming microorganisms. Heliyon 2019, 5, e02192. [Google Scholar] [CrossRef]
- Balcázar, J.L.; Subirats, J.; Borrego, C.M. The role of biofilms as environmental reservoirs of antibiotic resistance. Front. Microbiol. 2015, 6, 1216. [Google Scholar] [CrossRef] [PubMed]
- Rowińska, I.; Szyperska-Ślaska, A.; Zariczny, P.; Pasławski, R.; Kramkowski, K.; Kowalczyk, P. The Influence of Diet on Oxidative Stress and Inflammation Induced by Bacterial Biofilms in the Human Oral Cavity. Materials 2021, 14, 1444. [Google Scholar] [CrossRef] [PubMed]
- Loesche, W.J. Microbiology of Dental Decay and Periodontal Disease; University of Texas Medical Branch at Galveston: Galveston, TX, USA, 1996. [Google Scholar]
- Gurenlian, J.R. The Role of Dental Plaque Biofilm in Oral Health. Am. Dent. Hyg. Assoc. 2007, 81 (Suppl. 1), 116. [Google Scholar]
- Marsh, P.D.; Head, D.A.; Devine, D.A. Dental plaque as a biofilm and a microbial community—Implications for treatment. J. Oral Biosci. 2015, 57, 185–191. [Google Scholar] [CrossRef]
- López-Martínez, J.; Chueca, N.; Padial-Molina, M.; Fernandez-Caballero, J.A.; García, F.; O’Valle, F.; Galindo-Moreno, P. Bacteria associated with periodontal disease are also increased in health. Med. Oral Patol. Oral Cir. Bucal 2020, 25, e745–e751. [Google Scholar] [CrossRef]
- Signat, B.; Roques, C.; Poulet, P.; Duffaut, D. Fusobacterium nucleatum in periodontal health and disease. Curr. Issues Mol. Biol. 2011, 13, 25–36. [Google Scholar]
- Zenobia, C.; Hajishengallis, G. Porphyromonas gingivalis virulence factors involved in subversion of leukocytes and microbial dysbiosis. Virulence 2015, 6, 236–243. [Google Scholar] [CrossRef]
- Kinane, D.F.; Stathopoulou, P.G.; Papapanou, P.N. Periodontal diseases. Nat. Rev. Dis. Primers 2017, 3, 17038. [Google Scholar] [CrossRef]
- Pihlstrom, B.L.; Michalowicz, B.S.; Johnson, N.W. Periodontal diseases. Lancet 2005, 366, 1809–1820. [Google Scholar] [CrossRef]
- Scannapieco, F.A. Role of Oral Bacteria in Respiratory Infection. J. Periodontol. 1999, 70, 793–802. [Google Scholar] [CrossRef]
- Chen, X.; Daliri, E.B.-M.; Kim, N.; Kim, J.-R.; Yoo, D.; Oh, D.-H. Microbial Etiology and Prevention of Dental Caries: Exploiting Natural Products to Inhibit Cariogenic Biofilms. Pathogens 2020, 9, 569. [Google Scholar] [CrossRef]
- Seminario, A.; Broukal, Z.; Ivancaková, R. Mutans streptococci and the development of dental plaque. Prague Med. Rep. 2005, 106, 349–358. [Google Scholar]
- Xiao, X.; He, S.; He, F.; Wu, X.; Zheng, Y. Metagenomic Analysis Reveals Neisseria bacilliformis Variation in the Early Childhood Caries Plaque Microbiome. Evid.-Based Complement. Altern. Med. 2021, 2021, 2774772. [Google Scholar] [CrossRef]
- Marsh, P.D. Dental plaque as a biofilm and a microbial community—Implications for health and disease. BMC Oral Health 2006, 6, S14. [Google Scholar] [CrossRef]
- Lynge Pedersen, A.M.; Belstrøm, D. The role of natural salivary defences in maintaining a healthy oral microbiota. J. Dent. 2019, 80, S3–S12. [Google Scholar] [CrossRef]
- Bechir, F.; Pacurar, M.; Tohati, A.; Bataga, S.M. Comparative Study of Salivary pH, Buffer Capacity, and Flow in Patients with and without Gastroesophageal Reflux Disease. Int. J. Environ. Res. Public Health 2021, 19, 201. [Google Scholar] [CrossRef]
- Boisen, G.; Davies, J.R.; Neilands, J. Acid tolerance in early colonizers of oral biofilms. BMC Microbiol. 2021, 21, 45. [Google Scholar] [CrossRef]
- Kumara-Raja, B.; Radha, G. Prevalence of root caries among elders living in residential homes of Bengaluru city, India. J. Clin. Exp. Dent. 2016, 8, e260–e267. [Google Scholar] [CrossRef]
- Gati, D.; Vieira, A.R. Elderly at greater risk for root caries: A look at the multifactorial risks with emphasis on genetics susceptibility. Int. J. Dent. 2011, 2011, 647168. [Google Scholar] [CrossRef]
- Rôças, I.N.; Alves, F.R.F.; Rachid, C.T.C.C.; Lima, K.C.; Assunção, I.V.; Gomes, P.N.; Siqueira, J.F., Jr. Microbiome of Deep Dentinal Caries Lesions in Teeth with Symptomatic Irreversible Pulpitis. PLoS ONE 2016, 11, e0154653. [Google Scholar] [CrossRef]
- Narayanan, L.L.; Vaishnavi, C. Endodontic microbiology. J. Conserv. Dent. 2010, 13, 233–239. [Google Scholar] [CrossRef]
- Zehnder, M.; Belibasakis, G.N. On the dynamics of root canal infections-what we understand and what we don’t. Virulence 2015, 6, 216–222. [Google Scholar] [CrossRef]
- Shah, A.C.; Leong, K.K.; Lee, M.K.; Allareddy, V. Outcomes of hospitalizations attributed to periapical abscess from 2000 to 2008: A longitudinal trend analysis. J. Endod. 2013, 39, 1104–1110. [Google Scholar] [CrossRef]
- Alghamdi, F.; Shakir, M. The Influence of Enterococcus faecalis as a Dental Root Canal Pathogen on Endodontic Treatment: A Systematic Review. Cureus 2020, 12, e7257. [Google Scholar] [CrossRef]
- Vidana, R.; Sullivan, Å.; Billström, H.; Ahlquist, M.; Lund, B. Enterococcus faecalis infection in root canals—Host-derived or exogenous source? Lett. Appl. Microbiol. 2011, 52, 109–115. [Google Scholar] [CrossRef] [PubMed]
- Jin, L.; Lamster, I.; Greenspan, J.; Pitts, N.; Scully, C.; Warnakulasuriya, S. Global burden of oral diseases: Emerging concepts, management and interplay with systemic health. Oral Dis. 2016, 22, 609–619. [Google Scholar] [CrossRef]
- Kane, S.F. The effects of oral health on systemic health. Gen. Dent. 2017, 65, 30–34. [Google Scholar]
- Alpert, P.T. Oral Health: The Oral-Systemic Health Connection. Home Health Care Manag. Pract. 2016, 29, 56–59. [Google Scholar] [CrossRef]
- Nobile, C.J.; Johnson, A.D. Candida albicans Biofilms and Human Disease. Annu. Rev. Microbiol. 2015, 69, 71–92. [Google Scholar] [CrossRef]
- Iliev, I.D.; Leonardi, I. Fungal dysbiosis: Immunity and interactions at mucosal barriers. Nat. Rev. Immunol. 2017, 17, 635–646. [Google Scholar] [CrossRef]
- Singh, A.; Verma, R.; Murari, A.; Agrawal, A. Oral candidiasis: An overview. J. Oral Maxillofac. Pathol. 2014, 18 (Suppl. S1), S81–S85. [Google Scholar] [CrossRef]
- Ramage, G.; Coco, B.; Sherry, L.; Bagg, J.; Lappin, D.F. In vitro Candida albicans biofilm induced proteinase activity and SAP8 expression correlates with in vivo denture stomatitis severity. Mycopathologia 2012, 174, 11–19. [Google Scholar] [CrossRef] [PubMed]
- De Bernardis, F.; Mühlschlegel, F.A.; Cassone, A.; Fonzi, W.A. The pH of the host niche controls gene expression in and virulence of Candida albicans. Infect. Immun. 1998, 66, 3317–3325. [Google Scholar] [CrossRef] [PubMed]
- Bachtiar, E.W.; Bachtiar, B.M. Relationship between Candida albicans and Streptococcus mutans in early childhood caries, evaluated by quantitative PCR. F1000Research 2018, 7, 1645. [Google Scholar] [CrossRef]
- Kim, D.; Sengupta, A.; Niepa, T.H.R.; Lee, B.-H.; Weljie, A.; Freitas-Blanco, V.S.; Murata, R.M.; Stebe, K.J.; Lee, D.; Koo, H. Candida albicans stimulates Streptococcus mutans microcolony development via cross-kingdom biofilm-derived metabolites. Sci. Rep. 2017, 7, 41332. [Google Scholar] [CrossRef] [PubMed]
- Siqueira, J.F., Jr.; Rôças, I.N. Microbiology and treatment of acute apical abscesses. Clin. Microbiol. Rev. 2013, 26, 255–273. [Google Scholar] [CrossRef]
- Cope, A.L.; Francis, N.; Wood, F.; Chestnutt, I.G. Systemic antibiotics for symptomatic apical periodontitis and acute apical abscess in adults. Cochrane Database Syst. Rev. 2018, 9, CD010136. [Google Scholar] [CrossRef] [PubMed]
- Segura-Egea, J.J.; Gould, K.; Şen, B.H.; Jonasson, P.; Cotti, E.; Mazzoni, A.; Sunay, H.; Tjäderhane, L.; Dummer, P.M.H. Antibiotics in Endodontics: A review. Int. Endod. J. 2017, 50, 1169–1184. [Google Scholar] [CrossRef] [PubMed]
- Lockhart, P.B.; Tampi, M.P.; Abt, E.; Aminoshariae, A.; Durkin, M.J.; Fouad, A.F.; Gopal, P.; Hatten, B.W.; Kennedy, E.; Lang, M.S.; et al. Evidence-based clinical practice guideline on antibiotic use for the urgent management of pulpal- and periapical-related dental pain and intraoral swelling: A report from the American Dental Association. J. Am. Dent. Assoc. 2019, 150, 906–921.e12. [Google Scholar] [CrossRef]
- Poveda Roda, R.; Bagan, J.V.; Sanchis Bielsa, J.M.; Carbonell Pastor, E. Antibiotic use in dental practice. A review. Med. Oral Patol. Oral Cir. Bucal 2007, 12, E186–E192. [Google Scholar]
- Meinen, A.; Reuss, A.; Willrich, N.; Feig, M.; Noll, I.; Eckmanns, T.; Al-Nawas, B.; Markwart, R. Antimicrobial Resistance and the Spectrum of Pathogens in Dental and Oral-Maxillofacial Infections in Hospitals and Dental Practices in Germany. Front. Microbiol. 2021, 12, 676108. [Google Scholar] [CrossRef] [PubMed]
- Koyuncuoglu, C.Z.; Aydin, M.; Kirmizi, N.I.; Aydin, V.; Aksoy, M.; Isli, F.; Akici, A. Rational use of medicine in dentistry: Do dentists prescribe antibiotics in appropriate indications? Eur. J. Clin. Pharmacol. 2017, 73, 1027–1032. [Google Scholar] [CrossRef]
- Marra, F.; George, D.; Chong, M.; Sutherland, S.; Patrick, D.M. Antibiotic prescribing by dentists has increased: Why? J. Am. Dent. Assoc. 2016, 147, 320–327. [Google Scholar] [CrossRef]
- Ventola, C.L. The antibiotic resistance crisis: Part 1: Causes and threats. Pharm. Ther. 2015, 40, 277–283. [Google Scholar]
- Murray, C.J.; Ikuta, K.S.; Sharara, F.; Swetschinski, L.; Aguilar, G.R.; Gray, A.; Han, C.; Bisignano, C.; Rao, P.; Wool, E.; et al. Global burden of bacterial antimicrobial resistance in 2019: A systematic analysis. Lancet 2022, 399, 629–655. [Google Scholar] [CrossRef]
- Llor, C.; Bjerrum, L. Antimicrobial resistance: Risk associated with antibiotic overuse and initiatives to reduce the problem. Ther. Adv. Drug Saf. 2014, 5, 229–241. [Google Scholar] [CrossRef] [PubMed]
- Öcek, Z.; Sahin, H.; Baksi, G.; Apaydin, S. Development of a rational antibiotic usage course for dentists. Eur. J. Dent. Educ. 2008, 12, 41–47. [Google Scholar] [CrossRef]
- Agnihotry, A.; Thompson, W.; Fedorowicz, Z.; van Zuuren, E.J.; Sprakel, J. Antibiotic use for irreversible pulpitis. Cochrane Database Syst. Rev. 2019, CD004969. [Google Scholar] [CrossRef]
- Slots, J.; Ting, M. Systemic antibiotics in the treatment of periodontal disease. Periodontology 2000 2002, 28, 106–176. [Google Scholar] [CrossRef] [PubMed]
- Ong, A.; Kim, J.; Loo, S.; Quaranta, A.; Rincon, J.C.A. Prescribing trends of systemic antibiotics by periodontists in Australia. J. Periodontol. 2019, 90, 982–992. [Google Scholar] [CrossRef] [PubMed]
- Ayukekbong, J.A.; Ntemgwa, M.; Atabe, A.N. The threat of antimicrobial resistance in developing countries: Causes and control strategies. Antimicrob. Resist. Infect. Control 2017, 6, 47. [Google Scholar] [CrossRef]
- Menz, B.D.; Charani, E.; Gordon, D.L.; Leather, A.J.M.; Moonesinghe, S.R.; Phillips, C.J. Surgical Antibiotic Prophylaxis in an Era of Antibiotic Resistance: Common Resistant Bacteria and Wider Considerations for Practice. Infect. Drug Resist. 2021, 14, 5235–5252. [Google Scholar] [CrossRef] [PubMed]
- Lushniak, B.D. Antibiotic resistance: A public health crisis. Public Health Rep. 2014, 129, 314–316. [Google Scholar] [CrossRef]
- Ventola, C.L. The antibiotic resistance crisis: Part 2: Management strategies and new agents. Pharm. Ther. 2015, 40, 344–352. [Google Scholar]
- Wilson, W.; Taubert, K.A.; Gewitz, M.; Lockhart, P.B.; Baddour, L.M.; Levison, M.; Bolger, A.; Cabell, C.H.; Takahashi, M.; Baltimore, R.S.; et al. Prevention of infective endocarditis: Guidelines from the American Heart Association: A guideline from the American Heart Association Rheumatic Fever, Endocarditis and Kawasaki Disease Committee, Council on Cardiovascular Disease in the Young, and the Council on Clinical Cardiology, Council on Cardiovascular Surgery and Anesthesia, and the Quality of Care and Outcomes Research Interdisciplinary Working Group. J. Am. Dent. Assoc. 2007, 138, 739–760. [Google Scholar] [CrossRef]
- Kohanski, M.A.; Dwyer, D.J.; Collins, J.J. How antibiotics kill bacteria: From targets to networks. Nat. Rev. Microbiol. 2010, 8, 423–435. [Google Scholar] [CrossRef]
- Kapoor, G.; Saigal, S.; Elongavan, A. Action and resistance mechanisms of antibiotics: A guide for clinicians. J. Anaesthesiol. Clin. Pharmacol. 2017, 33, 300–305. [Google Scholar] [CrossRef]
- Munita, J.M.; Arias, C.A. Mechanisms of Antibiotic Resistance. Microbiol. Spectr. 2016, 4, 2. [Google Scholar] [CrossRef] [PubMed]
- Berger-Bächi, B.; Rohrer, S. Factors influencing methicillin resistance in staphylococci. Arch. Microbiol. 2002, 178, 165–171. [Google Scholar] [CrossRef]
- Macheboeuf, P.; Contreras-Martel, C.; Job, V.; Dideberg, O.; Dessen, A. Penicillin Binding Proteins: Key players in bacterial cell cycle and drug resistance processes. FEMS Microbiol. Rev. 2006, 30, 673–691. [Google Scholar] [CrossRef] [PubMed]
- Rajendiran, M.; Trivedi, H.M.; Chen, D.; Gajendrareddy, P.; Chen, L. Recent Development of Active Ingredients in Mouthwashes and Toothpastes for Periodontal Diseases. Molecules 2021, 26, 2001. [Google Scholar] [CrossRef] [PubMed]
- The FDA Approved Drug Products: Peridex (Chlorhexidine Gluconate) Oral Rinse. Available online: https://www.accessdata.fda.gov/drugsatfda_docs/label/2013/019028s020lbl.pdf (accessed on 9 February 2022).
- Hope, C.K.; Wilson, M. Analysis of the effects of chlorhexidine on oral biofilm vitality and structure based on viability profiling and an indicator of membrane integrity. Antimicrob. Agents Chemother. 2004, 48, 1461–1468. [Google Scholar] [CrossRef]
- Varoni, E.; Tarce, M.; Lodi, G.; Carrassi, A. Chlorhexidine (CHX) in dentistry: State of the art. Minerva Stomatol 2012, 61, 399–419. [Google Scholar]
- National Center for Biotechnology Information. PubChem Compound Summary for CID 9552079, Chlorhexidine. Available online: https://pubchem.ncbi.nlm.nih.gov/compound/Chlorhexidine (accessed on 1 August 2022).
- Williamson, D.A.; Carter, G.P.; Howden, B.P. Current and Emerging Topical Antibacterials and Antiseptics: Agents, Action, and Resistance Patterns. Clin. Microbiol. Rev. 2017, 30, 827–860. [Google Scholar] [CrossRef] [PubMed]
- Leshem, T.; Gilron, S.; Azrad, M.; Peretz, A. Characterization of reduced susceptibility to chlorhexidine among Gram-negative bacteria. Microbes Infect. 2021, 24, 104891. [Google Scholar] [CrossRef]
- Chatzigiannidou, I.; Teughels, W.; Van de Wiele, T.; Boon, N. Oral biofilms exposure to chlorhexidine results in altered microbial composition and metabolic profile. NPJ Biofilms Microbiomes 2020, 6, 13. [Google Scholar] [CrossRef]
- James, P.; Worthington, H.V.; Parnell, C.; Harding, M.; Lamont, T.; Cheung, A.; Whelton, H.; Riley, P. Chlorhexidine mouthrinse as an adjunctive treatment for gingival health. Cochrane Database Syst. Rev. 2017, 3, CD008676. [Google Scholar] [CrossRef]
- Ellingsen, J.E.; Rølla, G.; Eriksen, H.M. Extrinsic dental stain caused by chlorhexidine and other denaturing agents. J. Clin. Periodontol. 1982, 9, 317–322. [Google Scholar] [CrossRef]
- Gent, J.F.; Frank, M.E.; Hettinger, T.P. Taste Confusions Following Chlorhexidine Treatment. Chem. Senses 2002, 27, 73–80. [Google Scholar] [CrossRef]
- Frank, M.E.; Gent, J.F.; Hettinger, T.P. Effects of chlorhexidine on human taste perception. Physiol. Behav. 2001, 74, 85–99. [Google Scholar] [CrossRef]
- Silvestri, D.L.; McEnery-Stonelake, M. Chlorhexidine: Uses and Adverse Reactions. Dermatitis 2013, 24, 112–118. [Google Scholar] [CrossRef]
- Holland, R.; Souza, V.d. Ability of a new calcium hydroxide root canal filling material to induce hard tissue formation. J. Endod. 1985, 11, 535–543. [Google Scholar] [CrossRef]
- Holland, R.; Souza, V.; Nery, M.J.; Bernabe, P.F.E.; Mello, W.; Filho, J.A.O. Apical hard-tissue deposition in adult teeth of monkeys with use of calcium hydroxide. Aust. Dent. J. 1980, 25, 189–192. [Google Scholar] [CrossRef]
- Carrotte, P. Endodontics: Part 9 Calcium hydroxide, root resorption, endo-perio lesions. Br. Dent. J. 2004, 197, 735–743. [Google Scholar] [CrossRef]
- Fava, L.R.; Saunders, W.P. Calcium hydroxide pastes: Classification and clinical indications. Int. Endod. J. 1999, 32, 257–282. [Google Scholar] [CrossRef]
- Lacević, A.; Vranić, E.; Zulić, I. Clinical application of calcium hydroxide in dental pathology and endodontics. Bosn. J. Basic Med. Sci. 2003, 3, 26–29. [Google Scholar] [CrossRef]
- Zasloff, M. Antimicrobial peptides of multicellular organisms. Nature 2002, 415, 389–395. [Google Scholar] [CrossRef]
- Brogden, K.A. Antimicrobial peptides: Pore formers or metabolic inhibitors in bacteria? Nat. Rev. Microbiol. 2005, 3, 238–250. [Google Scholar] [CrossRef]
- Zanetti, M. The role of cathelicidins in the innate host defenses of mammals. Curr. Issues Mol. Biol. 2005, 7, 179–196. [Google Scholar] [CrossRef]
- Kmeck, A.; Tancer, R.J.; Ventura, C.R.; Wiedman, G.R. Synergies with and resistance to membrane-active peptides. Antibiotics 2020, 9, 620. [Google Scholar] [CrossRef]
- Cho, J.H.; Sung, B.H.; Kim, S.C. Buforins: Histone H2A-derived antimicrobial peptides from toad stomach. Biochim. Biophys. Acta (BBA)—Biomembr. 2009, 1788, 1564–1569. [Google Scholar] [CrossRef]
- Salazar, V.A.; Rubin, J.; Moussaoui, M.; Pulido, D.; Nogués, M.V.; Venge, P.; Boix, E. Protein post-translational modification in host defense: The antimicrobial mechanism of action of human eosinophil cationic protein native forms. FEBS J. 2014, 281, 5432–5446. [Google Scholar] [CrossRef]
- Bednarska, N.G.; Wren, B.W.; Willcocks, S.J. The importance of the glycosylation of antimicrobial peptides: Natural and synthetic approaches. Drug Discov. Today 2017, 22, 919–926. [Google Scholar] [CrossRef]
- Lee, E.Y.; Lee, M.W.; Wong, G.C.L. Modulation of toll-like receptor signaling by antimicrobial peptides. In Seminars in Cell and Developmental Biology; Elsevier Ltd.: Amsterdam, The Netherlands, 2019; pp. 173–184. [Google Scholar]
- Avci, F.G.; Akbulut, B.S.; Ozkirimli, E. Membrane Active Peptides and Their Biophysical Characterization. Biomolecules 2018, 8, 77. [Google Scholar] [CrossRef]
- Chan, D.I.; Prenner, E.J.; Vogel, H.J. Tryptophan- and arginine-rich antimicrobial peptides: Structures and mechanisms of action. Biochim. Biophys. Acta (BBA)—Biomembr. 2006, 1758, 1184–1202. [Google Scholar] [CrossRef] [PubMed]
- Takahashi, D.; Shukla, S.K.; Prakash, O.; Zhang, G. Structural determinants of host defense peptides for antimicrobial activity and target cell selectivity. Biochimie 2010, 92, 1236–1241. [Google Scholar] [CrossRef] [PubMed]
- Cutrona, K.J.; Kaufman, B.A.; Figueroa, D.M.; Elmore, D.E. Role of arginine and lysine in the antimicrobial mechanism of histone-derived antimicrobial peptides. FEBS Lett. 2015, 589, 3915–3920. [Google Scholar] [CrossRef] [PubMed]
- White, S.H.; Wimley, W.C. Hydrophobic interactions of peptides with membrane interfaces. Biochim. Biophys. Acta (BBA)—Rev. Biomembr. 1998, 1376, 339–352. [Google Scholar] [CrossRef]
- Fernández-Vidal, M.; White, S.H.; Ladokhin, A.S. Membrane Partitioning: “Classical” and “Nonclassical” Hydrophobic Effects. J. Membr. Biol. 2011, 239, 5–14. [Google Scholar] [CrossRef]
- Rees, D.C.; DeAntonio, L.; Eisenberg, D. Hydrophobic Organization of Membrane Proteins. Science 1989, 245, 510–513. [Google Scholar] [CrossRef]
- Saint Jean, K.D.; Henderson, K.D.; Chrom, C.L.; Abiuso, L.E.; Renn, L.M.; Caputo, G.A. Effects of Hydrophobic Amino Acid Substitutions on Antimicrobial Peptide Behavior. Probiotics Antimicrob. Proteins 2018, 10, 408–419. [Google Scholar] [CrossRef]
- Pace, C.N.; Shirley, B.A.; McNutt, M.; Gajiwala, K. Forces contributing to the conformational stability of proteins. FASEB J. 1996, 10, 75–83. [Google Scholar] [CrossRef]
- Zviling, M.; Leonov, H.; Arkin, I.T. Genetic algorithm-based optimization of hydrophobicity tables. Bioinformatics 2005, 21, 2651–2656. [Google Scholar] [CrossRef]
- Wimley, W.C.; White, S.H. Experimentally determined hydrophobicity scale for proteins at membrane interfaces. Nat. Struct. Biol. 1996, 3, 842–848. [Google Scholar] [CrossRef]
- Gong, H.; Zhang, J.; Hu, X.; Li, Z.; Fa, K.; Liu, H.; Waigh, T.A.; McBain, A.; Lu, J.R. Hydrophobic Control of the Bioactivity and Cytotoxicity of de Novo-Designed Antimicrobial Peptides. ACS Appl. Mater. Interfaces 2019, 11, 34609–34620. [Google Scholar] [CrossRef] [PubMed]
- Matsuzaki, K. Control of cell selectivity of antimicrobial peptides. Biochim. Biophys. Acta (BBA)—Biomembr. 2009, 1788, 1687–1692. [Google Scholar] [CrossRef] [PubMed]
- Schmidtchen, A.; Pasupuleti, M.; Malmsten, M. Effect of hydrophobic modifications in antimicrobial peptides. Adv. Colloid Interface Sci. 2014, 205, 265–274. [Google Scholar] [CrossRef] [PubMed]
- Ladokhin, A.S.; White, S.H. Protein Chemistry at Membrane Interfaces: Non-additivity of Electrostatic and Hydrophobic Interactions. J. Mol. Biol. 2001, 309, 543–552. [Google Scholar] [CrossRef] [PubMed]
- Hollmann, A.; Martínez, M.; Noguera, M.E.; Augusto, M.T.; Disalvo, A.; Santos, N.C.; Semorile, L.; Maffía, P.C. Role of amphipathicity and hydrophobicity in the balance between hemolysis and peptide-membrane interactions of three related antimicrobial peptides. Colloids Surf. B Biointerfaces 2016, 141, 528–536. [Google Scholar] [CrossRef]
- Eisenberg, D.; Weiss, R.M.; Terwilliger, T.C. The helical hydrophobic moment: A measure of the amphiphilicity of a helix. Nature 1982, 299, 371–374. [Google Scholar] [CrossRef]
- Fernández-Vidal, M.; Jayasinghe, S.; Ladokhin, A.S.; White, S.H. Folding Amphipathic Helices Into Membranes: Amphiphilicity Trumps Hydrophobicity. J. Mol. Biol. 2007, 370, 459–470. [Google Scholar] [CrossRef]
- Yin, L.M.; Edwards, M.A.; Li, J.; Yip, C.M.; Deber, C.M. Roles of hydrophobicity and charge distribution of cationic antimicrobial peptides in peptide-membrane interactions. J. Biol. Chem. 2012, 287, 7738–7745. [Google Scholar] [CrossRef]
- Almeida, P.F.; Ladokhin, A.S.; White, S.H. Hydrogen-bond energetics drive helix formation in membrane interfaces. Biochim. Biophys. Acta (BBA)—Biomembr. 2012, 1818, 178–182. [Google Scholar] [CrossRef]
- Zasloff, M. Magainins, a class of antimicrobial peptides from Xenopus skin: Isolation, characterization of two active forms, and partial cDNA sequence of a precursor. Proc. Natl. Acad. Sci. USA 1987, 84, 5449–5453. [Google Scholar] [CrossRef]
- Sevier, C.S.; Kaiser, C.A. Formation and transfer of disulphide bonds in living cells. Nat. Rev. Mol. Cell Biol. 2002, 3, 836–847. [Google Scholar] [CrossRef] [PubMed]
- Wiedemann, C.; Kumar, A.; Lang, A.; Ohlenschläger, O. Cysteines and Disulfide Bonds as Structure-Forming Units: Insights from Different Domains of Life and the Potential for Characterization by NMR. Front. Chem. 2020, 8, 280. [Google Scholar] [CrossRef] [PubMed]
- Nguyen, L.T.; Haney, E.F.; Vogel, H.J. The expanding scope of antimicrobial peptide structures and their modes of action. Trends Biotechnol. 2011, 29, 464–472. [Google Scholar] [CrossRef] [PubMed]
- Oren, Z.; Shai, Y. Mode of action of linear amphipathic α-helical antimicrobial peptides. Pept. Sci. 1998, 47, 451–463. [Google Scholar] [CrossRef]
- Sengupta, D.; Leontiadou, H.; Mark, A.E.; Marrink, S.-J. Toroidal pores formed by antimicrobial peptides show significant disorder. Biochim. Biophys. Acta (BBA)—Biomembr. 2008, 1778, 2308–2317. [Google Scholar] [CrossRef]
- Shai, Y.; Oren, Z. From “carpet” mechanism to de-novo designed diastereomeric cell-selective antimicrobial peptides. Peptides 2001, 22, 1629–1641. [Google Scholar] [CrossRef]
- Cranfield, C.G.; Cornell, B.A.; Grage, S.L.; Duckworth, P.; Carne, S.; Ulrich, A.S.; Martinac, B. Transient potential gradients and impedance measures of tethered bilayer lipid membranes: Pore-forming peptide insertion and the effect of electroporation. Biophys. J. 2014, 106, 182–189. [Google Scholar] [CrossRef]
- Elmore, D.E. Insights into buforin II membrane translocation from molecular dynamics simulations. Peptides 2012, 38, 357–362. [Google Scholar] [CrossRef] [PubMed]
- Jain, A.; Yadav, B.K.; Chugh, A. Marine antimicrobial peptide tachyplesin as an efficient nanocarrier for macromolecule delivery in plant and mammalian cells. FEBS J. 2015, 282, 732–745. [Google Scholar] [CrossRef] [PubMed]
- Wang, S.; Wang, Q.; Zeng, X.; Ye, Q.; Huang, S.; Yu, H.; Yang, T.; Qiao, S. Use of the Antimicrobial Peptide Sublancin with Combined Antibacterial and Immunomodulatory Activities to Protect against Methicillin-Resistant Staphylococcus aureus Infection in Mice. J. Agric. Food Chem. 2017, 65, 8595–8605. [Google Scholar] [CrossRef]
- Gursoy, U.K.; Könönen, E.; Luukkonen, N.; Uitto, V.J. Human neutrophil defensins and their effect on epithelial cells. J. Periodontol. 2013, 84, 126–133. [Google Scholar] [CrossRef] [PubMed]
- Munz, M.; Willenborg, C.; Richter, G.M.; Jockel-Schneider, Y.; Graetz, C.; Staufenbiel, I.; Wellmann, J.; Berger, K.; Krone, B.; Hoffmann, P.; et al. A genome-wide association study identifies nucleotide variants at SIGLEC5 and DEFA1A3 as risk loci for periodontitis. Hum. Mol. Genet. 2017, 26, 2577–2588. [Google Scholar] [CrossRef]
- Gürsoy, M.; Könönen, E.; He, Q.; Liukkonen, A.; Huumonen, S.; Gürsoy, U.K. Toll-like receptor-1, -2, and -6 genotypes in relation to salivary human beta-defensin-1, -2, -3 and human neutrophilic peptide-1. J. Clin. Periodontol. 2022. [Google Scholar] [CrossRef] [PubMed]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial Peptides: Diversity, Mechanism of Action and Strategies to Improve the Activity and Biocompatibility In Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef] [PubMed]
- Storici, P.; Tossi, A.; Lenarčič, B.; Romeo, D. Purification and Structural Characterization of Bovine Cathelicidins, Precursors of Antimicrobial Peptides. Eur. J. Biochem. 1996, 238, 769–776. [Google Scholar] [CrossRef]
- Larrick, J.W.; Hirata, M.; Balint, R.F.; Lee, J.; Zhong, J.; Wright, S.C. Human CAP18: A novel antimicrobial lipopolysaccharide-binding protein. Infect. Immun. 1995, 63, 1291–1297. [Google Scholar] [CrossRef]
- Murakami, M.; Kameda, K.; Tsumoto, H.; Tsuda, T.; Masuda, K.; Utsunomiya, R.; Mori, H.; Miura, Y.; Sayama, K. TLN-58, an Additional hCAP18 Processing Form, Found in the Lesion Vesicle of Palmoplantar Pustulosis in the Skin. J. Investig. Dermatol. 2017, 137, 322–331. [Google Scholar] [CrossRef] [PubMed]
- Sancho-Vaello, E.; Gil-Carton, D.; François, P.; Bonetti, E.-J.; Kreir, M.; Pothula, K.R.; Kleinekathöfer, U.; Zeth, K. The structure of the antimicrobial human cathelicidin LL-37 shows oligomerization and channel formation in the presence of membrane mimics. Sci. Rep. 2020, 10, 17356. [Google Scholar] [CrossRef]
- Mishra, B.; Golla, R.M.; Lau, K.; Lushnikova, T.; Wang, G. Anti-Staphylococcal Biofilm Effects of Human Cathelicidin Peptides. ACS Med. Chem. Lett. 2016, 7, 117–121. [Google Scholar] [CrossRef]
- Shafee, T.M.A.; Lay, F.T.; Phan, T.K.; Anderson, M.A.; Hulett, M.D. Convergent evolution of defensin sequence, structure and function. Cell. Mol. Life Sci. 2016, 74, 663–682. [Google Scholar] [CrossRef]
- Sabatini, L.M.; Azen, E.A. Histatins, a family of salivary histidine-rich proteins, are encoded by at least two loci (HIS1 and HIS2). Biochem. Biophys. Res. Commun. 1989, 160, 495–502. [Google Scholar] [CrossRef]
- Du, H.; Puri, S.; McCall, A.; Norris, H.L.; Russo, T.; Edgerton, M. Human salivary protein histatin 5 has potent bactericidal activity against ESKAPE pathogens. Front. Cell. Infect. Microbiol. 2017, 7, 41. [Google Scholar] [CrossRef]
- Cheng, K.-T.; Wu, C.-L.; Yip, B.-S.; Chih, Y.-H.; Peng, K.-L.; Hsu, S.-Y.; Yu, H.-Y.; Cheng, J.-W. The Interactions between the Antimicrobial Peptide P-113 and Living Candida albicans Cells Shed Light on Mechanisms of Antifungal Activity and Resistance. Int. J. Mol. Sci. 2020, 21, 2654. [Google Scholar] [CrossRef] [PubMed]
- Moffa, E.B.; Mussi, M.C.M.; Xiao, Y.; Garrido, S.S.; Machado, M.A.A.M.; Giampaolo, E.T.; Siqueira, W.L. Histatin 5 inhibits adhesion of C. albicans to Reconstructed Human Oral Epithelium. Front. Microbiol. 2015, 6, 885. [Google Scholar] [CrossRef] [PubMed]
- McCaslin, T.G.; Pagba, C.V.; Yohannan, J.; Barry, B.A. Specific metallo-protein interactions and antimicrobial activity in Histatin-5, an intrinsically disordered salivary peptide. Sci. Rep. 2019, 9, 17303. [Google Scholar] [CrossRef] [PubMed]
- Moretta, A.; Scieuzo, C.; Petrone, A.M.; Salvia, R.; Manniello, M.D.; Franco, A.; Lucchetti, D.; Vassallo, A.; Vogel, H.; Sgambato, A.; et al. Antimicrobial Peptides: A New Hope in Biomedical and Pharmaceutical Fields. Front. Cell. Infect. Microbiol. 2021, 11, 668632. [Google Scholar] [CrossRef]
- Akbari, R.; Hakemi Vala, M.; Hashemi, A.; Aghazadeh, H.; Sabatier, J.M.; Pooshang Bagheri, K. Action mechanism of melittin-derived antimicrobial peptides, MDP1 and MDP2, de novo designed against multidrug resistant bacteria. Amino Acids 2018, 50, 1231–1243. [Google Scholar] [CrossRef]
- Maturana, P.; Gonçalves, S.; Martinez, M.; Espeche, J.C.; Santos, N.C.; Semorile, L.; Maffia, P.C.; Hollmann, A. Interactions of “de novo” designed peptides with bacterial membranes: Implications in the antimicrobial activity. Biochim. Biophys. Acta—Biomembr. 2020, 1862, 183443. [Google Scholar] [CrossRef]
- Lam, S.J.; Wong, E.H.H.; Boyer, C.; Qiao, G.G. Antimicrobial polymeric nanoparticles. Prog. Polym. Sci. 2018, 76, 40–64. [Google Scholar] [CrossRef]
- Lam, S.J.; Wong, E.H.H.; O’Brien-Simpson, N.M.; Pantarat, N.; Blencowe, A.; Reynolds, E.C.; Qiao, G.G. Bionano Interaction Study on Antimicrobial Star-Shaped Peptide Polymer Nanoparticles. ACS Appl. Mater. Interfaces 2016, 8, 33446–33456. [Google Scholar] [CrossRef] [PubMed]
- Weiss, A.C.G.; Shirbin, S.J.; Kelly, H.G.; Besford, Q.A.; Kent, S.J.; Qiao, G.G. Plasma Corona Protects Human Immune Cells from Structurally Nanoengineered Antimicrobial Peptide Polymers. ACS Appl. Mater. Interfaces 2021, 13, 33821–33829. [Google Scholar] [CrossRef]
- Li, W.; Lin, F.; Hung, A.; Barlow, A.; Sani, M.-A.; Paolini, R.; Singleton, W.; Holden, J.; Hossain, M.A.; Separovic, F.; et al. Enhancing proline-rich antimicrobial peptide action by homodimerization: Influence of bifunctional linker. Chem. Sci. 2022, 13, 2226–2237. [Google Scholar] [CrossRef] [PubMed]
- Shi, Y.; Feng, X.; Lin, L.; Wang, J.; Chi, J.; Wu, B.; Zhou, G.; Yu, F.; Xu, Q.; Liu, D.; et al. Virus-inspired surface-nanoengineered antimicrobial liposome: A potential system to simultaneously achieve high activity and selectivity. Bioact. Mater. 2021, 6, 3207–3217. [Google Scholar] [CrossRef] [PubMed]
- Worthington, P.; Langhans, S.; Pochan, D. β-hairpin peptide hydrogels for package delivery. Adv. Drug Deliv. Rev. 2017, 110–111, 127–136. [Google Scholar] [CrossRef] [PubMed]
- Tsukamoto, M.; Zappala, E.; Caputo, G.A.; Kikuchi, J.-i.; Najarian, K.; Kuroda, K.; Yasuhara, K. Mechanistic Study of Membrane Disruption by Antimicrobial Methacrylate Random Copolymers by the Single Giant Vesicle Method. Langmuir 2021, 37, 9982–9995. [Google Scholar] [CrossRef]
- Song, D.; Jiao, H.; Liu, Z. Phospholipid translocation captured in a bifunctional membrane protein MprF. Nat. Commun. 2021, 12, 2927. [Google Scholar] [CrossRef]
- Gunn, J.S.; Ryan, S.S.; Van Velkinburgh, J.C.; Ernst, R.K.; Miller, S.I. Genetic and functional analysis of a PmrA-PmrB-regulated locus necessary for lipopolysaccharide modification, antimicrobial peptide resistance, and oral virulence of Salmonella enterica Serovar Typhimurium. Infect. Immun. 2000, 68, 6139–6146. [Google Scholar] [CrossRef] [PubMed]
- Marchant, P.; Carreño, A.; Vivanco, E.; Silva, A.; Nevermann, J.; Otero, C.; Araya, E.; Gil, F.; Calderón, I.L.; Fuentes, J.A. “One for All”: Functional Transfer of OMV-Mediated Polymyxin B Resistance From Salmonella enterica sv. Typhi ΔtolR and ΔdegS to Susceptible Bacteria. Front. Microbiol. 2021, 12, 1068. [Google Scholar] [CrossRef] [PubMed]
- Moskowitz, S.M.; Ernst, R.K.; Miller, S.I. PmrAB, a Two-Component Regulatory System of Pseudomonas aeruginosa that Modulates Resistance to Cationic Antimicrobial Peptides and Addition of Aminoarabinose to Lipid A. J. Bacteriol. 2004, 186, 575–579. [Google Scholar] [CrossRef] [PubMed]
- Özdemir, M.; Caglayan, F.; Bikker, F.J.; Pussinen, P.; Könönen, E.; Yamalik, N.; Gürsoy, M.; Fteita, D.; Nazmi, K.; Güncü, G.N.; et al. Gingival tissue human beta-defensin levels in relation to infection and inflammation. J. Clin. Periodontol. 2020, 47, 309–318. [Google Scholar] [CrossRef]
- Chung, W.O.; Dale, B.A. Innate immune response of oral and foreskin keratinocytes: Utilization of different signaling pathways by various bacterial species. Infect. Immun. 2004, 72, 352–358. [Google Scholar] [CrossRef]
- Lopatkin, A.J.; Bening, S.C.; Manson, A.L.; Stokes, J.M.; Kohanski, M.A.; Badran, A.H.; Earl, A.M.; Cheney, N.J.; Yang, J.H.; Collins, J.J. Clinically relevant mutations in core metabolic genes confer antibiotic resistance. Science 2021, 371, eaba0862. [Google Scholar] [CrossRef]
- Wong, F.; Stokes, J.; Cervantes, B.; Penkov, S.; Friedrichs, J.; Renner, L.; Collins, J. Cytoplasmic condensation induced by membrane damage is associated with antibiotic lethality. Nat. Commun. 2021, 12, 2321. [Google Scholar] [CrossRef]
- Bojar, D.; Powers, R.K.; Camacho, D.M.; Collins, J.J. Deep-Learning Resources for Studying Glycan-Mediated Host-Microbe Interactions. Cell Host Microbe 2021, 29, 132–144.e3. [Google Scholar] [CrossRef] [PubMed]
- Wang, Z.; Koirala, B.; Hernandez, Y.; Zimmerman, M.; Park, S.; Perlin, D.S.; Brady, S.F. A naturally inspired antibiotic to target multidrug-resistant pathogens. Nature 2022, 601, 606–611. [Google Scholar] [CrossRef] [PubMed]
- Chen, C.H.; Starr, C.G.; Troendle, E.; Wiedman, G.; Wimley, W.C.; Ulmschneider, J.P.; Ulmschneider, M.B. Simulation-Guided Rational de Novo Design of a Small Pore-Forming Antimicrobial Peptide. J. Am. Chem. Soc. 2019, 141, 4839–4848. [Google Scholar] [CrossRef] [PubMed]
- Koehbach, J.; Gani, J.; Hilpert, K.; Craik, D.J. Comparison of a Short Linear Antimicrobial Peptide with Its Disulfide-Cyclized and Cyclotide-Grafted Variants against Clinically Relevant Pathogens. Microorganisms 2021, 9, 1249. [Google Scholar] [CrossRef] [PubMed]
- Bishop, B.M.; Juba, M.L.; Russo, P.S.; Devine, M.; Barksdale, S.M.; Scott, S.; Settlage, R.; Michalak, P.; Gupta, K.; Vliet, K.; et al. Discovery of Novel Antimicrobial Peptides from Varanus komodoensis (Komodo Dragon) by Large-Scale Analyses and De-Novo-Assisted Sequencing Using Electron-Transfer Dissociation Mass Spectrometry. J. Proteome Res. 2017, 16, 1470–1482. [Google Scholar] [CrossRef]
- Hua, J.; Yamarthy, R.; Felsenstein, S.; Scott, R.W.; Markowitz, K.; Diamond, G. Activity of antimicrobial peptide mimetics in the oral cavity: I. Activity against biofilms of Candida albicans. Mol. Oral Microbiol. 2010, 25, 418–425. [Google Scholar] [CrossRef]
- Ye, W.-H.; Yeghiasarian, L.; Cutler, C.W.; Bergeron, B.E.; Sidow, S.; Xu, H.H.K.; Niu, L.-N.; Ma, J.-Z.; Tay, F.R. Comparison of the use of d-enantiomeric and l-enantiomeric antimicrobial peptides incorporated in a calcium-chelating irrigant against Enterococcus faecalis root canal wall biofilms. J. Dent. 2019, 91, 103231. [Google Scholar] [CrossRef]
- Mai, S.; Mauger, M.T.; Niu, L.-N.; Barnes, J.B.; Kao, S.; Bergeron, B.E.; Ling, J.-Q.; Tay, F.R. Potential applications of antimicrobial peptides and their mimics in combating caries and pulpal infections. Acta Biomater. 2017, 49, 16–35. [Google Scholar] [CrossRef] [PubMed]
Example | Primary Structure | Secondary Structure | Origin | * Net Charge |
---|---|---|---|---|
Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ-NH2 | α-helix | Apis mellifera | +6 |
Buforin II | TRSSRAGLQFPVGRVHRLLRK | α-helix | Bufo gargarizans | +6 |
LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | α-helix | Homo sapiens | +6 |
Protegrin-1 | RGGRLCYCRRRFCVCVGR | β-sheet | Sus domesticus | +6 |
Tachyplesin-1 | KWCFRVCYRGICYRRCR | β-sheet | Tachypleus tridentatus | +6 |
Human neutrophil peptide-1 | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | β-sheet | Homo sapiens | +3 |
Indolicidin | ILPWKWPWWPWRR-NH2 | Random coil | Bos taurus | +4 |
Histatin-5 | DSHAKRHHGYKRKFHEKHHSHRGY | Random coil | Homo sapiens | +6 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Griffith, A.; Mateen, A.; Markowitz, K.; Singer, S.R.; Cugini, C.; Shimizu, E.; Wiedman, G.R.; Kumar, V. Alternative Antibiotics in Dentistry: Antimicrobial Peptides. Pharmaceutics 2022, 14, 1679. https://doi.org/10.3390/pharmaceutics14081679
Griffith A, Mateen A, Markowitz K, Singer SR, Cugini C, Shimizu E, Wiedman GR, Kumar V. Alternative Antibiotics in Dentistry: Antimicrobial Peptides. Pharmaceutics. 2022; 14(8):1679. https://doi.org/10.3390/pharmaceutics14081679
Chicago/Turabian StyleGriffith, Alexandra, Akilah Mateen, Kenneth Markowitz, Steven R. Singer, Carla Cugini, Emi Shimizu, Gregory R. Wiedman, and Vivek Kumar. 2022. "Alternative Antibiotics in Dentistry: Antimicrobial Peptides" Pharmaceutics 14, no. 8: 1679. https://doi.org/10.3390/pharmaceutics14081679