Abstract
In eukaryotic cells, the spatial distribution between cytoplasm and nucleus is essential for cell homeostasis. This dynamic distribution is selectively regulated by the nuclear pore complex (NPC), which allows the passive or energy-dependent transport of proteins between these two compartments. Viruses possess many strategies to hijack nucleocytoplasmic shuttling for the benefit of their viral replication. Here, we review how viruses interfere with the karyopherin CRM1 that controls the nuclear export of protein cargoes. We analyze the fact that the viral hijacking of CRM1 provokes are-localization of numerous cellular factors in a suitable place for specific steps of viral replication. While CRM1 emerges as a critical partner for viruses, it also takes part in antiviral and inflammatory response regulation. This review also addresses how CRM1 hijacking affects it and the benefits of CRM1 inhibitors as antiviral treatments.
1. Introduction
While small molecules (<40 kDa) can diffuse passively through the nuclear pore complex (NPC), the transport of macromolecules called “cargoes” mainly relies on the nuclear transport receptors of the Karyopherin β family (Kaps). Kaps include nuclear import receptors called importins, nuclear export receptors called exportins, and bidirectional receptors. Their role is to cross the NPC thanks to concomitant interactions with the cargoes and the nucleoporins (Nups) of the NPC [1]. Concerning the export, CRM1/XPO-1 (chromosomal region maintenance 1/exportin 1) has the largest interactome out of the seven exportins described before. CRM1 was first identified in Schizosaccharomyces pombe by the characterization of a mutation leading to a phenotype of distorted chromosomes, earning the name of Chromosome Region Maintenance 1 [2]. CRM1 was then characterized as a nuclear receptor, thanks to the discovery of a natural and selective inhibitor of its export, named Leptomycin B (LMB) [3,4], and the identification of the viral protein Rev from HIV-1 as an adapter protein for the export of viral RNAs [5,6,7]. The role of CRM1 in the export of specific cellular RNAs pre-associated with protein cargoes emerged later. Since then, the use of CRM1 synthetic inhibitors has highlighted the need for strict control of the cellular proteins nucleocytoplasmic distribution to ensure cellular homeostasis and healthy behavior. As a consequence, a great diversity of biological functions controlled by this exportin was further identified.
In the context of infection, viral proteins invade most of the cellular compartments in order to complete viral replication and suppress the host antiviral threats. Consequently, they actively shuttle between nucleus and cytoplasm; thus, hijacking the CRM1-dependent export emerges as a common phenomenon to divert cell functioning in favor of viruses, although the molecular mechanisms underlying this are virus-specific. Our knowledge of the different cellular processes involved in this hijacking is still lacking. Here, we exhaustively review the current literature on these matters: we focus on the mechanisms of inhibition or hijacking favoring viral replication as well as the possible impacts of these process for the host. First, we present the CRM1-dependent export mechanism and its related cellular functions. Then, we describe how interactions between viral proteins and CRM1 promote the export of vRNA, induce the transport of viral components, modify the nuclear pore composition, or directly relocate nuclear host proteins for the benefit viral replication. Finally, we explore the biological process that may be altered from this CRM1 hijacking.
2. CRM1-Dependent Export of Macromolecules
2.1. Association Cargo—CRM1: The NES Pattern
In order to interact with a specific cargo and address it to the cytoplasm, CRM1 recognizes a particular motif called NES (nuclear export signal) [8,9]. Numerous structural studies determine a NES consensus sequence as follows: Φ0-(x)2-Φ1-(x)1-2-3-Φ2-(x)2-3-Φ3-x1-Φ4. Here, Φ represents hydrophobic residues and x represents any amino acid. Based on these hydrophobic residues and their spacing, NES adopt specific conformations called “binding groove” that define “NES classes” [1,10,11,12]. While the experimentally calculated affinities (KD) vary greatly between the different classes (KD Rev-NES of class 2 = 1180 nM; KD SNUPN-NES of class 1c = 12,500 nM), they also vary within the same class (KD PKI-NES of class 1a = 34 nM; KD STRAD-NES class 1a = 10,300 nM) [13], suggesting that the interaction surface between CRM1 and its cargo is broader than just the NES and modulates the overall affinity, as observed with the RanGTP–CRM1–Snurportin complex (Figure 1) [14]. Regardless, the affinity for CRM1 for most NES domains is rather low, consistent with the need to deliver the cargo protein efficiently into the cytoplasm [12,14,15].
Figure 1.
Structure of CRM1. (A) Schematic representation on CRM1 showing its important motifs. In N-ter, the CRIME motif is colored green. The regulatory heat 9 (H9) is red. The NES pocket (H11 and H12) is blue. Colors are respected in all the different structures. (B) Different experimental crystal structure of CRM1. (i) “Open” structure of CRM1 with low affinity for the cargoes. RCSB PDB: 4FGV from [16]. (ii) Ring structure of CRM1 in association with RanGTP (in cyan), required for active export to cytoplasm. RCSB PDB: 3NC1 from [17]. (iii) Structure of the export complex with high affinity for the cargo, Snuportin (SNUPN—magenta). SNUPN interacts with the NES pocket but additional contacts with CRM1 backbone are required for the stabilization of the complex. To facilitate the visualization, RanGTP has been removed. RCSB PDB: 3GB8 from [18]. (C) Magnification of the SNUPN NES (magenta) orientation in the NES-binding groove of CRM1. Hydrophobic acids (Φ) from the NES sequence are indicated. All the structures were generated using PyMOL Molecular Graphics System Version 2.5.5.
2.2. Association Cargo—CRM1: The NES Pattern
To load cargoes on the nuclear side, CRM1 needs the small G protein, RAN, bound to GTP. A nucleocytoplasmic gradient of RanGTP/RanGDP is maintained with RCC1 (regulator of chromosome condensation 1) converting RanGDP to RanGTP in the nucleus, whereas RanGAP (GTPase-activating protein) dephosphorylates RanGTP into RanGDP at the cytoplasmic face of the NPC [19,20]. While independent interactions of CRM1 with either RanGTP or with its cargo are weak, the connection of CRM1 with both partners together stabilizes the formation of an export complex (cargo–CRM1–RanGTP) [1,19,21]. Several structural characteristics of CRM1 are important for the establishment of these cooperative interactions (Figure 1): CRM1 is composed of 21 domains of HEAT repeats (H1 to H21), motifs which are structured in tandem “helix A–loop–helix B” motifs—the two antiparallel alpha helices A and B of each HEAT repeat stack and align in such a way that the A type helixes form a convex outer surface and the B types helixes form a concave inner surface. H11 and H12 form a hydrophobic pocket on the outer surface of CRM1, called “NES pocket” that specifically interacts with NES motifs. In the “NES pocket”, the cysteine 528 was identified to covalently bind with Leptomycin B (LMB), leading to the selective and non-competitive inhibition of CRM1 export [22]. In addition, the C-terminal region (CTR) and the H9 loop exert an inhibitory effect by masking the H11 and H12 domains. At the N-terminal of the protein, the H1–H3 motifs form a CRIME domain involved in RanGTP binding. RanGTP binding to CRM1 induces conformational changes: the N-terminal and C-terminal extremities are brought closer, folding CRM1 in a ring-like shape, releasing the H9 loop and CTR inhibition [1,19,23,24]. Recently, the STK38 kinase was proposed to stabilize this active conformation through the phosphorylation of the CTR S1055 [25].
By interacting with these structural elements, other factors will be able to modulate the stability of the export complex. For example, it is shown that RanBP3 also binds the H9 loop and stabilizes the export complex, in particular by increasing the binding affinity of RanGTP to CRM1 in the nucleus [26]. The nuclear pore (NPC) is an assembly of ~1000 proteins comprising multiple copies of 34 different Nups. Interactions between specific Nups and the export complex drive this latter to the cytoplasm. For instance, CRM1 was shown to interact with Nup153, p62, Nup98, Nup214, and hCG1 [27]. In the cytoplasm, Ran interacts with Nup358/RanBP2 and RanBP1. In addition, the SUMOylation of RanGAP favors its recruitment to RanBP2 and stabilizes the link with RanGTP [28,29]. The reversion of RanGTP in RanGDP destabilizes the CRM1–Ran interaction, leading to the return of CRM1 into its original autoinhibitory conformation. As a consequence, the cargo dissociates from CRM1 and is released in the cytoplasm, while the exportin shuttles back into the nucleus.
3. Biological Functions of CRM1
Over the years, deciphering the biological functions and process regulated by CRM1 has been performed using three different approaches (Figure 2).
Figure 2.
Biological process relying on CRM1. CRM1 exports protein cargoes containing NES. The multiplicity of the biological process dependent on CRM1 were revealed by the study of CRM1 mutants or overexpression in diseases, CRM1 inhibition by synthetic inhibitors and CRM1 interactome. Regulatory proteins include transcription factors that indirectly link CRM1 with several additional cellular functions. These transcriptional effects can also be combined with the RNA export function of CRM1. Overall, CRM1 regulates biological processes through time and space, ensuring the correct localization of proteins for their respective function, but also guarantees the limited residence of active factors in the nucleus to safeguard cellular homeostasis. CRM1 also exerts export-independent functions during snoRNA maturation to target snoRNA to the nucleolus.
3.1. Evaluation of the Impact of CRM1 Associated Mutations or Overexpression in Disease
Several CRM1/XPO1 mutations were found in solid and hematopoietic tumors. A large-scale study, which uses whole-exome genomic sequencing data from 42,793 patients, identified three frequently mutated CRM1 amino acids: E571, R749, and D624 [30,31,32]. Although their functional implications in the associated oncogenesis processes are poorly understood, their analysis highlighted some of CRM1 functions. Notably, two recent studies focused on characterizing the mutant CRM1E571K found in type B lymphoblastic cells. Miloudi et al. show that CRM1E571K accumulates in the cytoplasm and find an abnormal association with certain partners, in particular with importin β1 [33]. Baumhardt et al. combined computing analysis and cellular localization to suggest that EIF4E-transporter (4E-T)’s affinity with CRM1E571K was decreased by a factor of 10 compared to the affinity with wild-type CRM1 [34]. 4E-T is directly involved in the repression of AU-rich mRNAs in the cytoplasm [35]; decreased 4E-T levels in the cytoplasm may thus relieve this translational inhibition, modifying B-cell homeostasis. Alternatively, computational analysis suggested that the NES of the cargoes MEK1 would have an increased affinity for CRM1E571K. This could lead to a possible blockage of CRM1 and a slowdown in the export of other specific cargoes. The authors also stressed that additional cargoes, such as IKBα and IKBε, with lower difference in affinity between wild-type and mutant CRM1 were found and could also play a significant role in cancer development. Finally, severe mitotic defects were found in the HEK293T CRM1E571K/E571K cells [34]. This supports previous observations describing the recruitment of proteins such as RanGAP and RanBP2 to kinetochores in a CRM1-dependent manner, during the metaphase–anaphase transition [36].
Overexpression of CRM1 is also frequently found in various types of cancers (pancreatic, glioma, ovarian, pulmonary, prostate, and colorectal). It is generally associated with a poor prognosis and resistance to chemotherapies [30,37,38,39]. More precisely, the overexpression of CRM1 has been shown to alter the processes of apoptosis, DNA damage repair, chromosome stability, and angiogenesis [40,41,42,43]. Supporting this idea, a large number of tumor suppressors (such as p53, the retinoblastoma protein RB or BRCA1/2), oncogenic proteins (such as BCR-ABL), and transcription factors (such as FOXO and NF-kB proteins) were found to be mislocalized in cancer cells [24,30,44,45].
CRM1 is also considered to be an interesting target in aging pathologies, such as Hutchinson–Gilford progeria syndrome (HGPS), where it is overexpressed [46]. The increase export activity was also observed in the hippocampus and cortex during physiological aging. Here, CRM1 accumulation resulted in a decrease in nuclear TFEB and STAT3 linked with an autophagic flux impairment [47].
3.2. Evaluation of the Impact of CRM1 Inhibitors
A few decades ago, it emerged that excessive nuclear export could contribute to drug resistance during cancer treatment. Many efforts were then expended towards the development of compounds that inhibit CRM1. The latter of these play a critical role in our current knowledge of CRM1-dependent biological processes as well as CRM1-related cargoes. The most well-known inhibitor is leptomycin B (LMB) [48]. Due to its excessive toxicity, a new class of agents was then developed: the “Selective Inhibitors of Nuclear Export” (SINE). These molecules form covalent bonds with CRM1 C528 like LMB (Figure 3) [49]. However, they are engaged in a slowly reversible covalent bonding, which decreases their toxicity [50]. They also cause a transient degradation of CRM1, reversible upon discontinuation of the treatment [51]. Selinexor (KPT-330), the most promising one, is involved in at least 12 phase I and II clinical trials with hematological malignancies and 8 phase I and II clinical trials with solid tumors [52,53,54,55].
Patients with multiple myeloma (MM) commonly acquire a resistance to bortezomid, a proteasomal inhibitor. Quantitative mass spectrometry analysis revealed that CRM1 as well as a strong cluster of XPO1 regulated proteins were upregulated in bortezomid resistant MM cells [56]. In experimental models, the combined treatment of bortezomid with Selinexor improved survival with a decreased tumor development and progression compared with bortezomid alone [57]. Additional studies on gefitinib resistance, ibrutinib resistance, or platinium resistance have demonstrated how reversing CRM1 overexpression through Selinexor inhibition retains key oncogenic signaling proteins and DNA repair factors in the nucleus (β-catenin, DDX17, IκBα, NF-κB p65, p53, SET, Top2A, and E2F) and restores cellular sensitivity to chemotherapy. In addition, in vitro experiments showed that, in macrophages, Selinexor is able to repress the production of TNF-α, a known LPS-induced proinflammatory cytokine, notably through suppressing NF-kB signaling. Notably, CRM1 inhibition induced the nuclear retention of p65 and IκBα, retaining NF-κB subunits in a repressed complex. As a consequence, the NF-κB regulation and activation pathways were disrupted, reversing its proinflammatory profile [58]. Similarly, the use of the SINEs KPT-350 and KPT-335 showed an upregulation of anti-inflammatory cytokines (IL-4, IL-10 and IL-13) and a downregulation of proinflammatory cytokines (including IL-1A/B, IL-6 and IL-8) revealing the central role of CRM1 in the inflammatory response [59,60].
Figure 3.
Inhibitors of CRM1. (A) Structure of CRM1 in association with SINE. Domains are coloured as descried in Figure 1. (i) Structure of CRM1 in association with leptomycin B (LMB), in purple. RCSB PDB: 6TVO from [61]. (ii) Structure of CRM1 in association with Selinexor (KPT-330), in purple. RCSB PDB: 7L5E from [62]. The two described SINE inhibit CRM1 nuclear export by interaction with the cysteine 528, located on the NES binding groove. All these figures were generate using PyMOL Molecular Graphics System Version 2.5.5. (B) Table of the CRM1 inhibitors used in antiviral therapy (see Section 5, Discussion) [6,63,64,65,66,67,68].
3.3. Investigatation of CRM1 Interactome
Finally, to investigate the biological pathways involving CRM1, the CRM1 interactome was studied. In 2020, Miloudi et al. compared the interactome of WT and E571K CRM1 [33], while Kirli et al. had previously compared the interactome of CRM1 in S. cerevisiae, in Xenopus oocytes and in HeLa cells [69]. In this latter study, they found more than 700 cargoes in yeast, 1000 cargoes in Xenopus oocytes, and >1050 cargoes in HeLa cells. These results enrich the existing data concerning the link between CRM1 and the biogenesis of ribosomes, the export of regulatory proteins such as kinases, phosphatase, and the ubiquitin/proteasome system, autophagy, the regulation of centrosomes; they also highlight new links with vesicular assembly of secretory pathways, peroxisomes, and RNA metabolism. Interestingly, among the high-scoring cargoes, they identify factors involved in mRNA degradation, as well as components of P-bodies, suggesting a potential regulation of RNA metabolism. These cargoes are also found in Xenopus oocytes and S. cerevisiae, suggesting a conserved function of CRM1 [69].
mRNA export is a critical step of gene expression that is modulated by the incorporation of nuclear export adaptors in the mRNP at different steps of the RNA maturation [70]. For bulk mRNA, the heterodimer NXF1/NXT1 ultimately binds RNA and these adaptors in a cooperative manner to drive nuclear export through the NPC. However, for a subset of RNAs, the transit through the nuclear pore is dependent on the CRM1/RanGTP complex, instead. To do so, CRM1 relies on specific RNA-binding adaptors displaying NES. So far, four of them have been clearly identified: HuR (RNA-binding protein human antigen R), LRPPRC (leucine-rich pentatricopeptide repeat protein), NXF3 (nuclear export factor 3), and PHAX (phosphorylated adapter for RNA export). HuR binds mRNAs containing AU-rich elements (AREs): these AREs are found in the 3′UTR region of up to 22.4% of human mRNAs, including most inflammatory cytokines, interferons, and other transiently expressed chemokines genes [71,72,73]. On this topic, CRM1 is the nuclear export receptor required for the export of c-fos and Cox2 mRNA [73,74]. Direct evidence has also been reported for TNF-α, BIRC3, LTA, CD82, NINJ1, BCL2L1, and CD83 mRNA in activated lymphocytes specifically [75]. LRPPRC, in association with eIF4E, controls the export of mRNAs with 4E-SE sequences in their 3’UTR [76,77]. This eIF4E–4ESE-dependent export is involved in the regulation of cell proliferation, in particular with the export of cyclin D1 mRNA [78,79]. CRM1 interacts with NXF3 to export small nucleolar RNA (snoRNA) already associated with a large multiprotein complex [80] in response to stress conditions [81], as well as piRNA precursors (PIWI-interacting RNA small non-coding repressor RNAs) in Drosophila [82]. Interestingly, these adaptors of export are overexpressed in cancer cells, like CRM1, strengthening a particular link between mRNA export, CRM1 and oncogenesis [37]. Finally, CRM1-RanGTP interacts with PHAX to export small nuclear RNA (snRNA) precursors that are involved in mRNA splicing and rRNA and histone preRNA processing after maturation [5,83]. These precursors are hypermethylated in cytoplasm by a methylase exported by CRM1 and TGS1, as shown through a heterokaryon assay [84,85]. The characterization of CRM1 functions associated with snoRNA metabolism also reveals some export-independent functions; indeed, CRM1 can orchestrate pre-snoRNP remodeling and promote their nucleolar targeting: by removing the long isoform of TGS1 bound to the snoRNP, CRM1 activates the NoLS of the core snoRNP protein NOP58, leading to its nucleolar relocalization [86,87].
A number of other mRNAs, such as Interferon-alpha-1 (IFN-α1) and interleukin 6 (IL-6), are exported by CRM1, although no adapter is currently known [88,89]. IFN-α1 is expressed quickly after infection and plays a key role in innate defense against pathogens and almost every aspect of cellular and humoral adaptive immune responses. Similarly, IL-6 is a pleiotropic cytokine with a central role in the integrated immune defense network against infection. IFN-α1 transcripts are exported in a CRM1-dependent and HuR-independent manner and would rely on secondary structures present in the coding sequence [90,91]. Concerning IL-6 mRNA, the inhibition of its export by LMB treatment suggested the involvement of CRM1. After LPS stimulation, Arid5a (adenine-thymine (AT)-rich interactive domain 5a) binds to the stem loop structure in the 3′UTR of IL-6 mRNA and is exported with IL-6 mRNA. The absence of an identified NES in Arid5a implied the existence of another adapter. Interestingly, the authors observed that the RNA helicase UPF1, known as a CRM1 cargo, was exported with Arid5a/IL-6 mRNA as well [92]. However, proposing UPF1 as a new CRM1 adapter would require further investigation.
4. Viral Subversion of the CRM1 Function
As described before, CRM1 is a central factor controlling the flux between nucleus and cytoplasm. Viruses have developed strategies to exploit the cellular machinery, including the CRM1-dependent export, to allow replication and transmission. Among the studies reporting a viral hijacking of CRM1, we identified four main functions for CRM1 during the viral replication cycle (Figure 4): First, the selective export of viral RNA that relies on specific RNA-binding adaptors and allows the bypass of the canonical export pathway. Second, the adaptation of the cellular transport network to favor the viral components mobility and virus assembly. Only few examples have been reported so far, but they match with the function of CRM1 related to the organization of the cytoskeleton and centrosome. Third, the redistribution of host factors to promote viral replication; by interacting with CRM1, viral proteins are able to contact and control specific host proteins shuttling, redirecting them toward proviral activity. Fourth, several examples in the literature have described how viruses exploit CRM1 to access the NPC in order to modulate its composition, altering nucleocytoplasmic trafficking.
Figure 4.
Scheme summarizing the consequences of the viral hijacking of CRM1. (1) Upon viral infection, it is well described that CRM1 is hijacked to support vRNA export with a viral NES adaptor or with HuR. (2) The re-localization of cellular proteins is also described as a consequence of CRM1 hijacking, notably to the site of virus assembly or/and virus replication sites. (3) In HAdV, CRM1 plays a crucial role by enhancing the microtubule mediated transport of the virions to the nuclear membrane. (4) In some cases, CRM1 hijacking is involved in the alteration of the NPC composition, affecting the nucleocytoplasmic trafficking.
4.1. Viral Interference with the CRM1 Export Pathway
4.1.1. Drive of vRNA Export
Retroviral genomic information is contained in a single RNA that is reverse transcribed into DNA. This proviral DNA is then integrated in the host genome. In order to replicate, the complete proviral DNA sequence is transcribed, and the primary transcript (full length, vRNA) undergoes various splicing events. Viral RNAs are exported for protein synthesis. Notably, the unspliced viral RNAs (vRNAs) usually code structural proteins that have to be expressed in higher amounts. In addition, vRNA has to be encapsidated as is, to form mature and infectious viral particles. Thus, viral RNAs have to be efficiently exported and also need to avoid surveillance mechanisms that basically prevent the export of unspliced mRNA. To overcome these constraints, complex retroviruses bypass the usual NXF1/NXT1 mRNA export pathway and use the CRM1 export pathway, as shown for HIV-1 [6]. Most of the complex retroviruses can be characterized by the expression of an adapter protein dedicated to connect CRM1 and vRNA. Historically, the discovery of the viral hijacking of CRM1 by the retroviral protein Rev from HIV-1, played a key role in the deciphering of CRM1 mode of action and functions [7]. First, Rev binds RNA at the Rev-responsive element (RRE) in the middle of the Env coding exon [6,93]. The RRE is a highly structured RNA element of ~350-nt containing multiple binding sites for Rev (reviewed in [94]). It was shown that multiple molecules of Rev are recruited on the RRE in a specific and cooperative manner [95]. Second, Rev displays a leucine-rich sequence fitting the NES consensus and recognized by the exportin CRM1 [9,96]. Both proteins associate prior to or during early spliceosome assembly at the transcription sites. Third, the local concentration of Rev multimers stabilizes the Rev–CRM1 interaction and is correlated with viral mRNA export efficiency [97]. Like snRNA or snoRNA, unspliced or partially spliced HIV-1 mRNA harbor a trimethylguanosine (TMG)-cap catalyzed by the human methylase, PIMT (paralog of the yeast TGS1) in a Rev-dependent manner. The TMG-cap likely serves to direct these RNA to CRM1 export; it also inhibits cap exchange to eIF4E, favoring the specialized translation of HIV late mRNA [98,99].
Other complex retroviruses express Rev-like proteins and mimic this process; for instance, the Rem and Rex proteins from the betaretrovirus MMTV and the deltaretrovirus HTLV-1, respectively. Rex (the most-described retroviral adapter after Rev) displays NES, NLS and a dual multimerization domains like Rev, despite a globally low sequence homology with Rev (reviewed in [100]). While the overall mechanism of vRNA export is similar to that which is described for Rev, some divergences have been characterized: notably, it is accepted that Rex can interact with CRM1 as a monomer before multimerization and RNA [101,102]. The functional homology of these proteins even allowed the successful complementation of Rev- and Rem-deficient viruses with Rex [103]. Along the same lines, the Orthomyxoviridae influenza A virus (IAV –) is an RNA virus using CRM1 to export some of its RNA. The IAV nucleoprotein (IAV NP) coating vRNA to form vRNPs, accumulates in the nucleus after LMB treatments and in the cytoplasm after CRM1 overexpression [104,105]. In parallel, the viral nuclear export protein (NEP/NS2) and matrix (M1) protein also display several NES sequences, supporting a model in which vRNPs are exported in conjunction with NP, M1, and NEP. In this daisy-chain model, M1 acts as a bridge between the NP bound to RNA and NEP, while NEP is an adapter contacting CRM1 [106,107,108]. This RNA–M1–NEP–CRM1 complex is reminiscent of the jelly fish model described for Rev complexes.
Interestingly, foamy viruses (FVs) are complex retrovirus that do not encode Rev-like proteins to support vRNA export. FVs take advantage of the cell adapter, HuR, combined with ANP32A/B [109]. Crosslinking experiments revealed that the host protein HuR is co-recruited on the viral mRNP together with CRM1, but the targeted RNA sequence remains to be identified. Likewise, human Papillomaviruses (HPVs) late genes mRNA (L1 and L2) contain well defined AU-rich inhibitory elements, named h1ARE [110,111,112,113]. HuR binds these sequences and stimulates HPV-1 late gene expression in a CRM1-dependent pathway [114].
At last, some viruses hijack CRM1 to segregate subpopulations of the same RNA. The simple retrovirus Mason–Pfizer Monkey Virus (MPMV) illustrates that point: MPMV has well characterized cis-elements, called constitutive elements (CTEs), dedicated to the NXT1/NXF1 export. However, Mougel et al. showed that the RNA export pathway involved is dependent on the future of the vRNA molecule (translation or encapsidation); RNA imaging and export reporter assays demonstrated that NXF/NXT1 drives vRNA for translation, while the CRM1 pathway marks the MPMV RNA for packaging [115]. Naturally, the Psi sequence for packaging is critical in this process but the adapter is still unknown. Similarly, the Herpes virus hijacks CRM1 to selectively export its RNA. Illustrating this, HSV-1 has a nuclear replication cycle and needs to export vRNA in the cytoplasm for translation. It encodes ICP27 (infected cell culture protein 27), a shuttling RNA binding protein, that affects pre-mRNA processing. ICP27 is described to facilitate viral mRNA export via the RNA export REF and export receptor NXF1 [116,117]. However, it has also been reported that ICP27 contains a NES [118,119,120]. Soliman et al. demonstrated that the mutagenesis of ICP27 NES domain affects the virus growth and that LMB prevents ICP27 and vRNA cytoplasmic accumulation [121,122]. Thus, similarly to MPMV, HSV-1 exports some viral mRNAs using CRM1-independent pathway while other viral RNA are exported via a CRM1-dependent pathway. For adenovirus type5, it is admitted that the NXF1 complex is needed for viral late mRNA export [123], while one study showed that CRM1 is involved in viral early mRNA export [124], also illustrating a selective use of export pathways during infection.
Hepatitis virus (HBV) is another example of DNA virus that seem to use CRM1 to export encapsidated viral RNA (pgRNA). Yang et al. showed that when HBV core protein (HBc) assembles as a viral particle in the nucleus, it has multiple accessible NES domains. Those viral particles are filled with pgRNA and exported by CRM1 in the cytoplasm for genome maturation. CRM1 inhibitors treatments then significantly inhibit HBc export leading to a reduction in viral DNA synthesis. This alternative model of pgRNA encapsidation would occur in the early phases of infection, to the contrary of the late phase, when pgRNA export is NXF1-dependent [125]. This illustrates how the hijacking of CRM1 tightly controls vRNA export.
4.1.2. To Adapt the Transport Network to Favor Viral Components Mobility and Virus Assembly
Clear evidence exists to demonstrate how adenoviruses take advantage of CRM1 to precisely drive virions from cytoplasm to the nuclear membrane [126]. By combining high-resolution microscopy, live imaging, and machine learning, Wang et al. found that CRM1 inhibition increases the fraction of microtubule-dependent motion across the cell, preventing the unloading of virions around the nucleus [127]. It is suggested that CRM1 may bring a factor such as HDAC or AGTPB1/CCP1 to the nucleus proximal microtubules that could control the interaction between microtubules and motors. Ultimately, this would reduce the transport of cargoes such as adenoparticles and further deliver their genome in the nucleus. Recently, Lagadec et al. identified two new mutations CRM1 W142A and P143A that are compromised with respect to adenoviral capsid disassembly in both interphase and mitotic cells but remains export competent [128]. This revealed that viruses can take advantage of export-independent functions of CRM1 during viral infection.
4.1.3. To Control Host Factors Redistribution Promoting Viral Replication
As described before, CRM1 controls the localization of numerous proteins within the cell. Naturally, those factors are also important regulators of the viral replication and are often redistributed to favor specific steps of the viral life cycle. In line with this, several studies suggested that CRM1 hijacking could help forming a hub to come in contact or to better control the export of these nuclear partners of CRM1. Interestingly, this process is observed with viruses replicating in the nucleus as well as in the cytoplasm.
As discussed before, retroviruses hijack CMR1 with Rev-like proteins in the host nucleus to export vRNA. It is important to note that several other host proteins have been identified with this CRM1-Rev like-vRNA complex. For instance, the RNA helicase UPF1, STAU2, the RNA binding motif protein 14, eukaryotic initiation factor-5A, and the DEAD box RNA helicases DDX1, DDX3, and DDX5 are recruited on the vRNP with CRM1 and stimulate nuclear export [129,130,131,132,133,134,135,136,137,138,139]. Some of these factors, such as UPF1, were shown to exert additional proviral activities when associated with the vRNP: in HIV, it was suggested that UPF1 is incorporated in the viral particle to support reverse transcription functions in a newly infected cell [140]. In line with this, Prochasson et al. recently observed that the REX–CRM1 interaction is critical for the incorporation of UPF1 in the HTLV mRNP [129]. In the late steps of HTLV-1 replication, UPF1 is necessary for optimal RNA export, to control the maturation of structural proteins, and ultimately, to produce infectious virions.
The turnip mosaic virus (TuMV) is an ssRNA(+) virus whose replication occurs in cytoplasmic bound membrane complexes (viral replication centers—VRCs), adjacent to the nucleus. These complexes are composed of host factors as well as several viral proteins including the NIb protein. NIb is the viral RNA polymerase. It harbors 2 NES sequences in the RdRP domain and interacts with CRM1 [141]. Upon sumoylation, CRM1 exports NIb out of the nucleus where both factors participate in the formation of the VRCs [142]. The exact composition of the CRM1–NIb complex has not yet been investigated but may reveal the presence of numerous host factors also found at the VRC. Those results demonstrate that the interaction of viral protein with CRM1 also plays a critical role in the replication of plant virus.
The matrix protein (M) from the respiratory syncytial virus (RSV), an ssRNA(−) virus, is exported in a CRM-dependent manner to promote virions production [143]. Indeed, residues 194–206 from the RSV M protein fit the consensus to a NES. Likely favoring the interaction with CRM1 NES pocket, the phosphorylation of Threonine 205 by CK2 enhances M nuclear export. It is tempting to link the shuttling of M with an already known function of M in mediating the transport of vRNPs to assembly sites; although a direct connection with the known actin-driven transport by M has yet to be investigated, we may suspect this viral protein to redirect CRM1 functions associated with intracellular transport: indeed interactome studies highlighted a connection of CRM1 with cytoskeleton organization through interactions with septins and tubulin, as well as microtubule organization centers [60].
4.1.4. To Alter the Nuclear Pore Composition
Following the idea to control host factors localization, a large number of viruses directly target the Nups of the NPC. They act on the NPC permeability and affect the nucleocytoplasmic trafficking and to favor viral replication.
It was recently reported that CRM1 is concentrating host factors necessary for SARS-CoV-2 replication. In parallel, at least 7 SARS-CoV-2 viral proteins display a putative NES (Table 1). More specifically, it was observed that CRM1 directly affected the interaction between ORF6 from SARS-CoV-2 and NPC components like Rae1 or Nup98 [144,145]. This interaction with Rae1 and Nup98 is associated with mRNA accumulation the nucleus.
It also has been described and documented in detail how viral proteases could cleave the FG domains of Nups to open the pore. However, in these cases, there is no evidence of CRM1 involvement. Interestingly, the Cardioviruses (Picornaviridae) such as EMCV and TMEV, whose proteases are inactive, use the leader protein, L, to induce the hyperphosphorylation of NUP62/NUP153/NUP214 and Nup98 by specific kinases, such as ERK, RSK, and p38, to alter the pore functioning. Concomitantly, L was shown to interact with Ran and CRM1; size exclusion experiments suggested that a trimeric complex exists and CRM1 knockdown strongly diminished NUP62 phosphorylation in EMCV-infected cells [146,147]. Altogether, these data support the model that L drives the hyperphosphorylation of Nups by interacting with Ran, CRM1, and specific kinases [148]. In the case of picornaviruses, these alterations are likely to favor the recruitment of nuclear proteins in the cytoplasm to promote viral replication and/or translation; notably, it is reported that TMEV L protein induces the cytoplasmic mis localization of polypyrimidine tract binding (PTB), known to be essential for TMEV IRES-dependent translation initiation [149].
Table 1.
List of described viral proteins (viral family/virus name/viral proteins) exported/interacting via CRM1. When known, the NES sequence is indicated. NetNES1.1 is an online tool to predict NES (http://www.cbs.dtu.dk/, accessed on 1 July 2023). Hydrophobic acids are colored in red and when the sequence fit the consensus, the class (from [13]) is determined. The known functions/consequences of viral CRM1 hijacking on the host cell the host cell are briefly summarized.
Table 1.
List of described viral proteins (viral family/virus name/viral proteins) exported/interacting via CRM1. When known, the NES sequence is indicated. NetNES1.1 is an online tool to predict NES (http://www.cbs.dtu.dk/, accessed on 1 July 2023). Hydrophobic acids are colored in red and when the sequence fit the consensus, the class (from [13]) is determined. The known functions/consequences of viral CRM1 hijacking on the host cell the host cell are briefly summarized.
| Type of Genome | Family | Virus Name | Viral Protein | NES Sequence Hydrophobic Acids Are in Red | Effect of Nuclear Export on the Host Cell and/or Virus Cycle | References |
|---|---|---|---|---|---|---|
| ssRNA(+) | Retroviridae | Human immunodeficiency virus type 1 (HIV-1) | Rev | LQLPPLERLTLD Class 1b | Nuclear export of Rev is essential to support unspliced viral RNA export from nucleus. | [6,7] |
| Vpr | EAIIRILQQLLFI Class 1a-R | Nuclear export of Vpr is required for efficient replication. | [150] | |||
| Human T-cell leukemia virus type 1 (HTLV-1) | Tax | YKRIEELLYKISLTT Class 1a | N.D | [151] | ||
| Rex | ALSAQLYSSLSLDS Class 1c | Support CRM1-dependent export of the unspliced viral RNA. | [101,152] | |||
| HBz | MVNFVSVGLFRCLPVPCPEDLLVEELVDGLLSL | Nuclear export of HBZ is essential to regulate the mTOR signaling pathway via inhibition of GADD34 activity in the cytoplasm. | [153] | |||
| Mouse mammary tumor virus (MMTV) | Rem | N.D | Support CRM1-dependent export of the unspliced viral RNA. | [154] | ||
| Coronaviridae | SARS-CoV-2 | ORF9 | LALLSDLQDL Class 1b (putative NES) | N.D | NetNES 1.1 | |
| N (Nucleocapsid) | LLDRLNQL Class 1a (putative NES) | |||||
| S (Spike) | LEPLVDLPI Class 1b (putative NES) | |||||
| M (Matrix) | LESELVIGAVIL Class 1c (putative NES) | |||||
| E (Enveloppe) | LAILTALRL Class 1b (putative NES) | |||||
| ORF3a | VHFVCNLLL Class 1b (putative NES) | |||||
| NSP12 (RdRp) | LMIERFVSLAI Class 1b (putative NES) | |||||
| ORF6 | N.D | By interacting with Nup98/Ra1, ORF6 inhibits CRM1-dependent export of IRF-1 and RIG-I mRNA. | [155] | |||
| SARS-CoV | ORF3b | L-HKLLQTLVL Class 1c | Suppression of IFN I signaling (mitochondrial antiviral signaling—MAVS) | [156] | ||
| ORF9b | LRLGSQLSL Class 2 | Inhibition of apoptosis caspase-3 dependent. | [157] | |||
| Alphaviridae | Venezuelan Equine Encephalitis (VEE) | Capsid | TDPFLAMQVQELTRSMANLTFKQRRDAPPEGPSAKKPKK | N.D | [158] | |
| nsP2 | VREFGLDLDSGL Class 4 | N.D | [159] | |||
| Flaviviridae | Hepatitis C virus (HCV) | Core protein | LGKVIDTL Class 1d | N.D | [160] | |
| Dengue virus (DENV) | NS5 (RNA polymerase) | LLTKPWDIIPMVTQMAM Class 1a | Modulation of IL-8 production | [161] | ||
| Zika virus (ZIKV) | NS3 (protease) | TRVVAAEMEEALRGL Class 2 | N.D | [162] | ||
| Chikungunya virus (CHIKV) | Capsid | VKGTIDNADLAKLAF Class 1a | N.D | [163] | ||
| Potyviridae | Turnip Mosaic Virus (TuMV) | TuMV Nlb (RNA Polymerase) | YEYWWDTWADNWREW | Interaction between Nlb and CRM1 required to promote viral replication | [141] | |
| Picornaviridae | Cardiovirus | L protein | N.D | Alteration of nuclear pore complex homeostasis. | [147] | |
| Mengovirus | L protein | N.D | [164] | |||
| ssRNA(−) | Bornaviridae | Borna disease virus (BDV) | X protein | LRLTLLELVRRL Class 2 | Nuclear export of X protein is essential to mitochondrial localization of the viral protein. Mitochondrial localization required to its neuroprotective activity. | [165] |
| Orthomyxoviridae | Human parainfluenza 2 virus (HPIV-2) | P (Phosphoprotein) | IIELLKGLDL Class 1d | N.D | [166] | |
| Influenza A (IAV) | NP (Nucleoprotein) | Several sequences: MIDGIGRFYI Class 1b VKGVGTMVM Class 1b LIFLARSALIL | Support viral vRNP export. | [104] | ||
| NS2/NEP (Nuclear export Protein) | MITQFESAKA Class 1b | [167] | ||||
| M1 (Matrix) | ILGFVFTLTV Class 1b | [108] | ||||
| Influenza D (IDV) | NS2 | LVSLIRLKSKL Class 1d | [168] | |||
| Pneumoviridae | Respiratory Syncytial Virus (RSV) | M (Matrix protein) | IIPYSGLLLVITV | Support virus particle formation and vRNA export. CRM1-mediated nuclear export is critical to the infectious cycle of RSV. | [143] | |
| dsDNA | Herpesviridae | Cytomegalovirus (CMV) | Pp65 (Matrix protein) | NLVPMVATV | Support viral RNA export. Pp65 export is important for pp65 antigen presentation and CHD activation. | [169] |
| UL84 | Two independent NES: LSLNLFALRI LTLSSLTL Class 2 | Support viral RNA export. | [170] | |||
| UL94 | CILCQLLLLY | N.D | [171] | |||
| Kaposi’s sarcoma-associated herpesvirus (KHSV) | LANA 2 | MVP-LVIK-LRL Class 2 | Subcellular localization of LANA2 regulate p53 activity and apoptosis induction. LANA2 export regulate lytic viral cycle. | [172,173] | ||
| ORF45 | VLSQRIGLMDV | N.D | [174] | |||
| Herpes simplex virus type 1 (HSV-1) | pUL47 (Tegument protein) | IMSQFRKLLM Class 1b | pUL47 binds to RNA transcripts. | [175] | ||
| ICP27 | DMLIDLGLDLDL Class 2 | Export of ICP27 is crucial for viral production by playing a role in ICP4 expression, the mRNA export factor. | [121,176,177] | |||
| ICP34.5 | LPPRLALRLR | N.D | [178] | |||
| Bovine herpesvirus type-1 (BHV-1) | BICP27 (Bovin ICP27) | LEELCAARRLSL | N.D | [179] | ||
| Adenoviridae | Human Adenovirus tye-5 (HAdV-5) | E4 | MV--LTREELVI Class 1c | N.D | [180] | |
| E1A | VSQIFPDSVMLAVQEGIDLL Class 1b | N.D | [181] | |||
| E4orf6 | N.D | E4 is co-exported from nucleus with the complex HuR-mRNA (c-fos, c-myc, COX-2), increasing mRNA stability and inducing cell transformation. | [182,183] | |||
| Hepadnaviridae | Hepatite B virus (HBV) | HBx (Protein X) | QILPKVLHKRTLGLSAM | NES domain of HBx is associate with cytoplasmic retention of CRM1. | [184] | |
| HBc (Core protein) | Two sequences: WGELMTLATWVGNL Class 1a-R RDLVVSYVNTNMGL Class 1c or 1d | Interaction with CRM1 allowed HBC particles containing encapsidated viral RNAs. | [125] | |||
| Papillomaviridae | Human papillomavirus type 11 (HPV 11) | E1 | ISPRLDAIKL Class 1a | Nuclear export of E1 is necessary for long-term viral DNA maintenance and cell proliferation. | [185] | |
| E7 | IRQLQDLLL Class 1b | N.D | [186] | |||
| Human papillomavirus type 16 (HPV 16) | E7 | IRTLEDLLM Class 1b | N.D | [187] | ||
| Human papillomavirus type 8 (HPV 8) | E7 | IRTFQELL Class 3 | N.D | [188] | ||
| ssDNA | Parvoviridae | Murine minute virus (MVM) | NS2-P (non-structural protein 2) | MTKKFGTLTIHDTEKYASQPELCNN | Nuclear export of NS2-P is essential for proper viral production. | [18,189] |
| Anelloviridae | Chicken anemia virus (CAV) | VP1 (Nucleocapsid) | ELDTNFFTLYVAQG Class 1c-R | N.D | [190] |
Finally, the Hepatitis C virus (HCV), an ssRNA(+) with a cytoplasmic replication cycle, expresses a core protein (HCVc) that is localized in the cytoplasm and in the nucleus [159]. The domain responsible for an interaction with CRM1 is well-characterized and LMB treatments induced a nuclear retention of HCVc. Although LMB treatments in an HCV replicative cellular model also showed a decrease in the production and release of new viral particles, the underlying molecular mechanisms are yet to be clarified. It is possible that thanks to this shuttling, HCVc captures nuclear factors necessary for late steps of the infection or induces their re-localization. Supporting this, Boson et al. recently showed that the NPC component Nup98 is recruited by HCVc to viral assembly sites, a necessary step to locally increase the concentration of (+) RNA genome [191]. The common interaction of HCVc and CRM1 with Nup98 combined with the CRM1/HCVc association might help targeting the HCVc to Nup98.
4.2. Viral Interference of CRM1 to Modulate Cellular Pathways
As described previously, viruses exploit CRM1 in different steps of the viral replication, notably to support viral RNP export or to re-localize host factors to promote viral activities. There is much less evidence supporting that this hijacking, by competing with cellular cargoes, may also alter host biological processes. However, we know that the innate immune system activates signaling cascades that lead to the nuclear localization of interferon (IFN)-regulatory factors, such as IRF-3/7, NF-kB (p50/p65), STAT, and /or cGas to stimulate the expression of type I interferon and proinflammatory cytokines [192,193,194,195]. To maintain their signaling cascades actives, these regulators need to be exported back in the cytoplasm by CRM1. We also described above how CRM1 favors the cytoplasmic export and stabilization of IFN-I and cytokines mRNA, including IL-8, IL-6, TNF-α, COX-2, and many others. Here, we report the different studies that revealed a direct or indirect impact of CRM1 hijacking on the pathological phenotypes during infection.
4.2.1. Modulation of Immune and Antiviral Signaling
In cells overexpressing HIV-1 Rev, it has been monitored by ELISA that Rev reduced the nuclear export of human interferon-α1 (IFN-α1) [91]. This inhibition was reversed when Rev had a point mutation in its NES, suggesting that this effect on host mRNA export is the consequence of a competition between CRM1-dependent export for viral RNA and cellular mRNA and is consistent with the observation that CRM1 and Ran is a rate-limiting step in nuclear export. Along the same lines, the recruitment of SARS-CoV-2 ORF6 to the nuclear pore by CRM1 was shown to inhibit the export of many mRNA including those encoding antivirals factors such as IRF-1 and RIG-I, leading to the suppression of the antiviral response [155].
HBx protein is a known inhibitor of CRM1, as described before. Forgues et al. reported that its expression clearly modified the localization of NF-κB, inducing its nuclear retention, while HBx itself was essentially cytoplasmic. NES-mutated HBx was retained in the nucleus and the usual nucleocytoplasmic distribution of NF-κB was maintained. Thus, the hijacking of CRM1 seems to be directly involved in the deregulation of NF-κB. However, Forgues et al. found that this nuclear accumulation was associated with a NF-κB activation, while CRM1 inhibitors induced a nuclear retention of Iκ-Bα in the nucleus and p65 in a repressed complex, disrupting NF-κB signaling [184,196]. Lim et al. resolved this apparent paradox with the identification of a nuclear ternary complex composed of HBx/p22Flip/NEMO responsible for NF-κB activation [197]. This suggests that, despite HBx exerting multiple effects to maintain NF-κB activation, CRM1 hijacking by HBx clearly has a repressive action on NF-κB.
Several cytoplasmic-replicating RNA viruses harbor an intermediate of dsRNA during the life cycle. dsRNA is recognized as a PAMP and activates innate antiviral signaling. Indeed, this cytoplasmic dsRNA from pathogens are detected by retinoic-acid-inductile gene I (RIG-1). The mitochondrial antiviral signaling (MAVS) activates IRF-3 or NF-κB (p65/p30) and promotes their translocation to produce IFN-I and cytokines. SARS-CoV is threatened by this pathway. Freundt et al. observed, through confocal microscopy, that the SARS-CoV ORF3b protein has nuclear, cytoplasmic, and mitochondria localization in the cell. LMB treatments induce a nuclear retention of ORF3b and a reduction in mitochondria localization, suggesting that the CRM1-dependent export of ORF3b is needed for its mitochondrial targeting. By using an IRF3-inducible luciferase reporter assay, they found a decreased level of the IRF3-inducible reporter when ORF3b is located on mitochondria. In summary, SARS-CoV ORF3b is exported from the nucleus to the mitochondria via CRM1, leading to MAVS signaling inhibition [156].
4.2.2. Modulation of Pro-Oncogenic Cell Activity
In addition to subvert the host immune signaling, viruses such as oncovirus (but not exclusively) can specifically take control of the host pathways dedicated to proliferation and survival/apoptosis. Likewise, we reported before how CRM1 mutagenesis or overexpression was associated with cancer and recent studies have proposed that CRM1 cargoes are involved in 9 out of 10 cancer hallmark processes [42]. In 2019, Guven-maiorov et al. developed a computational method to predict host/microbes’ interactions (HMI) based on exogenous surface mimicking. With this tool, they analyze the HMIs of all oncoviral proteins with available 3D structure and investigated their impact on the cancer hallmark traits [198]. Even though the results were under-evaluated because of the lacking available structures of viral proteins, CRM1 was suggested as a target for several proteins of more than half of the oncovirus. This convergence, combined with the central place of CRM1 in non-viral-induced cancers, suggests that CRM1 alteration during infection may deregulate the signaling of some cancer hallmark process. However, few studies were interested in this aspect.
We can report the case of the oncogenic HBx (Hepatitis B) leading to hepatocytes transformation, during HBV infection. The oncoprotein HBx contains a functional NES domain that is necessary for its cytoplasmic localization [184]. The authors observed a cytoplasmic sequestration of CRM1 in HBx-overexpressing cells as well as in infected livers. This example is one of the rare that illustrates how a viral protein can force an overall abnormal localization of the exportin. Interestingly, they also observed centrosomal duplications that were directly dependent on CRM1 sequestration and inactivation by HBx [199]. Abnormal centrosomal duplications is a hallmark of cancer [200]. Mechanistically, these results fit with the role of CRM1 in regulating the formation of a bipolar spindle and centrosome [201]. Recently, Shi et al. found that HBx interacts with Smad4 and prevent the nuclear translocation of Smad2/3/4 leading to deprive activin antiproliferative activity. Indeed, as a part of activin signaling, Smad proteins works as an inhibitor of cell growth. This effect is CRM1-dependent and reversed upon LMB treatment. HBx, while inducing the cytoplasmic relocation of CRM1, prevents the continuous shuttling of these proteins necessary for their action. Although the exact underlying mechanism is still unknown, this illustrates the critical influence of CRM1 hijacking by a viral factor in the destabilization of the host homeostasis [202]. We reported before how HBx interaction with CRM1 also affects NF-κB activation. NF-κB is well known to control the expression of target genes, involved in tumor cell proliferation, survival, and angiogenesis; in line with this, NF-κB deregulation via the HBx/CRM1 axis could exert oncogenic effects.
It is noteworthy that examples also exist of an indirect alteration of CRM1 export by viral proteins inducing a modulation of oncogenic ARE-mRNA expression. This is the case of the adenovirus (dsDNA virus) E4orf6 protein that is not exported by CRM1, but displays a putative NES at its N-terminal extremity [203]. Higashino et al. demonstrated on transformed BRK cell lines that the N-terminal extremity of E4orf6 is responsible of a nuclear retention of pp32/LANP protein, involved in the HuR-mediated export of ARE-mRNA c-fos, c-myc, and COX-2. In addition, the oncodomain on the C-terminal extremity of E4orf6 can interact with pp32/LANP and restore its distribution as well as mRNA export after complexing with E1B-55K and HuR. However, this was possible even under LMB treatments, demonstrating that E4orf6 can inhibit CRM1 and favor a CRM1-independent export of ARE-mRNA, which are critical in the transformation of rodent immortalized cells [182]. Finally, Dobner’s group identified and characterized adenoviral E1B-55K shuttling via CRM1. Notably, they showed that E1B-55K SUMOylation, close to the NES, interferes with CRM1 binding. This leads to E1B-55K accumulation at the nuclear periphery, close to viral replication centers of infected cells and PML nuclear bodies in stably transformed rat cells. SUMO deconjugation then restores a competent CRM1-dependent export [204]. Interestingly, among E1B-55K many host interactors, p53 and Mre11 are exported in the cytoplasm for proteosomal degradation: this nucleocytoplasmic export and degradation by the E1B-55K/E4orf6-dependent E3 ubiquitin ligase was somehow affected by mutations of E1B-55K NES [205]. In transformed rat cells, this mutant exhibited increased tumorigenicity, indicating that E1B-55K-CRM1 interaction also controls oncogenic transformation by combinatorial mechanisms that involve the modulation of p53 in the context of PML nuclear bodies [206].
5. Discussion
In this review, we exhaustively listed viruses and viral proteins that contain NES. This reflects their need to frequently navigate between the nucleus and the cytoplasm. Among the many examples that we present here, it is clear that, beyond their cytoplasmic localization, the transit through the nucleus is essential to ensure efficient viral replication. It appears that CRM1 hijacking allows the shuttling of different types of viral materials, such as viral proteins and viral mRNPs, as well as allowing the formation of complex viral assemblies such as viral particles. Viruses also take advantage of the central place of CRM1 in the cell and its important interactome, to hijack or inhibit host cargoes. Surprisingly, the impact of CRM1 hijacking on cellular processes is much less documented. However, it seems that the export of RNAs encoding cytokines and interferon is altered in this process.
In line with these observations, CRM1 inhibitors (SINEs) were recently used as antiviral treatments (Figure 3); the SINE compound KPT-185 suppressed the expression of the intron containing late viral RNA species, displaying anti-HIV activity in primary cells [66]. Similarly, Verdinexor (KPT-335) administration showed an antiviral activity at tolerable dose range for dsDNA opportunistic viruses such as Epstein–Barr virus (EBV), human cytomegalovirus (HCMV), Kaposi’s sarcoma virus (KSHV), adenoviruses (AdV), BK virus (BKPyV), John Cunningham virus (JCPyV), and human papillomavirus (HPV), in vitro [65]. Strikingly, the team of Ralph. A. Tripp found that Verdinexor treatments could repress not only viral replication but also the proinflammatory cytokine production after RSV and IAV infections [63,64,207]. This was associated with a decrease in the viral dependent lung inflammation and the mortality rate in animal models. The capacity of CRM1 inhibitors to favor anti-inflammatory cytokines and downregulate pro-inflammatory cytokines production thus reduced the virus-associated immunopathology. In view of these observations on respiratory RNA virus, SARS-CoV-2 infection models were treated with Selinexor in vitro and in vivo. Kashyap et al. found that XPO1 inhibition leads to a reduction in viral replication and could be used as a prophylactic treatment. Moreover, a protective effect of CRM1 inhibition against the cytokine storm and the associated pathological changes in lung and nasal tissues was observed, as expected [62,208]. Currently, Selinexor is being evaluated in 2 phase II clinical trial, while Verdinexor showed positive results in a Phase I trial.
To conclude, it is interesting to note that a fine control of CRM1 in time and space could help controlling viral infection and its pathological effects: in the early stages of the infection, it is involved in the activation of the innate immune response, whereas in the next stages of the infection, it is hijacked by viruses and favors the viral replication. Finally, the modulation of CRM1 availability can dampen a further inflammatory overrun, responsible for virus associated immunopathology, at the root of the disease severity of respiratory infections.
Author Contributions
Conceptualization, M.M.-H., L.P. and V.M.; writing—original draft preparation, M.M.-H., L.P., P.J. and V.M.; writing—review and editing, M.M.-H., L.P., P.J. and V.M.; supervision, V.M. and P.J.; funding acquisition, M.M.-H., L.P. and V.M. All authors have read and agreed to the published version of the manuscript.
Funding
This work was supported by the Agence Nationale de Recherche contre le Sida (ANRS; grant number 2019-1 ECTZ89398) to L.P. Ecole Normale Supérieure de Lyon to M.M.-H. and la Ligue Nationale Contre le Cancer (NO. 8FI15706YHZD).
Acknowledgments
The authors acknowledge Figure 2 and Figure 4 were created with BioRender.com (accessed on 1 July 2023).
Conflicts of Interest
The authors declare no conflict of interest.
Abbreviations
| Kaps | Karyopherin |
| CRM1 | Chromosome Region Maintenance 1 |
| NPC | nuclear pore complex |
| SNUPN | Snuportin |
| LMB | Leptomycin B |
| NES | nuclear export signal |
| SINE | selective inhibitors of nuclear export |
| mRNP | messenger ribonucleo-particle |
| ARE | AU-rich element |
| 3′UTR | 3′ untranslated-region |
| IFN | interferon |
| IL | interleukine |
| vRNA | viral RNA |
| HIV-1 | human immunodeficiency virus type 1 |
| MMTV | mouse mammary tumor virus |
| HTLV-1 | human T-cell leukemia virus type 1 |
| NLS | nuclear localization signal |
| IAV | Influenza A virus |
| FV | foamy virus |
| MMPV | Mason–Pfizer Monkey Virus |
| HBV | Hepatitis B virus |
| TuMV | turnip mosaic virus |
| RSV | respiratory syncytial virus |
| SARS-CoV (-2) | severe acute respiratory syndrome coronavirus (-2) |
| EMCV | encephalomyocarditis virus |
| TMEV | Theiler’s murine encephalomyelitis virus |
| HCV | Hepatitis C virus |
| HAdV | human adenovirus |
| VEE | Venezuelan equine encephalitis virus |
| DEN | Dengue virus |
| CHIKV | Chikungunya virus |
| BDV | Borna disease virus |
| HPIV-2 | human parainfluenza virus |
| IDV | Influenza D virus |
| CMV | cytomegalovirus |
| KHSV | Kaposi’s sarcoma associated herpesvirus |
| HSV-1 | herpes simplex-virus type 1 |
| BHV-1 | bovine herpesvirus type 1 |
| HAdV | human adenovirus |
| CAV | chicken anemia virus |
| MVM | murine minute virus |
References
- Fung, H.Y.J.; Chook, Y.M. Atomic basis of CRM1-cargo recognition, release and inhibition. Semin. Cancer Biol. 2014, 27, 52–61. [Google Scholar] [CrossRef] [PubMed]
- Adachi, Y.; Yanagida, M. Higher order chromosome structure is affected by cold-sensitive mutations in a Schizosaccharomyces pombe gene crm1+ which encodes a 115-kD protein preferentially localized in the nucleus and its periphery. J. Cell Biol. 1989, 108, 1195–1207. [Google Scholar] [CrossRef] [PubMed]
- Stade, K.; Ford, C.S.; Guthrie, C.; Weis, K. Exportin 1 (Crm1p) Is an Essential Nuclear Export Factor. Cell 1997, 90, 1041–1050. [Google Scholar] [CrossRef]
- Fukuda, M.; Asano, S.; Nakamura, T.; Adachi, M.; Yoshida, M.; Yanagida, M.; Nishida, E. CRM1 is responsible for intracellular transport mediated by the nuclear export signal. Nature 1997, 390, 308–311. [Google Scholar] [CrossRef]
- Fornerod, M.; Ohno, M.; Yoshida, M.; Mattaj, I.W. CRM1 Is an Export Receptor for Leucine-Rich Nuclear Export Signals. Cell 1997, 90, 1051–1060. [Google Scholar] [CrossRef]
- Wolff, B.; Sanglier, J.-J.; Wang, Y. Leptomycin B is an inhibitor of nuclear export: Inhibition of nucleo-cytoplasmic translocation of the human immunodeficiency virus type 1 (HIV-1) Rev protein and Rev-dependent mRNA. Chem. Biol. 1997, 4, 139–147. [Google Scholar] [CrossRef]
- Neville, M.; Stutz, F.; Lee, L.; Davis, L.I.; Rosbash, M. The importin-beta family member Crm1p bridges the interaction between Rev and the nuclear pore complex during nuclear export. Curr. Biol. 1997, 7, 767–775. [Google Scholar] [CrossRef]
- Wing, C.E.; Fung, H.Y.J.; Chook, Y.M. Karyopherin-mediated nucleocytoplasmic transport. Nat. Rev. Mol. Cell Biol. 2022, 23, 307–328. [Google Scholar] [CrossRef]
- Cautain, B.; Hill, R.; de Pedro, N.; Link, W. Components and regulation of nuclear transport processes. FEBS J. 2015, 282, 445–462. [Google Scholar] [CrossRef]
- Fung, H.Y.J.; Fu, S.-C.; Chook, Y.M.; University of Texas Southwestern Medical Center USA. Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals. eLife 2017, 6, e23961. [Google Scholar] [CrossRef]
- Monecke, T.; Güttler, T.; Neumann, P.; Dickmanns, A.; Görlich, D.; Ficner, R. Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP. Science 2009, 324, 1087–1091. [Google Scholar] [CrossRef] [PubMed]
- Fu, S.-C.; Fung, H.Y.J.; Cağatay, T.; Baumhardt, J.; Chook, Y.M. Correlation of CRM1-NES affinity with nuclear export activity. Mol. Biol. Cell 2018, 29, 2037–2044. [Google Scholar] [CrossRef] [PubMed]
- Lee, Y.; Pei, J.; Baumhardt, J.M.; Chook, Y.M.; Grishin, N.V. Structural prerequisites for CRM1-dependent nuclear export signaling peptides: Accessibility, adapting conformation, and the stability at the binding site. Sci. Rep. 2019, 9, 6627. [Google Scholar] [CrossRef] [PubMed]
- Kehlenbach, R.H.; Dickmanns, A.; Gerace, L. Nucleocytoplasmic Shuttling Factors Including Ran and CRM1 Mediate Nuclear Export of NFAT In Vitro. J. Cell Biol. 1998, 141, 863–874. [Google Scholar] [CrossRef]
- Engelsma, D.; Bernad, R.; Calafat, J.; Fornerod, M. Supraphysiological nuclear export signals bind CRM1 independently of RanGTP and arrest at Nup358. EMBO J. 2004, 23, 3643–3652. [Google Scholar] [CrossRef]
- Monecke, T.; Haselbach, D.; Voß, B.; Russek, A.; Neumann, P.; Thomson, E.; Hurt, E.; Zachariae, U.; Stark, H.; Grubmüller, H.; et al. Structural basis for cooperativity of CRM1 export complex formation. Proc. Natl. Acad. Sci. USA 2012, 110, 960–965. [Google Scholar] [CrossRef]
- Güttler, T.; Madl, T.; Neumann, P.; Deichsel, D.; Corsini, L.; Monecke, T.; Ficner, R.; Sattler, M.; Görlich, D. NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1. Nat. Struct. Mol. Biol. 2010, 17, 1367–1376. [Google Scholar] [CrossRef]
- Dong, X.; Biswas, A.; Süel, K.E.; Jackson, L.K.; Martinez, R.; Gu, H.; Chook, Y.M. Structural basis for leucine-rich nuclear export signal recognition by CRM1. Nature 2009, 458, 1136–1141. [Google Scholar] [CrossRef]
- Güttler, T.; Görlich, D. Ran-dependent nuclear export mediators: A structural perspective. EMBO J. 2011, 30, 3457–3474. [Google Scholar] [CrossRef]
- Kaláb, P.; Pralle, A.; Isacoff, E.Y.; Heald, R.; Weis, K. Analysis of a RanGTP-regulated gradient in mitotic somatic cells. Nature 2006, 440, 697–701. [Google Scholar] [CrossRef]
- Petosa, C.; Schoehn, G.; Askjaer, P.; Bauer, U.; Moulin, M.; Steuerwald, U.; Soler-López, M.; Baudin, F.; Mattaj, I.W.; Müller, C.W. Architecture of CRM1/Exportin1 Suggests How Cooperativity Is Achieved during Formation of a Nuclear Export Complex. Mol. Cell 2004, 16, 761–775. [Google Scholar] [CrossRef]
- Kudo, N.; Wolff, B.; Sekimoto, T.; Schreiner, E.P.; Yoneda, Y.; Yanagida, M.; Horinouchi, S.; Yoshida, M. Leptomycin B Inhibition of Signal-Mediated Nuclear Export by Direct Binding to CRM1. Exp. Cell Res. 1998, 242, 540–547. [Google Scholar] [CrossRef]
- Dian, C.; Bernaudat, F.; Langer, K.; Oliva, M.F.; Fornerod, M.; Schoehn, G.; Müller, C.W.; Petosa, C. Structure of a Truncation Mutant of the Nuclear Export Factor CRM1 Provides Insights into the Auto-Inhibitory Role of Its C-Terminal Helix. Structure 2013, 21, 1338–1349. [Google Scholar] [CrossRef] [PubMed]
- Ferreira, B.I.; Cautain, B.; Grenho, I.; Link, W. Small Molecule Inhibitors of CRM1. Front. Pharmacol. 2020, 11, 625. [Google Scholar] [CrossRef] [PubMed]
- Martin, A.P.; Jacquemyn, M.; Lipecka, J.; Chhuon, C.; Aushev, V.N.; Meunier, B.; Singh, M.K.; Carpi, N.; Piel, M.; Codogno, P.; et al. STK 38 kinase acts as XPO 1 gatekeeper regulating the nuclear export of autophagy proteins and other cargoes. Embo Rep. 2019, 20, e48150. [Google Scholar] [CrossRef] [PubMed]
- Langer, K.; Dian, C.; Rybin, V.; Müller, C.W.; Petosa, C. Insights into the Function of the CRM1 Cofactor RanBP3 from the Structure of Its Ran-Binding Domain. PLoS ONE 2011, 6, e17011. [Google Scholar] [CrossRef] [PubMed]
- Ryan, K.J.; Wente, S.R. The nuclear pore complex: A protein machine bridging the nucleus and cytoplasm. Curr. Opin. Cell Biol. 2000, 12, 361–371. [Google Scholar] [CrossRef]
- Ritterhoff, T.; Das, H.; Hofhaus, G.; Schröder, R.R.; Flotho, A.; Melchior, F. The RanBP2/RanGAP1*SUMO1/Ubc9 SUMO E3 ligase is a disassembly machine for Crm1-dependent nuclear export complexes. Nat. Commun. 2016, 7, 11482. [Google Scholar] [CrossRef]
- Bley, C.J.; Nie, S.; Mobbs, G.W.; Petrovic, S.; Gres, A.T.; Liu, X.; Mukherjee, S.; Harvey, S.; Huber, F.M.; Lin, D.H.; et al. Architecture of the cytoplasmic face of the nuclear pore. Science 2022, 376, eabm9129. [Google Scholar] [CrossRef]
- Azizian, N.G.; Li, Y. XPO1-dependent nuclear export as a target for cancer therapy. J. Hematol. Oncol. 2020, 13, 61. [Google Scholar] [CrossRef]
- Taylor, J.; Sendino, M.; Gorelick, A.N.; Pastore, A.; Chang, M.T.; Penson, A.V.; Gavrila, E.I.; Stewart, C.; Melnik, E.M.; Chavez, F.H.; et al. Altered Nuclear Export Signal Recognition as a Driver of Oncogenesis. Cancer Discov. 2019, 9, 1452–1467. [Google Scholar] [CrossRef] [PubMed]
- Puente, X.S.; Pinyol, M.; Quesada, V.; Conde, L.; Ordóñez, G.R.; Villamor, N.; Escaramis, G.; Jares, P.; Beà, S.; González-Díaz, M.; et al. Whole-genome sequencing identifies recurrent mutations in chronic lymphocytic leukaemia. Nature 2011, 475, 101–105. [Google Scholar] [CrossRef] [PubMed]
- Miloudi, H.; Bohers, É.; Guillonneau, F.; Taly, A.; Gibouin, V.C.; Viailly, P.-J.; Jego, G.; Grumolato, L.; Jardin, F.; Sola, B. XPO1E571K Mutation Modifies Exportin 1 Localisation and Interactome in B-Cell Lymphoma. Cancers 2020, 12, 2829. [Google Scholar] [CrossRef] [PubMed]
- Baumhardt, J.M.; Walker, J.S.; Lee, Y.; Shakya, B.; Brautigam, C.A.; Lapalombella, R.; Grishin, N.; Chook, Y.M. Recognition of nuclear export signals by CRM1 carrying the oncogenic E571K mutation. Mol. Biol. Cell 2020, 31, 1879–1891. [Google Scholar] [CrossRef]
- Räsch, F.; Weber, R.; Izaurralde, E.; Igreja, C. 4E-T-bound mRNAs are stored in a silenced and deadenylated form. Genes Dev. 2020, 34, 847–860. [Google Scholar] [CrossRef]
- Arnaoutov, A.; Azuma, Y.; Ribbeck, K.; Joseph, J.; Boyarchuk, Y.; Karpova, T.; McNally, J.; Dasso, M. Crm1 is a mitotic effector of Ran-GTP in somatic cells. Nat. Cell Biol. 2005, 7, 626–632. [Google Scholar] [CrossRef]
- Siddiqui, N.; Borden, K.L.B. mRNA export and cancer. Wiley Interdiscip. Rev. RNA 2012, 3, 13–25. [Google Scholar] [CrossRef]
- Yue, L.; Sun, Z.; Yao, Y.; Shen, Z.; Wang, H.; Liu, X.; Zhou, F.; Xiang, J.; Yao, R.; Niu, H. CRM1, a novel independent prognostic factor overexpressed in invasive breast carcinoma of poor prognosis. Oncol. Lett. 2018, 15, 7515–7522. [Google Scholar] [CrossRef]
- Gao, W.; Lu, C.; Chen, L.; Keohavong, P. Overexpression of CRM1: A Characteristic Feature in a Transformed Phenotype of Lung Carcinogenesis and a Molecular Target for Lung Cancer Adjuvant Therapy. J. Thorac. Oncol. Off. Publ. Int. Assoc. Study Lung Cancer 2015, 10, 815–825. [Google Scholar] [CrossRef]
- Liu, S.; Wang, S.; Gu, R.; Che, N.; Wang, J.; Cheng, J.; Yuan, Z.; Cheng, Y.; Liao, Y. The XPO1 Inhibitor KPT-8602 Ameliorates Parkinson’s Disease by Inhibiting the NF-κB/NLRP3 Pathway. Front. Pharmacol. 2022, 13, 847605. [Google Scholar] [CrossRef]
- Nakashima, A.; Cheng, S.-B.; Ikawa, M.; Yoshimori, T.; Huber, W.J.; Menon, R.; Huang, Z.; Fierce, J.; Padbury, J.F.; Sadovsky, Y.; et al. Evidence for lysosomal biogenesis proteome defect and impaired autophagy in preeclampsia. Autophagy 2019, 16, 1771–1785. [Google Scholar] [CrossRef] [PubMed]
- Sun, Q.; Chen, X.; Zhou, Q.; Burstein, E.; Yang, S.; Jia, D. Inhibiting cancer cell hallmark features through nuclear export inhibition. Signal Transduct. Target. Ther. 2016, 1, 16010. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Zhang, H.; Na, L.; Du, C.; Zhang, Z.; Zheng, Y.-H.; Wang, X. ANP32A and ANP32B are key factors in the Rev-dependent CRM1 pathway for nuclear export of HIV-1 unspliced mRNA. J. Biol. Chem. 2019, 294, 15346–15357. [Google Scholar] [CrossRef] [PubMed]
- Gravina, G.L.; Senapedis, W.; McCauley, D.; Baloglu, E.; Shacham, S.; Festuccia, C. Nucleo-cytoplasmic transport as a therapeutic target of cancer. J. Hematol. Oncol. 2014, 7, 85. [Google Scholar] [CrossRef]
- Mathew, C.; Ghildyal, R. CRM1 Inhibitors for Antiviral Therapy. Front. Microbiol. 2017, 8, 1171. [Google Scholar] [CrossRef] [PubMed]
- García-Aguirre, I.; Alamillo-Iniesta, A.; Rodríguez-Pérez, R.; Vélez-Aguilera, G.; Amaro-Encarnación, E.; Jiménez-Gutiérrez, E.; Vásquez-Limeta, A.; Laredo-Cisneros, M.S.; Morales-Lázaro, S.L.; Tiburcio-Félix, R.; et al. Enhanced nuclear protein export in premature aging and rescue of the progeria phenotype by modulation of CRM1 activity. Aging Cell 2019, 18, e13002. [Google Scholar] [CrossRef]
- Gorostieta-Salas, E.; Moreno-Blas, D.; Gerónimo-Olvera, C.; Cisneros, B.; Court, F.A.; Castro-Obregón, S. Enhanced Activity of Exportin-1/CRM1 in Neurons Contributes to Autophagy Dysfunction and Senescent Features in Old Mouse Brain. Oxidative Med. Cell. Longev. 2021, 2021, 6682336. [Google Scholar] [CrossRef]
- Hamamoto, T.; Seto, H.; Beppu, T. Leptomycins A and B, new antifungal antibiotics. II. Structure elucidation. J. Antibiot. 1983, 36, 646–650. [Google Scholar] [CrossRef]
- Liu, X.; Chong, Y.; Liu, H.; Han, Y.; Niu, M. Novel reversible selective inhibitor of CRM1 for targeted therapy in ovarian cancer. J. Ovarian Res. 2015, 8, 35. [Google Scholar] [CrossRef]
- Sun, Q.; Carrasco, Y.P.; Hu, Y.; Guo, X.; Mirzaei, H.; MacMillan, J.; Chook, Y.M. Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1. Proc. Natl. Acad. Sci. USA 2013, 110, 1303–1308. [Google Scholar] [CrossRef]
- Wang, A.Y.; Liu, H. The past, present, and future of CRM1/XPO1 inhibitors. Stem Cell Investig. 2019, 6, 6. [Google Scholar] [CrossRef] [PubMed]
- Tang, T.; Martin, P.; Somasundaram, N.; Lim, C.; Tao, M.; Poon, E.; Yunon, M.J.; Toh, S.Q.; Yan, S.X.; Farid, M.; et al. Phase I study of selinexor in combination with dexamethasone, ifosfamide, carboplatin, etoposide chemotherapy in patients with relapsed or refractory peripheral T-cell or natural-killer/T-cell lymphoma. Haematologica 2020, 106, 3170–3175. [Google Scholar] [CrossRef]
- Stephens, D.M.; Huang, Y.; Ruppert, A.S.; Walker, J.S.; Canfield, D.; Cempre, C.B.; Fu, Q.; Baker, S.; Hu, B.; Shah, H.; et al. Selinexor Combined with Ibrutinib Demonstrates Tolerability and Safety in Advanced B-Cell Malignancies: A Phase I Study. Clin. Cancer Res. Off. J. Am. Assoc. Cancer Res. 2022, 28, 3242–3247. [Google Scholar] [CrossRef]
- Lassman, A.B.; Wen, P.Y.; Bent, M.J.v.D.; Plotkin, S.R.; Walenkamp, A.M.; Green, A.L.; Li, K.; Walker, C.J.; Chang, H.; Tamir, S.; et al. A Phase II Study of the Efficacy and Safety of Oral Selinexor in Recurrent Glioblastoma. Clin. Cancer Res. Off. J. Am. Assoc. Cancer Res. 2022, 28, 452–460. [Google Scholar] [CrossRef] [PubMed]
- Kalakonda, N.; Maerevoet, M.; Cavallo, F.; Follows, G.; Goy, A.; Vermaat, J.S.P.; Casasnovas, O.; Hamad, N.; Zijlstra, J.M.; Bakhshi, S.; et al. Selinexor in patients with relapsed or refractory diffuse large B-cell lymphoma (SADAL): A single-arm, multinational, multicentre, open-label, phase 2 trial. Lancet Haematol. 2020, 7, e511–e522. [Google Scholar] [CrossRef] [PubMed]
- Chanukuppa, V.; Paul, D.; Taunk, K.; Chatterjee, T.; Sharma, S.; Kumar, S.; Santra, M.K.; Rapole, S. XPO1 is a critical player for bortezomib resistance in multiple myeloma: A quantitative proteomic approach. J. Proteomics 2019, 209, 103504. [Google Scholar] [CrossRef] [PubMed]
- Turner, J.G.; Kashyap, T.; Dawson, J.L.; Gomez, J.; Bauer, A.A.; Grant, S.; Dai, Y.; Shain, K.H.; Meads, M.; Landesman, Y.; et al. XPO1 inhibitor combination therapy with bortezomib or carfilzomib induces nuclear localization of IκBα and overcomes acquired proteasome inhibitor resistance in human multiple myeloma. Oncotarget 2016, 7, 78896–78909. [Google Scholar] [CrossRef] [PubMed]
- Wu, M.; Gui, H.; Feng, Z.; Xu, H.; Li, G.; Li, M.; Chen, T.; Wu, Y.; Huang, J.; Bai, Z.; et al. KPT-330, a potent and selective CRM1 inhibitor, exhibits anti-inflammation effects and protection against sepsis. Biochem. Biophys. Res. Commun. 2018, 503, 1773–1779. [Google Scholar] [CrossRef]
- Pickens, J.A.; Tripp, R.A. Verdinexor Targeting of CRM1 is a Promising Therapeutic Approach against RSV and Influenza Viruses. Viruses 2018, 10, 48. [Google Scholar] [CrossRef]
- Tajiri, N.; De La Peña, I.; Acosta, S.A.; Kaneko, Y.; Tamir, S.; Landesman, Y.; Carlson, R.; Shacham, S.; Borlongan, C.V. A Nuclear Attack on Traumatic Brain Injury: Sequestration of Cell Death in the Nucleus. CNS Neurosci. Ther. 2016, 22, 306–315. [Google Scholar] [CrossRef][Green Version]
- Shaikhqasem, A.; Dickmanns, A.; Neumann, P.; Ficner, R. Characterization of Inhibition Reveals Distinctive Properties for Human and Saccharomyces cerevisiae CRM1. J. Med. Chem. 2020, 63, 7545–7558. [Google Scholar] [CrossRef] [PubMed]
- Walker, J.S.; Hing, Z.A.; Harrington, B.; Baumhardt, J.; Ozer, H.G.; Lehman, A.; Giacopelli, B.; Beaver, L.; Williams, K.; Skinner, J.N.; et al. Recurrent XPO1 mutations alter pathogenesis of chronic lymphocytic leukemia. J. Hematol. Oncol. 2021, 14, 1–21. [Google Scholar] [CrossRef] [PubMed]
- Kudo, N.; Matsumori, N.; Taoka, H.; Fujiwara, D.; Schreiner, E.P.; Wolff, B.; Yoshida, M.; Horinouchi, S. Leptomycin B inactivates CRM1/exportin 1 by covalent modification at a cysteine residue in the central conserved region. Proc. Natl. Acad. Sci. USA 1999, 96, 9112–9117. [Google Scholar] [CrossRef] [PubMed]
- Kashyap, T.; Murray, J.; Walker, C.J.; Chang, H.; Tamir, S.; Hou, B.; Shacham, S.; Kauffman, M.G.; Tripp, R.A.; Landesman, Y. Selinexor, a novel selective inhibitor of nuclear export, reduces SARS-CoV-2 infection and protects the respiratory system in vivo. Antivir. Res. 2021, 192, 105115. [Google Scholar] [CrossRef]
- Jorquera, P.A.; Mathew, C.; Pickens, J.; Williams, C.; Luczo, J.M.; Tamir, S.; Ghildyal, R.; Tripp, R.A. Verdinexor (KPT-335), a Selective Inhibitor of Nuclear Export, Reduces Respiratory Syncytial Virus Replication In Vitro. J. Virol. 2019, 93, e01684-18. [Google Scholar] [CrossRef]
- Perwitasari, O.; Johnson, S.; Yan, X.; Howerth, E.; Shacham, S.; Landesman, Y.; Baloglu, E.; McCauley, D.; Tamir, S.; Tompkins, S.M.; et al. Verdinexor, a Novel Selective Inhibitor of Nuclear Export, Reduces Influenza A Virus Replication In Vitro and In Vivo. J. Virol. 2014, 88, 10228–10243. [Google Scholar] [CrossRef]
- Widman, D.G.; Gornisiewicz, S.; Shacham, S.; Tamir, S. In vitro toxicity and efficacy of verdinexor, an exportin 1 inhibitor, on opportunistic viruses affecting immunocompromised individuals. PLoS ONE 2018, 13, e0200043. [Google Scholar] [CrossRef]
- Boons, E.; Vanstreels, E.; Jacquemyn, M.; Nogueira, T.C.; Neggers, J.E.; Vercruysse, T.; Oord, J.v.D.; Tamir, S.; Shacham, S.; Landesman, Y.; et al. Human Exportin-1 is a Target for Combined Therapy of HIV and AIDS Related Lymphoma. EBioMedicine 2015, 2, 1102–1113. [Google Scholar] [CrossRef]
- Kırlı, K.; Karaca, S.; Dehne, H.J.; Samwer, M.; Pan, K.T.; Lenz, C.; Urlaub, H.; Görlich, D. A deep proteomics perspective on CRM1-mediated nuclear export and nucleocytoplasmic partitioning. eLife 2015, 4, e11466. [Google Scholar] [CrossRef]
- Hautbergue, G.M.; Hung, M.-L.; Golovanov, A.P.; Lian, L.-Y.; Wilson, S.A. Mutually exclusive interactions drive handover of mRNA from export adaptors to TAP. Proc. Natl. Acad. Sci. USA 2008, 105, 5154–5159. [Google Scholar] [CrossRef]
- Bakheet, T.; Khabar, K.S.A.; Hitti, E.G. Differential upregulation of AU-rich element-containing mRNAs in COVID-19. Hum. Genom. 2022, 16, 59. [Google Scholar] [CrossRef] [PubMed]
- Lourou, N.; Gavriilidis, M.; Kontoyiannis, D.L. Lessons from studying the AU-rich elements in chronic inflammation and autoimmunity. J. Autoimmun. 2019, 104, 102334. [Google Scholar] [CrossRef]
- Brennan, C.M.; Gallouzi, I.-E.; Steitz, J.A. Protein Ligands to Hur Modulate Its Interaction with Target Mrnas in Vivo. J. Cell Biol. 2000, 151, 1–14. [Google Scholar] [CrossRef] [PubMed]
- Jang, B.-C.; Muñoz-Najar, U.; Paik, J.-H.; Claffey, K.; Yoshida, M.; Hla, T. Leptomycin B, an Inhibitor of the Nuclear Export Receptor CRM1, Inhibits COX-2 Expression. J. Biol. Chem. 2003, 278, 2773–2776. [Google Scholar] [CrossRef] [PubMed]
- Schütz, S.; Chemnitz, J.; Spillner, C.; Frohme, M.; Hauber, J.; Kehlenbach, R.H. Stimulated Expression of mRNAs in Activated T Cells Depends on a Functional CRM1 Nuclear Export Pathway. J. Mol. Biol. 2006, 358, 997–1009. [Google Scholar] [CrossRef][Green Version]
- Scott, D.D.; Aguilar, L.C.; Kramar, M.; Oeffinger, M. It’s Not the Destination, It’s the Journey: Heterogeneity in mRNA Export Mechanisms. Adv. Exp. Med. Biol. 2019, 1203, 33–81. [Google Scholar] [CrossRef]
- Osborne, M.J.; Borden, K.L.B. The eukaryotic translation initiation factor eIF4E in the nucleus: Taking the road less traveled. Immunol. Rev. 2015, 263, 210–223. [Google Scholar] [CrossRef]
- Culjkovic, B.; Topisirovic, I.; Skrabanek, L.; Ruiz-Gutierrez, M.; Borden, K.L. eIF4E is a central node of an RNA regulon that governs cellular proliferation. J. Cell Biol. 2006, 175, 415–426. [Google Scholar] [CrossRef]
- Culjkovic, B.; Topisirovic, I.; Borden, K.L. Controlling Gene Expression through RNA Regulons: The Role of the Eukaryotic Translation Initiation Factor eIF4E. Cell Cycle 2007, 6, 65–69. [Google Scholar] [CrossRef]
- Watkins, N.J.; Lemm, I.; Ingelfinger, D.; Schneider, C.; Hoßbach, M.; Urlaub, H.; Lührmann, R. Assembly and Maturation of the U3 SnoRNP in the Nucleoplasm in a Large Dynamic Multiprotein Complex. Mol. Cell 2004, 16, 789–798. [Google Scholar] [CrossRef]
- Li, M.W.; Sletten, A.C.; Lee, J.; Pyles, K.D.; Matkovich, S.J.; Ory, D.S.; Schaffer, J.E. Nuclear export factor 3 regulates localization of small nucleolar RNAs. J. Biol. Chem. 2017, 292, 20228–20239. [Google Scholar] [CrossRef] [PubMed]
- ElMaghraby, M.F.; Andersen, P.R.; Pühringer, F.; Hohmann, U.; Meixner, K.; Lendl, T.; Tirian, L.; Brennecke, J. A Heterochromatin-Specific RNA Export Pathway Facilitates piRNA Production. Cell 2019, 178, 964–979. [Google Scholar] [CrossRef] [PubMed]
- Ohno, M.; Segref, A.; Bachi, A.; Wilm, M.; Mattaj, I.W. PHAX, a Mediator of U snRNA Nuclear Export Whose Activity Is Regulated by Phosphorylation. Cell 2000, 101, 187–198. [Google Scholar] [CrossRef]
- Verheggen, C.; Bertrand, E. CRM1 plays a nuclear role in transporting snoRNPs to nucleoli in higher eukaryotes. Nucleus 2012, 3, 132–137. [Google Scholar] [CrossRef]
- Mouaikel, J.; Narayanan, U.; Verheggen, C.; Matera, A.G.; Bertrand, E.; Tazi, J.; Bordonné, R. Interaction between the small-nuclear-RNA cap hypermethylase and the spinal muscular atrophy protein, survival of motor neuron. EMBO Rep. 2003, 4, 616–622. [Google Scholar] [CrossRef] [PubMed]
- Pradet-Balade, B.; Girard, C.; Boulon, S.; Paul, C.; Azzag, K.; Bordonné, R.; Bertrand, E.; Verheggen, C. CRM1 controls the composition of nucleoplasmic pre-snoRNA complexes to licence them for nucleolar transport. EMBO J. 2011, 30, 2205–2218. [Google Scholar] [CrossRef]
- Boulon, S.; Verheggen, C.; Jady, B.E.; Girard, C.; Pescia, C.; Paul, C.; Ospina, J.K.; Kiss, T.; Matera, A.; Bordonné, R.; et al. PHAX and CRM1 Are Required Sequentially to Transport U3 snoRNA to Nucleoli. Mol. Cell 2004, 16, 777–787. [Google Scholar] [CrossRef]
- Okamura, M.; Inose, H.; Masuda, S. RNA Export through the NPC in Eukaryotes. Genes 2015, 6, 124–149. [Google Scholar] [CrossRef]
- Hutten, S.; Kehlenbach, R.H. CRM1-mediated nuclear export: To the pore and beyond. Trends Cell Biol. 2007, 17, 193–201. [Google Scholar] [CrossRef]
- Kimura, T.; Hashimoto, I.; Nishizawa, M.; Ito, S.; Yamada, H. Novel cis-active structures in the coding region mediate CRM1-dependent nuclear export of IFN-α 1 mRNA. Med. Mol. Morphol. 2010, 43, 145–157. [Google Scholar] [CrossRef]
- Kimura, T.; Hashimoto, I.; Nagase, T.; Fujisawa, J.-I. CRM1-dependent, but not ARE-mediated, nuclear export of IFN-α1 mRNA. J. Cell Sci. 2004, 117, 2259–2270. [Google Scholar] [CrossRef] [PubMed]
- Higa, M.; Oka, M.; Fujihara, Y.; Masuda, K.; Yoneda, Y.; Kishimoto, T. Regulation of inflammatory responses by dynamic subcellular localization of RNA-binding protein Arid5a. Proc. Natl. Acad. Sci. USA 2018, 115, E1214–E1220. [Google Scholar] [CrossRef] [PubMed]
- Malim, M.H.; Hauber, J.; Le, S.-Y.; Maizel, J.V.; Cullen, B.R. The HIV-1 rev trans-activator acts through a structured target sequence to activate nuclear export of unspliced viral mRNA. Nature 1989, 338, 254–257. [Google Scholar] [CrossRef] [PubMed]
- Fernandes, J.; Jayaraman, B.; Frankel, A. The HIV-1 Rev response element: An RNA scaffold that directs the cooperative assembly of a homo-oligomeric ribonucleoprotein complex. RNA Biol. 2012, 9, 6–11. [Google Scholar] [CrossRef]
- Malim, M.H.; Cullen, B.R. HIV-1 structural gene expression requires the binding of multiple Rev monomers to the viral RRE: Implications for HIV-1 latency. Cell 1991, 65, 241–248. [Google Scholar] [CrossRef]
- Malim, M.H.; Böhnlein, S.; Hauber, J.; Cullen, B.R. Functional dissection of the HIV-1 Rev trans-activator—Derivation of a trans-dominant repressor of Rev function. Cell 1989, 58, 205–214. [Google Scholar] [CrossRef]
- Edgcomb, S.P.; Aschrafi, A.; Kompfner, E.; Williamson, J.R.; Gerace, L.; Hennig, M. Protein structure and oligomerization are important for the formation of export-competent HIV-1 Rev-RRE complexes. Protein Sci. Publ. Protein Soc. 2008, 17, 420–430. [Google Scholar] [CrossRef]
- Yedavalli, V.S.R.K.; Jeang, K.-T. Trimethylguanosine capping selectively promotes expression of Rev-dependent HIV-1 RNAs. Proc. Natl. Acad. Sci. USA 2010, 107, 14787–14792. [Google Scholar] [CrossRef]
- Singh, G.; Seufzer, B.; Song, Z.; Zucko, D.; Heng, X.; Boris-Lawrie, K. HIV-1 hypermethylated guanosine cap licenses specialized translation unaffected by mTOR. Proc. Natl. Acad. Sci. USA 2022, 119, e2105153118. [Google Scholar] [CrossRef]
- Nakano, K.; Watanabe, T. HTLV-1 Rex Tunes the Cellular Environment Favorable for Viral Replication. Viruses 2016, 8, 58. [Google Scholar] [CrossRef]
- Hakata, Y.; Umemoto, T.; Matsushita, S.; Shida, H. Involvement of Human CRM1 (Exportin 1) in the Export and Multimerization of the Rex Protein of Human T-Cell Leukemia Virus Type 1. J. Virol. 1998, 72, 6602–6607. [Google Scholar] [CrossRef] [PubMed]
- Hakata, Y.; Yamada, M.; Shida, H. A Multifunctional Domain in Human CRM1 (Exportin 1) Mediates RanBP3 Binding and Multimerization of Human T-Cell Leukemia Virus Type 1 Rex Protein. Mol. Cell. Biol. 2003, 23, 8751–8761. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Mertz, J.A.; Lozano, M.M.; Dudley, J.P. Rev and Rex proteins of human complex retroviruses function with the MMTV Rem-responsive element. Retrovirology 2009, 6, 10. [Google Scholar] [CrossRef] [PubMed]
- Elton, D.; Simpson-Holley, M.; Archer, K.; Medcalf, L.; Hallam, R.; McCauley, J.; Digard, P. Interaction of the Influenza Virus Nucleoprotein with the Cellular CRM1-Mediated Nuclear Export Pathway. J. Virol. 2001, 75, 408–419. [Google Scholar] [CrossRef]
- Watanabe, K.; Takizawa, N.; Katoh, M.; Hoshida, K.; Kobayashi, N.; Nagata, K. Inhibition of nuclear export of ribonucleoprotein complexes of influenza virus by leptomycin B. Virus Res. 2001, 77, 31–42. [Google Scholar] [CrossRef]
- O’Neill, R.E.; Talon, J.; Palese, P. The influenza virus NEP (NS2 protein) mediates the nuclear export of viral ribonucleoproteins. EMBO J. 1998, 17, 288–296. [Google Scholar] [CrossRef]
- Bui, M.; Wills, E.G.; Helenius, A.; Whittaker, G.R. Role of the Influenza Virus M1 Protein in Nuclear Export of Viral Ribonucleoproteins. J. Virol. 2000, 74, 1781–1786. [Google Scholar] [CrossRef]
- Cao, S.; Liu, X.; Yu, M.; Li, J.; Jia, X.; Bi, Y.; Sun, L.; Gao, G.F.; Liu, W. A Nuclear Export Signal in the Matrix Protein of Influenza A Virus Is Required for Efficient Virus Replication. J. Virol. 2012, 86, 4883–4891. [Google Scholar] [CrossRef]
- Bodem, J.; Schied, T.; Gabriel, R.; Rammling, M.; Rethwilm, A. Foamy Virus Nuclear RNA Export Is Distinct from That of Other Retroviruses. J. Virol. 2011, 85, 2333–2341. [Google Scholar] [CrossRef]
- Sokolowski, M.; Tan, W.; Jellne, M.; Schwartz, S. mRNA Instability Elements in the Human Papillomavirus Type 16 L2 Coding Region. J. Virol. 1998, 72, 1504–1515. [Google Scholar] [CrossRef]
- Schwartz, S. Cis-Acting Negative RNA Elements on Papillomavirus Late mRNAs. Semin. Virol. 1998, 8, 291–300. [Google Scholar] [CrossRef]
- Sokolowski, M.; Zhao, C.; Tan, W.; Schwartz, S. AU-rich mRNA instability elements on human papillomavirus type 1 late mRNAs and c-fos mRNAs interact with the same cellular factors. Oncogene 1997, 15, 2303–2319. [Google Scholar] [CrossRef] [PubMed]
- Sokolowski, M.; Furneaux, H.; Schwartz, S. The Inhibitory Activity of the AU-Rich RNA Element in the Human Papillomavirus Type 1 Late 3′ Untranslated Region Correlates with Its Affinity for the elav-Like HuR Protein. J. Virol. 1999, 73, 1080–1091. [Google Scholar] [CrossRef]
- Carlsson, A.; Schwartz, S. Inhibitory activity of the human papillomavirus type 1 AU-rich element correlates inversely with the levels of the elav-like HuR protein in the cell cytoplasm. Arch. Virol. 2000, 145, 491–503. [Google Scholar] [CrossRef]
- Mougel, M.; Akkawi, C.; Chamontin, C.; Feuillard, J.; Pessel-Vivares, L.; Socol, M.; Laine, S. NXF1 and CRM1 nuclear export pathways orchestrate nuclear export, translation and packaging of murine leukaemia retrovirus unspliced RNA. RNA Biol. 2020, 17, 528–538. [Google Scholar] [CrossRef]
- Chen, I.-H.B.; Sciabica, K.S.; Sandri-Goldin, R.M. ICP27 Interacts with the RNA Export Factor Aly/REF To Direct Herpes Simplex Virus Type 1 Intronless mRNAs to the TAP Export Pathway. J. Virol. 2002, 76, 12877–12889. [Google Scholar] [CrossRef]
- Johnson, L.A.; Li, L.; Sandri-Goldin, R.M. The Cellular RNA Export Receptor TAP/NXF1 Is Required for ICP27-Mediated Export of Herpes Simplex Virus 1 RNA, but the TREX Complex Adaptor Protein Aly/REF Appears To Be Dispensable. J. Virol. 2009, 83, 6335–6346. [Google Scholar] [CrossRef]
- Sandri-Goldin, R.M. ICP27 mediates HSV RNA export by shuttling through a leucine-rich nuclear export signal and binding viral intronless RNAs through an RGG motif. Genes Dev. 1998, 12, 868–879. [Google Scholar] [CrossRef]
- Mears, W.E.; Lam, V.; Rice, S.A. Identification of nuclear and nucleolar localization signals in the herpes simplex virus regulatory protein ICP27. J. Virol. 1995, 69, 935–947. [Google Scholar] [CrossRef]
- Mears, W.E.; Rice, S.A. The RGG box motif of the herpes simplex virus ICP27 protein mediates an RNA-binding activity and determines in vivo methylation. J. Virol. 1996, 70, 7445–7453. [Google Scholar] [CrossRef]
- Soliman, T.M.; Sandri-Goldin, R.M.; Silverstein, S.J. Shuttling of the herpes simplex virus type 1 regulatory protein ICP27 between the nucleus and cytoplasm mediates the expression of late proteins. J. Virol. 1997, 71, 9188–9197. [Google Scholar] [CrossRef] [PubMed]
- Soliman, T.M.; Silverstein, S.J. Identification of an Export Control Sequence and a Requirement for the KH Domains in ICP27 from Herpes Simplex Virus Type 1. J. Virol. 2000, 74, 7600–7609. [Google Scholar] [CrossRef] [PubMed]
- Yatherajam, G.; Huang, W.; Flint, S.J. Export of Adenoviral Late mRNA from the Nucleus Requires the Nxf1/Tap Export Receptor. J. Virol. 2011, 85, 1429–1438. [Google Scholar] [CrossRef] [PubMed]
- Schmid, M.; Gonzalez, R.A.; Dobner, T. CRM1-Dependent Transport Supports Cytoplasmic Accumulation of Adenoviral Early Transcripts. J. Virol. 2012, 86, 2282–2292. [Google Scholar] [CrossRef] [PubMed]
- Yang, C.-C.; Chang, C.-H.; Chen, H.-L.; Chou, M.-C.; Jhou, R.-S.; Huang, E.-Y.; Li, H.-C.; Suen, C.-S.; Hwang, M.-J.; Shih, C. CRM1-spike-mediated nuclear export of hepatitis B virus encapsidated viral RNA. Cell Rep. 2022, 38, 110472. [Google Scholar] [CrossRef]
- Strunze, S.; Trotman, L.C.; Boucke, K.; Greber, U.F. Nuclear Targeting of Adenovirus Type 2 Requires CRM1-mediated Nuclear Export. Mol. Biol. Cell 2005, 16, 2999–3009. [Google Scholar] [CrossRef]
- Wang, I.-H.; Burckhardt, C.J.; Yakimovich, A.; Morf, M.K.; Greber, U.F. The nuclear export factor CRM1 controls juxta-nuclear microtubule-dependent virus transport. J. Cell Sci. 2017, 130, 2185–2195. [Google Scholar] [CrossRef]
- Lagadec, F.; Carlon-Andres, I.; Ragues, J.; Port, S.; Wodrich, H.; Kehlenbach, R.H. CRM1 Promotes Capsid Disassembly and Nuclear Envelope Translocation of Adenovirus Independently of Its Export Function. J. Virol. 2022, 96, e0127321. [Google Scholar] [CrossRef]
- Prochasson, L.; Mghezzi-Habellah, M.; Roisin, A.; Palma, M.; Robin, J.P.; de Bossoreille, S.; Sareoua, L.; Cluet, D.; Mouehli, M.; Decimo, D.; et al. HTLV-1 Rex hijacks UPF1 in a CRM1 dependent manner, leading to NMD inhibition and revealing unexpected proviral roles of UPF1. Mol. Biol. 2023; preprint. [Google Scholar] [CrossRef]
- Ajamian, L.; Abel, K.; Rao, S.; Vyboh, K.; García-De-Gracia, F.; Soto-Rifo, R.; Kulozik, A.E.; Gehring, N.H.; Mouland, A.J. HIV-1 Recruits UPF1 but Excludes UPF2 to Promote Nucleocytoplasmic Export of the Genomic RNA. Biomolecules 2015, 5, 2808–2839. [Google Scholar] [CrossRef]
- Balakrishnan, K.; Munusami, P.; Mohareer, K.; Priyakumar, U.D.; Banerjee, A.; Luedde, T.; Mande, S.C.; Münk, C.; Banerjee, S. Staufen-2 functions as a cofactor for enhanced Rev-mediated nucleocytoplasmic trafficking of HIV -1 genomic RNA via the CRM1 pathway. FEBS J. 2022, 289, 6731–6751. [Google Scholar] [CrossRef] [PubMed]
- Banerjee, A.; Benjamin, R.; Balakrishnan, K.; Ghosh, P.; Banerjee, S. Human protein Staufen-2 promotes HIV-1 proliferation by positively regulating RNA export activity of viral protein Rev. Retrovirology 2014, 11, 18. [Google Scholar] [CrossRef] [PubMed]
- Fang, J.; Kubota, S.; Yang, B.; Zhou, N.; Zhang, H.; Godbout, R.; Pomerantz, R.J. A DEAD box protein facilitates HIV-1 replication as a cellular co-factor of Rev. Virology 2004, 330, 471–480. [Google Scholar] [CrossRef]
- Robertson-Anderson, R.M.; Wang, J.; Edgcomb, S.P.; Carmel, A.B.; Williamson, J.R.; Millar, D.P. Single-Molecule Studies Reveal that DEAD Box Protein DDX1 Promotes Oligomerization of HIV-1 Rev on the Rev Response Element. J. Mol. Biol. 2011, 410, 959–971. [Google Scholar] [CrossRef] [PubMed]
- Edgcomb, S.P.; Carmel, A.B.; Naji, S.; Ambrus-Aikelin, G.; Reyes, J.R.; Saphire, A.C.; Gerace, L.; Williamson, J.R. DDX1 Is an RNA-Dependent ATPase Involved in HIV-1 Rev Function and Virus Replication. J. Mol. Biol. 2012, 415, 61–74. [Google Scholar] [CrossRef] [PubMed]
- Yasuda-Inoue, M.; Kuroki, M.; Ariumi, Y. DDX3 RNA helicase is required for HIV-1 Tat function. Biochem. Biophys. Res. Commun. 2013, 441, 607–611. [Google Scholar] [CrossRef]
- Zhou, X.; Luo, J.; Mills, L.; Wu, S.; Pan, T.; Geng, G.; Zhang, J.; Luo, H.; Liu, C.; Zhang, H. DDX5 Facilitates HIV-1 Replication as a Cellular Co-Factor of Rev. PLoS ONE 2013, 8, e65040. [Google Scholar] [CrossRef]
- Bevec, D.; Jaksche, H.; Oft, M.; Wöhl, T.; Himmelspach, M.; Pacher, A.; Schebesta, M.; Koettnitz, K.; Dobrovnik, M.; Csonga, R.; et al. Inhibition of HIV-1 Replication in Lymphocytes by Mutants of the Rev Cofactor eIF-5A. Science 1996, 271, 1858–1860. [Google Scholar] [CrossRef]
- Kaminski, R.; Darbinian, N.; Sawaya, B.E.; Slonina, D.; Amini, S.; Johnson, E.M.; Rappaport, J.; Khalili, K.; Darbinyan, A. Purα as a cellular co-factor of Rev/RRE-mediated expression of HIV-1 intron-containing mRNA. J. Cell. Biochem. 2008, 103, 1231–1245. [Google Scholar] [CrossRef]
- Serquiña, A.K.P.; Das, S.R.; Popova, E.; Ojelabi, O.A.; Roy, C.K.; Göttlinger, H.G. UPF1 Is Crucial for the Infectivity of Human Immunodeficiency Virus Type 1 Progeny Virions. J. Virol. 2013, 87, 8853–8861. [Google Scholar] [CrossRef]
- Zhang, M.; Gong, P.; Ge, L.; Li, Y.; Chang, Z.; Qiao, R.; Zhou, X.; Wang, A.; Li, F. Nuclear Exportin 1 (XPO1) Binds to the Nuclear Localization/Export Signal of the Turnip Mosaic Virus NIb to Promote Viral Infection. Front. Microbiol. 2021, 12, 780724. [Google Scholar] [CrossRef] [PubMed]
- Zhang, M.; Gong, P.; Ge, L.; Chang, Z.; Cheng, X.; Zhou, X.; Wang, A.; Li, F. Nuclear exportin 1 facilitates turnip mosaic virus infection by exporting the sumoylated viral replicase and by repressing plant immunity. New Phytol. 2021, 232, 1382–1398. [Google Scholar] [CrossRef]
- Ghildyal, R.; Ho, A.; Dias, M.; Soegiyono, L.; Bardin, P.G.; Tran, K.C.; Teng, M.N.; Jans, D.A. The Respiratory Syncytial Virus Matrix Protein Possesses a Crm1-Mediated Nuclear Export Mechanism. J. Virol. 2009, 83, 5353–5362. [Google Scholar] [CrossRef] [PubMed]
- Gordon, D.E.; Jang, G.M.; Bouhaddou, M.; Xu, J.; Obernier, K.; White, K.M.; O’Meara, M.J.; Rezelj, V.V.; Guo, J.Z.; Swaney, D.L.; et al. A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature 2020, 583, 459–468. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.-G.; Huang, W.; Lee, H.; van de Leemput, J.; Kane, M.A.; Han, Z. Characterization of SARS-CoV-2 proteins reveals Orf6 pathogenicity, subcellular localization, host interactions and attenuation by Selinexor. Cell Biosci. 2021, 11, 58. [Google Scholar] [CrossRef] [PubMed]
- Bacot-Davis, V.R.; Ciomperlik, J.J.; Basta, H.A.; Cornilescu, C.C.; Palmenberg, A.C. Solution structures of Mengovirus Leader protein, its phosphorylated derivatives, and in complex with nuclear transport regulatory protein, RanGTPase. Proc. Natl. Acad. Sci. USA 2014, 111, 15792–15797. [Google Scholar] [CrossRef]
- Ciomperlik, J.J.; Basta, H.A.; Palmenberg, A.C. Cardiovirus Leader proteins bind exportins: Implications for virus replication and nucleocytoplasmic trafficking inhibition. Virology 2016, 487, 19–26. [Google Scholar] [CrossRef]
- Lizcano-Perret, B.; Michiels, T. Nucleocytoplasmic Trafficking Perturbation Induced by Picornaviruses. Viruses 2021, 13, 1210. [Google Scholar] [CrossRef]
- Kaminski, A.; Jackson, R.J. The polypyrimidine tract binding protein (PTB) requirement for internal initiation of translation of cardiovirus RNAs is conditional rather than absolute. RNA 1998, 4, 626–638. [Google Scholar] [CrossRef]
- Sherman, M.P.; de Noronha, C.M.C.; Eckstein, L.A.; Hataye, J.; Mundt, P.; Williams, S.A.F.; Neidleman, J.A.; Goldsmith, M.A.; Greene, W.C. Nuclear Export of Vpr Is Required for Efficient Replication of Human Immunodeficiency Virus Type 1 in Tissue Macrophages. J. Virol. 2003, 77, 7582–7589. [Google Scholar] [CrossRef]
- Alefantis, T.; Barmak, K.; Harhaj, E.W.; Grant, C.; Wigdahl, B. Characterization of a Nuclear Export Signal within the Human T Cell Leukemia Virus Type I Transactivator Protein Tax. J. Biol. Chem. 2003, 278, 21814–21822. [Google Scholar] [CrossRef]
- Bogerd, H.P.; Fridell, R.A.; Benson, R.E.; Hua, J.; Cullen, B.R. Protein Sequence Requirements for Function of the Human T-Cell Leukemia Virus Type 1 Rex Nuclear Export Signal Delineated by a Novel In Vivo Randomization-Selection Assay. Mol. Cell. Biol. 1996, 16, 4207–4214. [Google Scholar] [CrossRef]
- Mukai, R.; Ohshima, T. HTLV-1 HBZ positively regulates the mTOR signaling pathway via inhibition of GADD34 activity in the cytoplasm. Oncogene 2014, 33, 2317–2328. [Google Scholar] [CrossRef] [PubMed]
- Byun, H.; Halani, N.; Gou, Y.; Nash, A.K.; Lozano, M.M.; Dudley, J.P. Requirements for Mouse Mammary Tumor Virus Rem Signal Peptide Processing and Function. J. Virol. 2012, 86, 214–225. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Hall, R.; Guedán, A.; Yap, M.W.; Young, G.R.; Harvey, R.; Stoye, J.P.; Bishop, K.N. SARS-CoV-2 ORF6 disrupts innate immune signalling by inhibiting cellular mRNA export. PLOS Pathog. 2022, 18, e1010349. [Google Scholar] [CrossRef] [PubMed]
- Freundt, E.C.; Yu, L.; Park, E.; Lenardo, M.J.; Xu, X.-N. Molecular Determinants for Subcellular Localization of the Severe Acute Respiratory Syndrome Coronavirus Open Reading Frame 3b Protein. J. Virol. 2009, 83, 6631–6640. [Google Scholar] [CrossRef] [PubMed]
- Sharma, K.; Åkerström, S.; Sharma, A.K.; Chow, V.T.K.; Teow, S.; Abrenica, B.; Booth, S.A.; Booth, T.F.; Mirazimi, A.; Lal, S.K. SARS-CoV 9b Protein Diffuses into Nucleus, Undergoes Active Crm1 Mediated Nucleocytoplasmic Export and Triggers Apoptosis When Retained in the Nucleus. PLoS ONE 2011, 6, e19436. [Google Scholar] [CrossRef]
- Atasheva, S.; Fish, A.; Fornerod, M.; Frolova, E.I. Venezuelan Equine Encephalitis Virus Capsid Protein Forms a Tetrameric Complex with CRM1 and Importin α/β That Obstructs Nuclear Pore Complex Function. J. Virol. 2010, 84, 4158–4171. [Google Scholar] [CrossRef]
- Montgomery, S.A.; Johnston, R.E. Nuclear Import and Export of Venezuelan Equine Encephalitis Virus Nonstructural Protein 2. J. Virol. 2007, 81, 10268–10279. [Google Scholar] [CrossRef]
- Cerutti, A.; Maillard, P.; Minisini, R.; Vidalain, P.-O.; Roohvand, F.; Pecheur, E.-I.; Pirisi, M.; Budkowska, A. Identification of a Functional, CRM-1-Dependent Nuclear Export Signal in Hepatitis C Virus Core Protein. PLoS ONE 2011, 6, e25854. [Google Scholar] [CrossRef]
- Rawlinson, S.M.; Pryor, M.J.; Wright, P.J.; Jans, D.A. CRM1-mediated Nuclear Export of Dengue Virus RNA Polymerase NS5 Modulates Interleukin-8 Induction and Virus Production. J. Biol. Chem. 2009, 284, 15589–15597. [Google Scholar] [CrossRef] [PubMed]
- De Jesús-González, L.A.; Palacios-Rápalo, S.N.; Reyes-Ruiz, J.M.; Osuna-Ramos, J.F.; Farfán-Morales, C.N.; Cordero-Rivera, C.D.; Cisneros, B.; Gutiérrez-Escolano, A.L.; del Ángel, R.M. Nucleo-Cytoplasmic Transport of ZIKV Non-Structural 3 Protein Is Mediated by Importin-α/β and Exportin CRM-1. J. Virol. 2023, 97, e0177322. [Google Scholar] [CrossRef]
- Thomas, S.; Rai, J.; John, L.; Schaefer, S.; Pützer, B.M.; Herchenröder, O. Chikungunya virus capsid protein contains nuclear import and export signals. Virol. J. 2013, 10, 269. [Google Scholar] [CrossRef] [PubMed]
- Bardina, M.V.; Lidsky, P.V.; Sheval, E.V.; Fominykh, K.V.; van Kuppeveld, F.J.M.; Polyakov, V.Y.; Agol, V.I. Mengovirus-Induced Rearrangement of the Nuclear Pore Complex: Hijacking Cellular Phosphorylation Machinery. J. Virol. 2009, 83, 3150–3161. [Google Scholar] [CrossRef] [PubMed]
- Ferré, C.A.; Davezac, N.; Thouard, A.; Peyrin, J.-M.; Belenguer, P.; Miquel, M.-C.; Gonzalez-Dunia, D.; Szelechowski, M. Manipulation of the N-terminal sequence of the Borna disease virus X protein improves its mitochondrial targeting and neuroprotective potential. FASEB J. 2016, 30, 1523–1533. [Google Scholar] [CrossRef]
- Ohtsuka, J.; Matsumoto, Y.; Ohta, K.; Fukumura, M.; Tsurudome, M.; Nosaka, T.; Nishio, M. Nucleocytoplasmic shuttling of the human parainfluenza virus type 2 phosphoprotein. Virology 2019, 528, 54–63. [Google Scholar] [CrossRef]
- Huang, S.; Chen, J.; Chen, Q.; Wang, H.; Yao, Y.; Chen, J.; Chen, Z. A Second CRM1-Dependent Nuclear Export Signal in the Influenza A Virus NS2 Protein Contributes to the Nuclear Export of Viral Ribonucleoproteins. J. Virol. 2013, 87, 767–778. [Google Scholar] [CrossRef]
- Zhao, L.; Xia, H.; Huang, J.; Zheng, Y.; Liu, C.; Su, J.; Ping, J. Features of Nuclear Export Signals of NS2 Protein of Influenza D Virus. Viruses 2020, 12, 1100. [Google Scholar] [CrossRef]
- Becke, S.; Fabre-Mersseman, V.; Aue, S.; Auerochs, S.; Sedmak, T.; Wolfrum, U.; Strand, D.; Marschall, M.; Plachter, B.; Reyda, S. Modification of the major tegument protein pp65 of human cytomegalovirus inhibits virus growth and leads to the enhancement of a protein complex with pUL69 and pUL97 in infected cells. J. Gen. Virol. 2010, 91 Pt 10, 2531–2541. [Google Scholar] [CrossRef]
- Lischka, P.; Rauh, C.; Mueller, R.; Stamminger, T. Human Cytomegalovirus UL84 Protein Contains Two Nuclear Export Signals and Shuttles between the Nucleus and the Cytoplasm. J. Virol. 2006, 80, 10274–10280. [Google Scholar] [CrossRef]
- Liu, Y.; Zhang, Z.; Zhao, X.; Wei, H.; Deng, J.; Cui, Z.; Zhang, X.-E. Human cytomegalovirus UL94 is a nucleocytoplasmic shuttling protein containing two NLSs and one NES. Virus Res. 2012, 166, 31–42. [Google Scholar] [CrossRef] [PubMed]
- Muñoz-Fontela, C.; Collado, M.; Rodriguez, E.; García, M.; Alvarez-Barrientos, A.; Arroyo, J.; Nombela, C.; Rivas, C. Identification of a nuclear export signal in the KSHV latent protein LANA2 mediating its export from the nucleus. Exp. Cell Res. 2005, 311, 96–105. [Google Scholar] [CrossRef] [PubMed]
- Muñoz-Fontela, C.; Rodríguez, E.; Nombela, C.; Arroyo, J.; Rivas, C. Characterization of the bipartite nuclear localization signal of protein LANA2 from Kaposi’s sarcoma-associated herpesvirus. Biochem. J. 2003, 374 Pt 2, 545–550. [Google Scholar] [CrossRef] [PubMed]
- Li, X.; Zhu, F. Identification of the Nuclear Export and Adjacent Nuclear Localization Signals for ORF45 of Kaposi’s Sarcoma-Associated Herpesvirus. J. Virol. 2009, 83, 2531–2539. [Google Scholar] [CrossRef]
- Williams, P.; Verhagen, J.; Elliott, G. Characterization of a CRM1-Dependent Nuclear Export Signal in the C Terminus of Herpes Simplex Virus Type 1 Tegument Protein UL47. J. Virol. 2008, 82, 10946–10952. [Google Scholar] [CrossRef]
- Mears, W.E.; Rice, S.A. The Herpes Simplex Virus Immediate-Early Protein ICP27 Shuttles between Nucleus and Cytoplasm. Virology 1998, 242, 128–137. [Google Scholar] [CrossRef]
- Phelan, A.; Clements, J.B. Herpes simplex virus type 1 immediate early protein IE63 shuttles between nuclear compartments and the cytoplasm. J. Gen. Virol. 1997, 78 Pt 12, 3327–3331. [Google Scholar] [CrossRef]
- Cheng, G.; Brett, M.-E.; He, B. Signals That Dictate Nuclear, Nucleolar, and Cytoplasmic Shuttling of the γ 1 34.5 Protein of Herpes Simplex Virus Type 1. J. Virol. 2002, 76, 9434–9445. [Google Scholar] [CrossRef]
- Ding, Q.; Guo, H.; Lin, F.; Pan, W.; Ye, B.; Zheng, A.C. Characterization of the nuclear import and export mechanisms of bovine herpesvirus-1 infected cell protein 27. Virus Res. 2010, 149, 95–103. [Google Scholar] [CrossRef]
- Dobbelstein, M.; Roth, J.; Kimberly, W.T.; Levine, A.J.; Shenk, T. Nuclear export of the E1B 55-kDa and E4 34-kDa adenoviral oncoproteins mediated by a rev-like signal sequence. EMBO J. 1997, 16, 4276–4284. [Google Scholar] [CrossRef]
- Jiang, H.; Olson, M.V.; Medrano, D.R.; Lee, O.; Xu, J.; Piao, Y.; Alonso, M.M.; Gomez-Manzano, C.; Hung, M.; Yung, W.K.A.; et al. A novel CRM1-dependent nuclear export signal in adenoviral E1A protein regulated by phosphorylation. FASEB J. Off. Publ. Fed. Am. Soc. Exp. Biol. 2006, 20, 2603–2605. [Google Scholar] [CrossRef]
- Higashino, F.; Aoyagi, M.; Takahashi, A.; Ishino, M.; Taoka, M.; Isobe, T.; Kobayashi, M.; Totsuka, Y.; Kohgo, T.; Shindoh, M. Adenovirus E4orf6 targets pp32/LANP to control the fate of ARE-containing mRNAs by perturbing the CRM1-dependent mechanism. J. Cell Biol. 2005, 170, 15–20. [Google Scholar] [CrossRef]
- Kuroshima, T.; Aoyagi, M.; Yasuda, M.; Kitamura, T.; Jehung, J.P.; Ishikawa, M.; Kitagawa, Y.; Totsuka, Y.; Shindoh, M.; Higashino, F. Viral-mediated stabilization of AU-rich element containing mRNA contributes to cell transformation. Oncogene 2011, 30, 2912–2920. [Google Scholar] [CrossRef] [PubMed]
- Forgues, M.; Marrogi, A.J.; Spillare, E.A.; Wu, C.-G.; Yang, Q.; Yoshida, M.; Wang, X.W. Interaction of the Hepatitis B Virus X Protein with the Crm1-dependent Nuclear Export Pathway. J. Biol. Chem. 2001, 276, 22797–22803. [Google Scholar] [CrossRef] [PubMed]
- Fradet-Turcotte, A.; Moody, C.; Laimins, L.A.; Archambault, J. Nuclear Export of Human Papillomavirus Type 31 E1 Is Regulated by Cdk2 Phosphorylation and Required for Viral Genome Maintenance. J. Virol. 2010, 84, 11747–11760. [Google Scholar] [CrossRef] [PubMed]
- McKee, C.H.; Onder, Z.; Ashok, A.; Cardoso, R.; Moroianu, J. Characterization of the transport signals that mediate the nucleocytoplasmic traffic of low risk HPV11 E7. Virology 2013, 443, 113–122. [Google Scholar] [CrossRef] [PubMed]
- Knapp, A.A.; McManus, P.M.; Bockstall, K.; Moroianu, J. Identification of the nuclear localization and export signals of high risk HPV16 E7 oncoprotein. Virology 2009, 383, 60–68. [Google Scholar] [CrossRef] [PubMed]
- Onder, Z.; Chang, V.; Moroianu, J. Nuclear export of cutaneous HPV8 E7 oncoprotein is mediated by a leucine-rich nuclear export signal via a CRM1 pathway. Virology 2015, 474, 28–33. [Google Scholar] [CrossRef]
- Bodendorf, U.; Cziepluch, C.; Jauniaux, J.-C.; Rommelaere, J.; Salomé, N. Nuclear Export Factor CRM1 Interacts with Nonstructural Proteins NS2 from Parvovirus Minute Virus of Mice. J. Virol. 1999, 73, 7769–7779. [Google Scholar] [CrossRef]
- Cheng, J.-H.; Lai, G.-H.; Lien, Y.-Y.; Sun, F.-C.; Hsu, S.-L.; Chuang, P.-C.; Lee, M.-S. Identification of nuclear localization signal and nuclear export signal of VP1 from the chicken anemia virus and effects on VP2 shuttling in cells. Virol. J. 2019, 16, 45. [Google Scholar] [CrossRef]
- Boson, B.; Mialon, C.; Schichl, K.; Denolly, S.; Cosset, F.-L. Nup98 Is Subverted from Annulate Lamellae by Hepatitis C Virus Core Protein to Foster Viral Assembly. Mbio 2022, 13, e0292321. [Google Scholar] [CrossRef] [PubMed]
- Schneider, W.M.; Chevillotte, M.D.; Rice, C.M. Interferon-Stimulated Genes: A Complex Web of Host Defenses. Annu. Rev. Immunol. 2014, 32, 513–545. [Google Scholar] [CrossRef] [PubMed]
- Kawai, T.; Akira, S. The role of pattern-recognition receptors in innate immunity: Update on Toll-like receptors. Nat. Immunol. 2010, 11, 373–384. [Google Scholar] [CrossRef]
- Sun, S.-C.; Chang, J.-H.; Jin, J. Regulation of nuclear factor-κB in autoimmunity. Trends Immunol. 2013, 34, 282–289. [Google Scholar] [CrossRef] [PubMed]
- Kumar, K.P.; McBride, K.M.; Weaver, B.K.; Dingwall, C.; Reich, N.C. Regulated Nuclear-Cytoplasmic Localization of Interferon Regulatory Factor 3, a Subunit of Double-Stranded RNA-Activated Factor 1. Mol. Cell. Biol. 2000, 20, 4159–4168. [Google Scholar] [CrossRef]
- Kashyap, T.; Argueta, C.; Aboukameel, A.; Unger, T.J.; Klebanov, B.; Mohammad, R.M.; Muqbil, I.; Azmi, A.S.; Drolen, C.; Senapedis, W.; et al. Selinexor, a Selective Inhibitor of Nuclear Export (SINE) compound, acts through NF-κB deactivation and combines with proteasome inhibitors to synergistically induce tumor cell death. Oncotarget 2016, 7, 78883–78895. [Google Scholar] [CrossRef]
- Lim, K.-H.; Choi, H.S.; Park, Y.K.; Park, E.-S.; Shin, G.C.; Kim, D.H.; Ahn, S.H.; Kim, K.-H. HBx-Induced NF-κB Signaling in Liver Cells Is Potentially Mediated by the Ternary Complex of HBx with p22-FLIP and NEMO. PLoS ONE 2013, 8, e57331. [Google Scholar] [CrossRef]
- Guven-Maiorov, E.; Tsai, C.-J.; Nussinov, R. Oncoviruses Can Drive Cancer by Rewiring Signaling Pathways Through Interface Mimicry. Front. Oncol. 2019, 9, 1236. [Google Scholar] [CrossRef]
- Forgues, M.; Difilippantonio, M.; Linke, S.; Ried, T.; Nagashima, K.; Feden, J.; Valerie, K.; Fukasawa, K.; Wang, X. Involvement of Crm1 in Hepatitis B Virus X Protein-Induced Aberrant Centriole Replication and Abnormal Mitotic Spindles. Mol. Cell. Biol. 2003, 23, 5282–5292. [Google Scholar] [CrossRef]
- Godinho, S.A.; Pellman, D. Causes and consequences of centrosome abnormalities in cancer. Philos. Trans. R. Soc. B Biol. Sci. 2014, 369, 20130467. [Google Scholar] [CrossRef]
- Forbes, D.J.; Travesa, A.; Nord, M.S.; Bernis, C. Nuclear transport factors: Global regulation of mitosis. Curr. Opin. Cell Biol. 2015, 35, 78–90. [Google Scholar] [CrossRef] [PubMed]
- Shi, Y.; Zhang, H.; Han, Z.; Mi, X.; Zhang, W.; Lv, M. HBx interacted with Smad4 to deprive activin a growth inhibition function in hepatocyte HL7702 on CRM1 manner. Tumor Biol. J. Int. Soc. Oncodevelopmental Biol. Med. 2016, 37, 3405–3415. [Google Scholar] [CrossRef] [PubMed]
- Dosch, T.; Horn, F.; Schneider, G.; Krätzer, F.; Dobner, T.; Hauber, J.; Stauber, R.H. The Adenovirus Type 5 E1B-55K Oncoprotein Actively Shuttles in Virus-Infected Cells, Whereas Transport of E4orf6 Is Mediated by a CRM1-Independent Mechanism. J. Virol. 2001, 75, 5677–5683. [Google Scholar] [CrossRef]
- Kindsmüller, K.; Groitl, P.; Härtl, B.; Blanchette, P.; Hauber, J.; Dobner, T. Intranuclear targeting and nuclear export of the adenovirus E1B-55K protein are regulated by SUMO1 conjugation. Proc. Natl. Acad. Sci. USA 2007, 104, 6684–6689. [Google Scholar] [CrossRef] [PubMed]
- Schmid, M.; Kindsmüller, K.; Wimmer, P.; Groitl, P.; Gonzalez, R.A.; Dobner, T. The E3 Ubiquitin Ligase Activity Associated with the Adenoviral E1B-55K–E4orf6 Complex Does Not Require CRM1-Dependent Export. J. Virol. 2011, 85, 7081–7094. [Google Scholar] [CrossRef]
- Endter, C.; Härtl, B.; Spruss, T.; Hauber, J.; Dobner, T. Blockage of CRM1-dependent nuclear export of the adenovirus type 5 early region 1B 55-kDa protein augments oncogenic transformation of primary rat cells. Oncogene 2005, 24, 55–64. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Perwitasari, O.; Johnson, S.; Yan, X.; Register, E.; Crabtree, J.; Gabbard, J.; Howerth, E.; Shacham, S.; Carlson, R.; Tamir, S.; et al. Antiviral Efficacy of Verdinexor In Vivo in Two Animal Models of Influenza A Virus Infection. PLoS ONE 2016, 11, e0167221. [Google Scholar] [CrossRef]
- Uddin, H.; Zonder, J.A.; Azmi, A.S. Exportin 1 inhibition as antiviral therapy. Drug Discov. Today 2020, 25, 1775–1781. [Google Scholar] [CrossRef]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).