Screening and Functional Evaluation of Antiinflammatory Bacteria Strains

A special issue of Microorganisms (ISSN 2076-2607). This special issue belongs to the section "Molecular Microbiology and Immunology".

Deadline for manuscript submissions: closed (31 May 2023) | Viewed by 5094

Special Issue Editor

College of Animal Science and Technology, Huazhong Agricultural University, Wuhan, China
Interests: nutrition; gut microbiota; gut health; metabolic disorder
Special Issues, Collections and Topics in MDPI journals

Special Issue Information

Dear Colleagues,

Infectious and non-infectious diseases usually lead to inflammatory responses in various tissues and organs in humans and animals, severely affecting the health of the host. A number of microorganisms originating from animals, plants, and soil have been shown to have excellent anti-inflammatory efficacy and are being used in human clinical and animal production in a progressive manner. Currently, the number of known anti-inflammatory bacteria strains is limited, mainly due to the inaccessibility of large numbers of difficult-to-culture microorganisms by conventional means. In addition, many of the potential anti-inflammatory bacteria strains that have been obtained have not been functionally validated in cell culture and animals.

This Research Topic is to provide a platform for presenting and discussing the cutting-edge research on all aspects of screening, functional evaluation, and mechanism elucidation of anti-inflammatory bacteria strains. We welcome manuscripts from, but not limited to, the following subtopics:

  • Screening and acquisition of anti-inflammatory bacteria strains;
  • Ex vivo and in vivo anti-inflammatory characterization of specific bacteria strains;
  • Role of anti-inflammatory bacteria strains in animal intestinal health and disease;
  • Identification and mechanisms by which metabolites of anti-inflammatory bacteria strains modulate host immunity;
  • Anti-inflammatory bacteria strains -intestinal microbiota interactions;
  • Potential mechanisms of specific bacteria strains against pathogenic infections based on multi-omics.

Dr. Shiyu Tao
Guest Editor

Manuscript Submission Information

Manuscripts should be submitted online at www.mdpi.com by registering and logging in to this website. Once you are registered, click here to go to the submission form. Manuscripts can be submitted until the deadline. All submissions that pass pre-check are peer-reviewed. Accepted papers will be published continuously in the journal (as soon as accepted) and will be listed together on the special issue website. Research articles, review articles as well as short communications are invited. For planned papers, a title and short abstract (about 250 words) can be sent to the Editorial Office for assessment.

Submitted manuscripts should not have been published previously, nor be under consideration for publication elsewhere (except conference proceedings papers). All manuscripts are thoroughly refereed through a single-blind peer-review process. A guide for authors and other relevant information for submission of manuscripts is available on the Instructions for Authors page. Microorganisms is an international peer-reviewed open access monthly journal published by MDPI.

Please visit the Instructions for Authors page before submitting a manuscript. The Article Processing Charge (APC) for publication in this open access journal is 2700 CHF (Swiss Francs). Submitted papers should be well formatted and use good English. Authors may use MDPI's English editing service prior to publication or during author revisions.

Keywords

  • microbiota
  • bacteria strains
  • metabolites
  • anti-inflammatory
  • intestine

Benefits of Publishing in a Special Issue

  • Ease of navigation: Grouping papers by topic helps scholars navigate broad scope journals more efficiently.
  • Greater discoverability: Special Issues support the reach and impact of scientific research. Articles in Special Issues are more discoverable and cited more frequently.
  • Expansion of research network: Special Issues facilitate connections among authors, fostering scientific collaborations.
  • External promotion: Articles in Special Issues are often promoted through the journal's social media, increasing their visibility.
  • Reprint: MDPI Books provides the opportunity to republish successful Special Issues in book format, both online and in print.

Further information on MDPI's Special Issue policies can be found here.

Published Papers (1 paper)

Order results
Result details
Select all
Export citation of selected articles as:

Research

16 pages, 6862 KB  
Article
GAPDH Released from Lactobacillus johnsonii MG Enhances Barrier Function by Upregulating Genes Associated with Tight Junctions
by Mengying Lyu, Yuying Bai, Kanami Orihara, Kazuhiko Miyanaga and Naoyuki Yamamoto
Microorganisms 2023, 11(6), 1393; https://doi.org/10.3390/microorganisms11061393 - 25 May 2023
Cited by 13 | Viewed by 3365
Abstract
Extracellular glyceraldehyde-3-phosphate dehydrogenase (GAPDH) has multiple interactions with various gut epithelial components. For instance, GAPDH in Lactobacillus johnsonii MG cells interacts with junctional adhesion molecule-2 (JAM-2) in Caco-2 cells and enhances tight junctions. However, the specificity of GAPDH toward JAM-2 and its role [...] Read more.
Extracellular glyceraldehyde-3-phosphate dehydrogenase (GAPDH) has multiple interactions with various gut epithelial components. For instance, GAPDH in Lactobacillus johnsonii MG cells interacts with junctional adhesion molecule-2 (JAM-2) in Caco-2 cells and enhances tight junctions. However, the specificity of GAPDH toward JAM-2 and its role in the tight junctions in Caco-2 cells remain unclear. In the present study, we assessed the effect of GAPDH on tight junction regeneration and explored the GAPDH peptide fragments required for interaction with JAM-2. GAPDH was specifically bound to JAM-2 and rescued H2O2-damaged tight junctions in Caco-2 cells, with various genes being upregulated in the tight junctions. To understand the specific amino acid sequence of GAPDH that interacts with JAM-2, peptides interacting with JAM-2 and L. johnsonii MG cells were purified using HPLC and predicted using TOF–MS analysis. Two peptides, namely 11GRIGRLAF18 at the N-terminus and 323SFTCQMVRTLLKFATL338 at the C-terminus, displayed good interactions and docking with JAM-2. In contrast, the long peptide 52DSTHGTFNHEVSATDDSIVVDGKKYRVYAEPQAQNIPW89 was predicted to bind to the bacterial cell surface. Overall, we revealed a novel role of GAPDH purified from L. johnsonii MG in promoting the regeneration of damaged tight junctions and identified the specific sequences of GAPDH involved in JAM-2 binding and MG cell interaction. Full article
Show Figures

Graphical abstract

Back to TopTop