The Mycotoxin Patulin Inhibits the Mitochondrial Carnitine/Acylcarnitine Carrier (SLC25A20) by Interaction with Cys136 Implications for Human Health
Abstract
1. Introduction
2. Results
2.1. Effect of Patulin on the Mitochondrial CAC
2.2. Effect of Patulin on the Recombinant CAC WT and Site-Directed Cys Mutants
2.3. Multiple Sequence Alignment and 3D Molecular Modelling of RnCAC (Rattus norvegicus CAC)
2.4. Docking Analysis
2.5. Mass Spectrometry Analysis
3. Discussion
4. Materials and Methods
4.1. Chemicals
4.2. Overexpression of the WT and Mutant CACs
4.3. Reconstitution of Mitochondrial and Recombinant Protein of CAC in Proteoliposomes
4.4. Transport Assay in Proteoliposomes
4.5. MC Protein Multiple Sequence Alignment
4.6. 3D Protein Structure and Comparative Modeling of RnCAC Cys Mutants
4.7. Docking Analysis
4.8. Sample Preparation for MS Analysis
4.9. In-Gel Digestion
4.10. MALDI-TOF MS Analysis
4.11. RPLC-ESI-MS Instrumentation and Operating Conditions
4.12. Database Searching
4.13. Other Methods
4.14. Statistical Analysis
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
Abbreviations
References
- Pal, S.; Singh, N.; Ansari, K.M. Toxicological effects of patulin mycotoxin on the mammalian system: An overview. Toxicol. Res. 2017, 6, 764–771. [Google Scholar] [CrossRef]
- Wichmann, G.; Herbarth, O.; Lehmann, I. The mycotoxins citrinin, gliotoxin, and patulin affect interferon-gamma rather than interleukin-4 production in human blood cells. Environ. Toxicol. 2002, 17, 211–218. [Google Scholar] [CrossRef] [PubMed]
- Liu, B.H.; Yu, F.Y.; Wu, T.S.; Li, S.Y.; Su, M.C.; Wang, M.C.; Shih, S.M. Evaluation of genotoxic risk and oxidative DNA damage in mammalian cells exposed to mycotoxins, patulin and citrinin. Toxicol. Appl. Pharmacol. 2003, 191, 255–263. [Google Scholar] [CrossRef]
- Zhou, S.M.; Jiang, L.P.; Geng, C.Y.; Cao, J.; Zhong, L.F. Patulin-induced oxidative DNA damage and p53 modulation in HepG2 cells. Toxicon 2010, 55, 390–395. [Google Scholar] [CrossRef] [PubMed]
- Saleh, I.; Goktepe, I. Health risk assessment of Patulin intake through apples and apple-based foods sold in Qatar. Heliyon 2019, 5, e02754. [Google Scholar] [CrossRef] [PubMed]
- Torović, L.; Dimitrov, N.; Lopes, A.; Martins, C.; Alvito, P.; Assunção, R. Patulin in fruit juices: Occurrence, bioaccessibility, and risk assessment for Serbian population. Food Addit. Contam. Part A Chem. Anal. Control Expo. Risk Assess 2018, 35, 985–995. [Google Scholar] [CrossRef]
- Wei, C.; Yu, L.; Qiao, N.; Zhao, J.; Zhang, H.; Zhai, Q.; Tian, F.; Chen, W. Progress in the distribution, toxicity, control, and detoxification of patulin: A review. Toxicon 2020, 184, 83–93. [Google Scholar] [CrossRef]
- Raiola, A.; Tenore, G.C.; Manyes, L.; Meca, G.; Ritieni, A. Risk analysis of main mycotoxins occurring in food for children: An overview. Food Chem. Toxicol. 2015, 84, 169–180. [Google Scholar] [CrossRef]
- Chan-Hon-Tong, A.; Charles, M.A.; Forhan, A.; Heude, B.; Sirot, V. Exposure to food contaminants during pregnancy. Sci. Total Environ. 2013, 458–460, 27–35. [Google Scholar] [CrossRef]
- Fliege, R.; Metzler, M. Electrophilic properties of patulin. N-acetylcysteine and glutathione adducts. Chem. Res. Toxicol. 2000, 13, 373–381. [Google Scholar] [CrossRef]
- Puel, O.; Galtier, P.; Oswald, I.P. Biosynthesis and toxicological effects of patulin. Toxins 2010, 2, 613–631. [Google Scholar] [CrossRef] [PubMed]
- Sakthisekaran, D.; Shanmugasundaram, K.R.; Shanmugasundaram, E.R. Effect of patulin on some enzymes of carbohydrate metabolism studied in rats. Biochem. Int. 1989, 19, 37–51. [Google Scholar] [PubMed]
- Mahfoud, R.; Maresca, M.; Garmy, N.; Fantini, J. The mycotoxin patulin alters the barrier function of the intestinal epithelium: Mechanism of action of the toxin and protective effects of glutathione. Toxicol. Appl. Pharmacol. 2002, 181, 209–218. [Google Scholar] [CrossRef] [PubMed]
- Rao, R.K.; Baker, R.D.; Baker, S.S.; Gupta, A.; Holycross, M. Oxidant-induced disruption of intestinal epithelial barrier function: Role of protein tyrosine phosphorylation. Am. J. Physiol. 1997, 273, G812–G823. [Google Scholar] [CrossRef] [PubMed]
- Tonazzi, A.; Giangregorio, N.; Console, L.; Scalise, M.; La Russa, D.; Notaristefano, C.; Brunelli, E.; Barca, D.; Indiveri, C. Mitochondrial carnitine/acylcarnitine transporter, a novel target of mercury toxicity. Chem. Res. Toxicol. 2015, 28, 1015–1022. [Google Scholar] [CrossRef]
- Giangregorio, N.; Tonazzi, A.; Console, L.; Prejanò, M.; Marino, T.; Russo, N.; Indiveri, C. Effect of Copper on the Mitochondrial Carnitine/Acylcarnitine Carrier Via Interaction with Cys136 and Cys155. Possible Implications in Pathophysiology. Molecules 2020, 25, 820. [Google Scholar] [CrossRef]
- Pochini, L.; Galluccio, M.; Scumaci, D.; Giangregorio, N.; Tonazzi, A.; Palmieri, F.; Indiveri, C. Interaction of beta-lactam antibiotics with the mitochondrial carnitine/acylcarnitine transporter. Chem. Biol. Interact. 2008, 173, 187–194. [Google Scholar] [CrossRef]
- Tonazzi, A.; Giangregorio, N.; Console, L.; Indiveri, C. Mitochondrial carnitine/acylcarnitine translocase: Insights in structure/function relationships. Basis for drug therapy and side effects prediction. Mini Rev. Med. Chem. 2015, 15, 396–405. [Google Scholar] [CrossRef]
- Giangregorio, N.; Palmieri, F.; Indiveri, C. Glutathione controls the redox state of the mitochondrial carnitine/acylcarnitine carrier Cys residues by glutathionylation. Biochim. Biophys. Acta BBA-Gen. Subj. 2013, 1830, 5299–5304. [Google Scholar] [CrossRef]
- Giangregorio, N.; Tonazzi, A.; Console, L.; Lorusso, I.; De Palma, A.; Indiveri, C. The mitochondrial carnitine/acylcarnitine carrier is regulated by hydrogen sulfide via interaction with C136 and C155. Biochim. Biophys. Acta 2016, 1860, 20–27. [Google Scholar] [CrossRef]
- Tonazzi, A.; Giangregorio, N.; Console, L.; Calvano, C.D.; Prejanò, M.; Scalise, M.; Incampo, G.; Marino, T.; Russo, N.; Cataldi, T.R.I.; et al. Inhibition of the carnitine acylcarnitine carrier by carbon monoxide reveals a novel mechanism of action with non-metal-containing proteins. Free Radic. Biol. Med. 2022, 188, 395–403. [Google Scholar] [CrossRef]
- Tonazzi, A.; Giangregorio, N.; Console, L.; De Palma, A.; Indiveri, C. Nitric oxide inhibits the mitochondrial carnitine/acylcarnitine carrier through reversible S-nitrosylation of cysteine 136. Biochim. Biophys. Acta Bioenerg. 2017, 1858, 475–482. [Google Scholar] [CrossRef]
- Tonazzi, A.; Eberini, I.; Indiveri, C. Molecular mechanism of inhibition of the mitochondrial carnitine/acylcarnitine transporter by omeprazole revealed by proteoliposome assay, mutagenesis and bioinformatics. PLoS ONE 2013, 8, e82286. [Google Scholar] [CrossRef]
- Bolognino, I.; Giangregorio, N.; Pisani, L.; de Candia, M.; Purgatorio, R.; Tonazzi, A.; Altomare, C.D.; Cellamare, S.; Catto, M. A Prospective Repurposing of Dantrolene as a Multitarget Agent for Alzheimer’s Disease. Molecules 2019, 24, 4298. [Google Scholar] [CrossRef]
- Indiveri, C.; Giangregorio, N.; Iacobazzi, V.; Palmieri, F. Site-directed mutagenesis and chemical modification of the six native cysteine residues of the rat mitochondrial carnitine carrier: Implications for the role of cysteine-136. Biochemistry 2002, 41, 8649–8656. [Google Scholar] [CrossRef]
- Tonazzi, A.; Giangregorio, N.; Indiveri, C.; Palmieri, F. Identification by site-directed mutagenesis and chemical modification of three vicinal cysteine residues in rat mitochondrial carnitine/acylcarnitine transporter. J. Biol. Chem. 2005, 280, 19607–19612. [Google Scholar] [CrossRef]
- Pebay-Peyroula, E.; Dahout-Gonzalez, C.; Kahn, R.; Trézéguet, V.; Lauquin, G.J.; Brandolin, G. Structure of mitochondrial ADP/ATP carrier in complex with carboxyatractyloside. Nature 2003, 426, 39–44. [Google Scholar] [CrossRef]
- Giangregorio, N.; Tonazzi, A.; Console, L.; Indiveri, C.; Palmieri, F. Site-directed mutagenesis of charged amino acids of the human mitochondrial carnitine/acylcarnitine carrier: Insight into the molecular mechanism of transport. Biochim. Biophys. Acta BBA-Bioenerg. 2010, 1797, 839–845. [Google Scholar] [CrossRef]
- Palmieri, F.; Pierri, C.L. Structure and function of mitochondrial carriers-role of the transmembrane helix P and G residues in the gating and transport mechanism. FEBS Lett. 2010, 584, 1931–1939. [Google Scholar] [CrossRef]
- Ruprecht, J.J.; King, M.S.; Zögg, T.; Aleksandrova, A.A.; Pardon, E.; Crichton, P.G.; Steyaert, J.; Kunji, E.R.S. The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier. Cell 2019, 176, 435–447. [Google Scholar] [CrossRef]
- Pierri, C.L.; Palmieri, F.; De Grassi, A. Single-nucleotide evolution quantifies the importance of each site along the structure of mitochondrial carriers. Cell Mol. Life Sci. 2014, 71, 349–364. [Google Scholar] [CrossRef] [PubMed]
- Liu, W.T.; Ng, J.; Meluzzi, D.; Bandeira, N.; Gutierrez, M.; Simmons, T.L.; Schultz, A.W.; Linington, R.G.; Moore, B.S.; Gerwick, W.H.; et al. Interpretation of tandem mass spectra obtained from cyclic nonribosomal peptides. Anal. Chem. 2009, 81, 4200–4209. [Google Scholar] [CrossRef] [PubMed]
- Katsuyama, A.; Konno, T.; Shimoyama, S.; Kikuchi, H. The mycotoxin patulin decreases expression of density-enhanced phosphatase-1 by down-regulating PPARγ in human colon cancer cells. Tohoku J. Exp. Med. 2014, 233, 265–274. [Google Scholar] [CrossRef] [PubMed]
- Han, N.; Luo, R.; Liu, J.; Guo, T.; Feng, J.; Peng, X. Transcriptomic and Proteomic Analysis Reveals Mechanisms of Patulin-Induced Cell Toxicity in Human Embryonic Kidney Cells. Toxins 2020, 12, 681. [Google Scholar] [CrossRef] [PubMed]
- Fliege, R.; Metzler, M. The mycotoxin patulin induces intra- and intermolecular protein crosslinks in vitro involving cysteine, lysine, and histidine side chains, and alpha-amino groups. Chem. Biol. Interact. 1999, 123, 85–103. [Google Scholar] [CrossRef]
- Diao, E.; Ma, K.; Li, M.; Zhang, H.; Xie, P.; Qian, S.; Song, H.; Mao, R.; Zhang, L. Possible Reaction Mechanisms Involved in Degradation of Patulin by Heat-Assisted Cysteine under Highly Acidic Conditions. Toxins 2022, 14, 695. [Google Scholar] [CrossRef]
- Pfeiffer, E.; Diwald, T.T.; Metzler, M. Patulin reduces glutathione level and enzyme activities in rat liver slices. Mol. Nutr. Food Res. 2005, 49, 329–336. [Google Scholar] [CrossRef]
- Farina, M.; Avila, D.S.; da Rocha, J.B.; Aschner, M. Metals, oxidative stress and neurodegeneration: A focus on iron, manganese and mercury. Neurochem. Int. 2013, 62, 575–594. [Google Scholar] [CrossRef]
- Togliatto, G.; Lombardo, G.; Brizzi, M.F. The Future Challenge of Reactive Oxygen Species (ROS) in Hypertension: From Bench to Bed Side. Int. J. Mol. Sci. 2017, 18, 1988. [Google Scholar] [CrossRef]
- Mansfield, K.D.; Simon, M.C.; Keith, B. Hypoxic reduction in cellular glutathione levels requires mitochondrial reactive oxygen species. J. Appl. Physiol. 2004, 97, 1358–1366. [Google Scholar] [CrossRef]
- Elrod, J.W.; Calvert, J.W.; Morrison, J.; Doeller, J.E.; Kraus, D.W.; Tao, L.; Jiao, X.; Scalia, R.; Kiss, L.; Szabo, C.; et al. Hydrogen sulfide attenuates myocardial ischemia-reperfusion injury by preservation of mitochondrial function. Proc. Natl. Acad. Sci. USA 2007, 104, 15560–15565. [Google Scholar] [CrossRef]
- Sun, W.H.; Liu, F.; Chen, Y.; Zhu, Y.C. Hydrogen sulfide decreases the levels of ROS by inhibiting mitochondrial complex IV and increasing SOD activities in cardiomyocytes under ischemia/reperfusion. Biochem. Biophys. Res. Commun. 2012, 421, 164–169. [Google Scholar] [CrossRef]
- Liu, B.H.; Wu, T.S.; Yu, F.Y.; Wang, C.H. Mycotoxin patulin activates the p38 kinase and JNK signaling pathways in human embryonic kidney cells. Toxicol. Sci. 2006, 89, 423–430. [Google Scholar] [CrossRef]
- Zhang, B.; Peng, X.; Li, G.; Xu, Y.; Xia, X.; Wang, Q. Oxidative stress is involved in Patulin induced apoptosis in HEK293 cells. Toxicon 2015, 94, 1–7. [Google Scholar] [CrossRef]
- Zhong, Y.; Jin, C.; Gan, J.; Wang, X.; Shi, Z.; Xia, X.; Peng, X. Apigenin attenuates patulin-induced apoptosis in HEK293 cells by modulating ROS-mediated mitochondrial dysfunction and caspase signal pathway. Toxicon 2017, 137, 106–113. [Google Scholar] [CrossRef]
- Boussabbeh, M.; Ben Salem, I.; Prola, A.; Guilbert, A.; Bacha, H.; Abid-Essefi, S.; Lemaire, C. Patulin induces apoptosis through ROS-mediated endoplasmic reticulum stress pathway. Toxicol. Sci. 2015, 144, 328–337. [Google Scholar] [CrossRef]
- Indiveri, C.; Iacobazzi, V.; Giangregorio, N.; Palmieri, F. The mitochondrial carnitine carrier protein: cDNA cloning, primary structure and comparison with other mitochondrial transport proteins. Biochem. J. 1997, 321, 713–719. [Google Scholar] [CrossRef]
- Ho, S.N.; Hunt, H.D.; Horton, R.M.; Pullen, J.K.; Pease, L.R. Site-directed mutagenesis by overlap extension using the polymerase chain reaction. Gene 1989, 77, 51–59. [Google Scholar] [CrossRef]
- Indiveri, C.; Iacobazzi, V.; Giangregorio, N.; Palmieri, F. Bacterial overexpression, purification, and reconstitution of the carnitine/acylcarnitine carrier from rat liver mitochondria. Biochem. Biophys. Res. Commun. 1998, 249, 589–594. [Google Scholar] [CrossRef]
- Wieckowski, M.R.; Giorgi, C.; Lebiedzinska, M.; Duszynski, J.; Pinton, P. Isolation of mitochondria-associated membranes and mitochondria from animal tissues and cells. Nat. Protoc. 2009, 4, 1582–1590. [Google Scholar] [CrossRef]
- Indiveri, C.; Tonazzi, A.; Giangregorio, N.; Palmieri, F. Probing the active site of the reconstituted carnitine carrier from rat liver mitochondria with sulfhydryl reagents. Eur. J. Biochem. 1995, 228, 271–278. [Google Scholar] [CrossRef] [PubMed]
- Giangregorio, N.; Pierri, C.L.; Tonazzi, A.; Incampo, G.; Tragni, V.; De Grassi, A.; Indiveri, C. Proline/Glycine residues of the PG-levels guide conformational changes along the transport cycle in the mitochondrial carnitine/acylcarnitine carrier (SLC25A20). Int. J. Biol. Macromol. 2022, 221, 1453–1465. [Google Scholar] [CrossRef] [PubMed]
- Lunetti, P.; Cappello, A.R.; Marsano, R.M.; Pierri, C.L.; Carrisi, C.; Martello, E.; Caggese, C.; Dolce, V.; Capobianco, L. Mitochondrial glutamate carriers from Drosophila melanogaster: Biochemical, evolutionary and modeling studies. Biochim. Biophys. Acta 2013, 1827, 1245–1255. [Google Scholar] [CrossRef] [PubMed]
- Todisco, S.; Di Noia, M.A.; Onofrio, A.; Parisi, G.; Punzi, G.; Redavid, G.; De Grassi, A.; Pierri, C.L. Identification of new highly selective inhibitors of the human ADP/ATP carriers by molecular docking and in vitro transport assays. Biochem. Pharm. 2016, 100, 112–132. [Google Scholar] [CrossRef]









| Experimental as [M + H]+ m/z | Theoretical m/z | Start-End a.a. | Sequence | |
|---|---|---|---|---|
| Control | Treated | |||
| 1009.49 | 1009.52 | 1009.54 | 203–211 | SVHDLSVPR |
| 1025.49 | 1025.52 | 1025.52 | 259–267 | EEGVTSLYK |
| 1025.49 | 1025.52 | 1025.54 | 159–166 | LYQEFGIR |
| 1053.56 | 1053.58 | 1053.61 | 293–301 | ILNWIAPNL |
| 1147.57 | - | 1147.61 | 136–146 | CLLQIQASSGK |
| 1153.58 | 1153.61 | 1153.63 | 158–166 | KLYQEFGIR |
| 1208.64 | 1208.66 | 1208.69 | 2–12 | AEEPKPISPLK |
| - | 1357.68 | 1357.73 | 167–178 | GFYKGTALTLMR |
| 1536.78 | 1536.81 | 1536.83 | 255–267 | ELIREEGVTSLYK |
| 1579.83 | 1579.79 | 1579.80 | 237–250 | FQTAPPGKYPNGFR |
| - | 1667.89 | 1667.95 | 220–234 | GIFNWVVAIPPDVLK |
| 1937.81 | 1937.85 | 1937.88 | 179–194 | DVPASGMYFMTYEWLK |
| 1953.81 | 1953.84 | 1953.87 | 179–194 | DVPASGMoxYFMTYEWLK |
| 2313.21 | 2313.20 | 2313.24 | 13–35 | NLLAGGFGGVCLVFVGHPLDTVK |
| - | 2456.23 | 2456.26 | 136–158 | CLLQIQASSGKNKYSGTLDCAKK |
| 2781.34 | 2781.32 | 2781.34 | 171–194 | GTALTLMRDVPASGMYFMTYEWLK |
| 3345.58 | 3345.62 | 3345.60 | 103–133 | SPEDELTYPQLFTAGMLSGVFTTGIMTPGER |
| 3361.52 | 3361.54 | 3361.59 | 103–133 | SPEDELTYPQLFTAGMoxLSGVFTTGIMTPGER |
| Coverage (%) | ||||
| 52.5 | 60.1 | |||
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Giangregorio, N.; Tonazzi, A.; Calvano, C.D.; Pierri, C.L.; Incampo, G.; Cataldi, T.R.I.; Indiveri, C. The Mycotoxin Patulin Inhibits the Mitochondrial Carnitine/Acylcarnitine Carrier (SLC25A20) by Interaction with Cys136 Implications for Human Health. Int. J. Mol. Sci. 2023, 24, 2228. https://doi.org/10.3390/ijms24032228
Giangregorio N, Tonazzi A, Calvano CD, Pierri CL, Incampo G, Cataldi TRI, Indiveri C. The Mycotoxin Patulin Inhibits the Mitochondrial Carnitine/Acylcarnitine Carrier (SLC25A20) by Interaction with Cys136 Implications for Human Health. International Journal of Molecular Sciences. 2023; 24(3):2228. https://doi.org/10.3390/ijms24032228
Chicago/Turabian StyleGiangregorio, Nicola, Annamaria Tonazzi, Cosima Damiana Calvano, Ciro Leonardo Pierri, Giovanna Incampo, Tommaso R. I. Cataldi, and Cesare Indiveri. 2023. "The Mycotoxin Patulin Inhibits the Mitochondrial Carnitine/Acylcarnitine Carrier (SLC25A20) by Interaction with Cys136 Implications for Human Health" International Journal of Molecular Sciences 24, no. 3: 2228. https://doi.org/10.3390/ijms24032228
APA StyleGiangregorio, N., Tonazzi, A., Calvano, C. D., Pierri, C. L., Incampo, G., Cataldi, T. R. I., & Indiveri, C. (2023). The Mycotoxin Patulin Inhibits the Mitochondrial Carnitine/Acylcarnitine Carrier (SLC25A20) by Interaction with Cys136 Implications for Human Health. International Journal of Molecular Sciences, 24(3), 2228. https://doi.org/10.3390/ijms24032228

