LXXLL Peptide Converts Transportan 10 to a Potent Inducer of Apoptosis in Breast Cancer Cells
Abstract
:1. Introduction
2. Results and Discussion
2.1. Results
2.1.1. Cellular Toxicity of TP10-SRC1LXXLL Peptide
2.1.2. Bioportide TP10-SRC1LXXLL Translocates to the Nucleus of MCF-7 Cells
2.1.3. TP10-SRC1LXXLL Affects Viability of Breast Cancer Cells Independently of ER-Mediated Transcription
2.1.4. Effect of TP10-SRC1LXXLL on Apoptosis
2.2. Discussion
3. Experimental Section
3.1. Peptide Synthesis, Purification and Analysis
3.2. Cell Culture
3.3. Viability Assay
3.4. Proliferation Assay
3.5. Quantitative RT-PCR
3.6. Confocal Microscopy
3.7. Detection of Apoptosis with Annexin V and 7-Amino-Actinomycin D (7-AAD) Staining
3.8. Statistical Analysis
4. Conclusions
Acknowledgments
Conflicts of Interest
- Author ContributionsK.T. developed the methods and performed optimization experiments, analyzed data, and co-wrote the manuscript. M.P. performed cell culture-related experiments. T.N. and K.P. conceived the methods. K.P. supervised the project and co-wrote the manuscript.
References
- Mohla, S.; Stearns, V.; Sathyamoorthy, N.; Rosenfeld, M.G.; Nelson, P. The biology of hormone refractory breast and prostate cancer: An NCI workshop report. Cancer Biol. Ther 2009, 8, 1975–1985. [Google Scholar]
- Chang, C.; Norris, J.D.; Gron, H.; Paige, L.A.; Hamilton, P.T.; Kenan, D.J.; Fowlkes, D.; McDonnell, D.P. Dissection of the LXXLL nuclear receptor-coactivator interaction motif using combinatorial peptide libraries: Discovery of peptide antagonists of estrogen receptors alpha and beta. Mol. Cell. Biol 1999, 19, 8226–8239. [Google Scholar]
- Heery, D.M.; Hoare, S.; Hussain, S.; Parker, M.G.; Sheppard, H. Core LXXLL motif sequences in CREB-binding protein, SRC1, and RIP140 define affinity and selectivity for steroid and retinoid receptors. J. Biol. Chem 2001, 276, 6695–6702. [Google Scholar]
- McInerney, E.M.; Rose, D.W.; Flynn, S.E.; Westin, S.; Mullen, T.M.; Krones, A.; Inostroza, J.; Torchia, J.; Nolte, R.T.; Assa-Munt, N.; et al. Determinants of coactivator LXXLL motif specificity in nuclear receptor transcriptional activation. Genes Dev 1998, 12, 3357–3368. [Google Scholar]
- York, B.; O’Malley, B.W. Steroid receptor coactivator (SRC) family: masters of systems biology. J. Biol. Chem 2010, 285, 38743–38750. [Google Scholar]
- Hong, H.; Kohli, K.; Trivedi, A.; Johnson, D.L.; Stallcup, M.R. GRIP1, a novel mouse protein that serves as a transcriptional coactivator in yeast for the hormone binding domains of steroid receptors. Proc. Natl. Acad. Sci. USA 1996, 93, 4948–4952. [Google Scholar]
- Torchia, J.; Rose, D.W.; Inostroza, J.; Kamei, Y.; Westin, S.; Glass, C.K.; Rosenfeld, M.G. The transcriptional co-activator p/CIP binds CBP and mediates nuclear-receptor function. Nature 1997, 387, 677–684. [Google Scholar]
- Onate, S.A.; Tsai, S.Y.; Tsai, M.J.; O’Malley, B.W. Sequence and characterization of a coactivator for the steroid hormone receptor superfamily. Science 1995, 270, 1354–1357. [Google Scholar]
- Heery, D.M.; Kalkhoven, E.; Hoare, S.; Parker, M.G. A signature motif in transcriptional co-activators mediates binding to nuclear receptors. Nature 1997, 387, 733–736. [Google Scholar]
- Parker, D.; Rivera, M.; Zor, T.; Henrion-Caude, A.; Radhakrishnan, I.; Kumar, A.; Shapiro, L.H.; Wright, P.E.; Montminy, M.; Brindle, P.K. Role of secondary structure in discrimination between constitutive and inducible activators. Mol. Cell. Biol 1999, 19, 5601–5607. [Google Scholar]
- Litterst, C.M.; Pfitzner, E. An LXXLL motif in the transactivation domain of STAT6 mediates recruitment of NCoA-1/SRC-1. J. Biol. Chem 2002, 277, 36052–36060. [Google Scholar]
- Lee, J.E.; Kim, K.; Sacchettini, J.C.; Smith, C.V.; Safe, S. DRIP150 coactivation of estrogen receptor alpha in ZR-75 breast cancer cells is independent of LXXLL motifs. J. Biol. Chem 2005, 280, 8819–8830. [Google Scholar]
- Zhang, J.; Fondell, J.D. Identification of mouse TRAP100: A transcriptional coregulatory factor for thyroid hormone and vitamin D receptors. Mol. Endocrinol 1999, 13, 1130–1140. [Google Scholar]
- Wang, J.C.; Stafford, J.M.; Granner, D.K. SRC-1 and GRIP1 coactivate transcription with hepatocyte nuclear factor 4. J. Biol. Chem 1998, 273, 30847–30850. [Google Scholar]
- Zhu, Y.; Qi, C.; Calandra, C.; Rao, M.S.; Reddy, J.K. Cloning and identification of mouse steroid receptor coactivator-1 (mSRC-1), as a coactivator of peroxisome proliferator-activated receptor gamma. Gene Expr 1996, 6, 185–195. [Google Scholar]
- Ding, X.F.; Anderson, C.M.; Ma, H.; Hong, H.; Uht, R.M.; Kushner, P.J.; Stallcup, M.R. Nuclear receptor-binding sites of coactivators glucocorticoid receptor interacting protein 1 (GRIP1) and steroid receptor coactivator 1 (SRC-1): Multiple motifs with different binding specificities. Mol. Endocrinol 1998, 12, 302–313. [Google Scholar]
- Zhou, G.; Cummings, R.; Li, Y.; Mitra, S.; Wilkinson, H.A.; Elbrecht, A.; Hermes, J.D.; Schaeffer, J.M.; Smith, R.G.; Moller, D.E. Nuclear receptors have distinct affinities for coactivators: Characterization by fluorescence resonance energy transfer. Mol. Endocrinol 1998, 12, 1594–1604. [Google Scholar]
- Lee, S.K.; Kim, H.J.; Na, S.Y.; Kim, T.S.; Choi, H.S.; Im, S.Y.; Lee, J.W. Steroid receptor coactivator-1 coactivates activating protein-1-mediated transactivations through interaction with the c-Jun and c-Fos subunits. J. Biol. Chem 1998, 273, 16651–16654. [Google Scholar]
- Kim, H.J.; Kim, J.H.; Lee, J.W. Steroid receptor coactivator-1 interacts with serum response factor and coactivates serum response element-mediated transactivations. J. Biol. Chem 1998, 273, 28564–28567. [Google Scholar]
- Na, S.Y.; Lee, S.K.; Han, S.J.; Choi, H.S.; Im, S.Y.; Lee, J.W. Steroid receptor coactivator-1 interacts with the p50 subunit and coactivates nuclear factor kappaB-mediated transactivations. J. Biol. Chem 1998, 273, 10831–10834. [Google Scholar]
- Myers, E.; Hill, A.D.; Kelly, G.; McDermott, E.W.; O’Higgins, N.J.; Buggy, Y.; Young, L.S. Associations and interactions between Ets-1 and Ets-2 and coregulatory proteins, SRC-1, AIB1, and NCoR in breast cancer. Clin. Cancer Res 2005, 11, 2111–2122. [Google Scholar]
- McIlroy, M.; McCartan, D.; Early, S.; Gaora, P.O.; Pennington, S.; Hill, A.D.; Young, L.S. Interaction of developmental transcription factor HOXC11 with steroid receptor coactivator SRC-1 mediates resistance to endocrine therapy in breast cancer. Cancer Res 2010, 70, 1585–1594. [Google Scholar]
- Qin, L.; Chen, X.; Wu, Y.; Feng, Z.; He, T.; Wang, L.; Liao, L.; Xu, J. Steroid receptor coactivator-1 upregulates integrin alpha(5) expression to promote breast cancer cell adhesion and migration. Cancer Res 2011, 71, 1742–1751. [Google Scholar]
- Xu, J.; Wu, R.C.; O’Malley, B.W. Normal and cancer-related functions of the p160 steroid receptor co-activator (SRC) family. Nat. Rev. Cancer 2009, 9, 615–630. [Google Scholar]
- Puigserver, P.; Adelmant, G.; Wu, Z.; Fan, M.; Xu, J.; O’Malley, B.; Spiegelman, B.M. Activation of PPARgamma coactivator-1 through transcription factor docking. Science 1999, 286, 1368–1371. [Google Scholar]
- Picard, F.; Gehin, M.; Annicotte, J.; Rocchi, S.; Champy, M.F.; O’Malley, B.W.; Chambon, P.; Auwerx, J. SRC-1 and TIF2 control energy balance between white and brown adipose tissues. Cell 2002, 111, 931–941. [Google Scholar]
- Chopra, A.R.; Louet, J.F.; Saha, P.; An, J.; Demayo, F.; Xu, J.; York, B.; Karpen, S.; Finegold, M.; Moore, D.; et al. Absence of the SRC-2 coactivator results in a glycogenopathy resembling von Gierke’s disease. Science 2008, 322, 1395–1399. [Google Scholar]
- Redmond, A.M.; Bane, F.T.; Stafford, A.T.; McIlroy, M.; Dillon, M.F.; Crotty, T.B.; Hill, A.D.; Young, L.S. Coassociation of estrogen receptor and p160 proteins predicts resistance to endocrine treatment; SRC-1 is an independent predictor of breast cancer recurrence. Clin. Cancer Res 2009, 15, 2098–2106. [Google Scholar]
- Fleming, F.J.; Myers, E.; Kelly, G.; Crotty, T.B.; McDermott, E.W.; O’Higgins, N.J.; Hill, A.D.; Young, L.S. Expression of SRC-1, AIB1, and PEA3 in HER2 mediated endocrine resistant breast cancer; a predictive role for SRC-1. J. Clin. Pathol 2004, 57, 1069–1074. [Google Scholar]
- Hudelist, G.; Czerwenka, K.; Kubista, E.; Marton, E.; Pischinger, K.; Singer, C.F. Expression of sex steroid receptors and their co-factors in normal and malignant breast tissue: AIB1 is a carcinoma-specific co-activator. Breast Cancer Res. Treat 2003, 78, 193–204. [Google Scholar]
- Agoulnik, I.U.; Vaid, A.; Bingman, W.E., 3rd; Erdeme, H.; Frolov, A.; Smith, C.L.; Ayala, G.; Ittmann, M.M.; Weigel, N.L. Role of SRC-1 in the promotion of prostate cancer cell growth and tumor progression. Cancer Res 2005, 65, 7959–7967. [Google Scholar]
- Tai, H.; Kubota, N.; Kato, S. Involvement of nuclear receptor coactivator SRC-1 in estrogen-dependent cell growth of MCF-7 cells. Biochem. Biophys. Res. Commun 2000, 267, 311–316. [Google Scholar]
- Gehin, M.; Mark, M.; Dennefeld, C.; Dierich, A.; Gronemeyer, H.; Chambon, P. The function of TIF2/GRIP1 in mouse reproduction is distinct from those of SRC-1 and p/CIP. Mol. Cell. Biol 2002, 22, 5923–5937. [Google Scholar]
- Xu, J.; Liao, L.; Ning, G.; Yoshida-Komiya, H.; Deng, C.; O’Malley, B.W. The steroid receptor coactivator SRC-3 (p/CIP/RAC3/AIB1/ACTR/TRAM-1) is required for normal growth, puberty, female reproductive function, and mammary gland development. Proc. Natl. Acad. Sci. USA 2000, 97, 6379–6384. [Google Scholar]
- Wang, Z.; Rose, D.W.; Hermanson, O.; Liu, F.; Herman, T.; Wu, W.; Szeto, D.; Gleiberman, A.; Krones, A.; Pratt, K.; et al. Regulation of somatic growth by the p160 coactivator p/CIP. Proc. Natl. Acad. Sci. USA 2000, 97, 13549–13554. [Google Scholar]
- Savkur, R.S.; Burris, T.P. The coactivator LXXLL nuclear receptor recognition motif. J. Pept. Res 2004, 63, 207–212. [Google Scholar]
- Norris, J.D.; Paige, L.A.; Christensen, D.J.; Chang, C.Y.; Huacani, M.R.; Fan, D.; Hamilton, P.T.; Fowlkes, D.M.; McDonnell, D.P. Peptide antagonists of the human estrogen receptor. Science 1999, 285, 744–746. [Google Scholar]
- Leduc, A.M.; Trent, J.O.; Wittliff, J.L.; Bramlett, K.S.; Briggs, S.L.; Chirgadze, N.Y.; Wang, Y.; Burris, T.P.; Spatola, A.F. Helix-stabilized cyclic peptides as selective inhibitors of steroid receptor-coactivator interactions. Proc. Natl. Acad. Sci. USA 2003, 100, 11273–11278. [Google Scholar]
- Geistlinger, T.R.; Guy, R.K. Novel selective inhibitors of the interaction of individual nuclear hormone receptors with a mutually shared steroid receptor coactivator 2. J. Am. Chem. Soc 2003, 125, 6852–6853. [Google Scholar]
- Rodriguez, A.L.; Tamrazi, A.; Collins, M.L.; Katzenellenbogen, J.A. Design, synthesis, and in vitro biological evaluation of small molecule inhibitors of estrogen receptor α coactivator binding. J. Med. Chem 2004, 47, 600–611. [Google Scholar]
- Zhou, H.B.; Collins, M.L.; Gunther, J.R.; Comninos, J.S.; Katzenellenbogen, J.A. Bicyclo [2.2.2] octanes: Close structural mimics of the nuclear receptor-binding motif of steroid receptor coactivators. Bioorg. Med. Chem. Lett 2007, 17, 4118–4122. [Google Scholar]
- LaFrate, A.L.; Gunther, J.R.; Carlson, K.E.; Katzenellenbogen, J.A. Synthesis and biological evaluation of guanylhydrazone coactivator binding inhibitors for the estrogen receptor. Bioorg. Med. Chem. Lett 2008, 16, 10075–10084. [Google Scholar]
- Parent, A.A.; Gunther, J.R.; Katzenellenbogen, J.A. Blocking estrogen signaling after the hormone: Pyrimidine-core inhibitors of estrogen receptor-coactivator binding. J. Med. Chem 2008, 51, 6512–6530. [Google Scholar]
- Gunther, J.R.; Moore, T.W.; Collins, M.L.; Katzenellenbogen, J.A. Amphipathic benzenes are designed inhibitors of the estrogen receptor alpha/steroid receptor coactivator interaction. ACS Chem. Biol 2008, 3, 282–286. [Google Scholar]
- Gunther, J.R.; Parent, A.A.; Katzenellenbogen, J.A. Alternative inhibition of androgen receptor signaling: Peptidomimetic pyrimidines as direct androgen receptor/coactivator disruptors. ACS Chem. Biol 2009, 4, 435–440. [Google Scholar]
- Howl, J.; Matou-Nasri, S.; West, D.C.; Farquhar, M.; Slaninova, J.; Ostenson, C.G.; Zorko, M.; Ostlund, P.; Kumar, S.; Langel, U.; et al. Bioportide: An emergent concept of bioactive cell-penetrating peptides. Cell. Mol. Life Sci 2012, 69, 2951–2966. [Google Scholar]
- El-Andaloussi, S.; Holm, T.; Langel, U. Cell-penetrating peptides: Mechanisms and applications. Curr. Pharm. Des 2005, 11, 3597–3611. [Google Scholar]
- Portoghese, P.S. Bivalent ligands and the message-address concept in the design of selective opioid receptor antagonists. Trends Pharmacol. Sci 1989, 10, 230–235. [Google Scholar]
- Soomets, U.; Lindgren, M.; Gallet, X.; Hallbrink, M.; Elmquist, A.; Balaspiri, L.; Zorko, M.; Pooga, M.; Brasseur, R.; Langel, U. Deletion analogues of transportan. Biochim. Biophys. Acta 2000, 1467, 165–176. [Google Scholar]
- Bramlett, K.S.; Wu, Y.; Burris, T.P. Ligands specify coactivator nuclear receptor (NR) box affinity for estrogen receptor subtypes. Mol. Endocrinol 2001, 15, 909–922. [Google Scholar]
- Futaki, S. Oligoarginine vectors for intracellular delivery: Design and cellular-uptake mechanisms. Biopolymers 2006, 84, 241–249. [Google Scholar]
- Jones, S.W.; Christison, R.; Bundell, K.; Voyce, C.J.; Brockbank, S.M.; Newham, P.; Lindsay, M.A. Characterisation of cell-penetrating peptide-mediated peptide delivery. Br. J. Pharmacol 2005, 145, 1093–1102. [Google Scholar]
- Madani, F.; Lindberg, S.; Langel, U.; Futaki, S.; Graslund, A. Mechanisms of cellular uptake of cell-penetrating peptides. J. Biophys 2011, 2011, 414729:1–414729:1. [Google Scholar]
- Verdurmen, W.P.; Brock, R. Biological responses towards cationic peptides and drug carriers. Trends Pharmacol. Sci 2011, 32, 116–124. [Google Scholar]
- Saar, K.; Lindgren, M.; Hansen, M.; Eiriksdottir, E.; Jiang, Y.; Rosenthal-Aizman, K.; Sassian, M.; Langel, U. Cell-penetrating peptides: A comparative membrane toxicity study. Anal. Biochem 2005, 345, 55–65. [Google Scholar]
- Jones, S.; Holm, T.; Mager, I.; Langel, U.; Howl, J. Characterization of bioactive cell penetrating peptides from human cytochrome c: Protein mimicry and the development of a novel apoptogenic agent. Chem. Biol 2010, 17, 735–744. [Google Scholar]
- Ward, B.; Seal, B.L.; Brophy, C.M.; Panitch, A. Design of a bioactive cell-penetrating peptide: When a transduction domain does more than transduce. J. Pept. Sci 2009, 15, 668–674. [Google Scholar]
- Hoskin, D.W.; Ramamoorthy, A. Studies on anticancer activities of antimicrobial peptides. Biochim. Biophys. Acta 2008, 1778, 357–375. [Google Scholar]
- Zhao, J.; Gao, P.; Xiao, W.; Fan, L.Q.; Wang, F.J.; Li, S.X.; Liu, J.W. A novel human derived cell-penetrating peptide in drug delivery. Mol. Biol. Rep 2011, 38, 2649–2656. [Google Scholar]
- Panno, M.L.; Salerno, M.; Pezzi, V.; Sisci, D.; Maggiolini, M.; Mauro, L.; Morrone, E.G.; Ando, S. Effect of oestradiol and insulin on the proliferative pattern and on oestrogen and progesterone receptor contents in MCF-7 cells. J. Cancer Res. Clin. Oncol 1996, 122, 745–749. [Google Scholar]
- Roodi, N.; Bailey, L.R.; Kao, W.Y.; Verrier, C.S.; Yee, C.J.; Dupont, W.D.; Parl, F.F. Estrogen receptor gene analysis in estrogen receptor-positive and receptor-negative primary breast cancer. J. Natl. Cancer Inst 1995, 87, 446–451. [Google Scholar]
- Ottaviano, Y.L.; Issa, J.P.; Parl, F.F.; Smith, H.S.; Baylin, S.B.; Davidson, N.E. Methylation of the estrogen receptor gene CpG island marks loss of estrogen receptor expression in human breast cancer cells. Cancer Res 1994, 54, 2552–2555. [Google Scholar]
- Quong, M.W.; Romanow, W.J.; Murre, C. E protein function in lymphocyte development. Annu. Rev. Immunol 2002, 20, 301–322. [Google Scholar]
- Massari, M.E.; Murre, C. Helix-loop-helix proteins: Regulators of transcription in eucaryotic organisms. Mol. Cell. Biol 2000, 20, 429–440. [Google Scholar]
- Lassar, A.B.; Davis, R.L.; Wright, W.E.; Kadesch, T.; Murre, C.; Voronova, A.; Baltimore, D.; Weintraub, H. Functional activity of myogenic HLH proteins requires hetero-oligomerization with E12/E47-like proteinsin vivo. Cell 1991, 66, 305–315. [Google Scholar]
- Murre, C. Role of helix-loop-helix proteins in lymphocyte development. Cold Spring Harb. Symp. Quant. Biol 1999, 64, 39–44. [Google Scholar]
- Pagliuca, A.; Gallo, P.; de Luca, P.; Lania, L. Class A helix-loop-helix proteins are positive regulators of several cyclin-dependent kinase inhibitors’ promoter activity and negatively affect cell growth. Cancer Res 2000, 60, 1376–1382. [Google Scholar]
- Zhang, Z.; Gu, J.; Gu, X. How much expression divergence after yeast gene duplication could be explained by regulatory motif evolution? Trends Genet 2004, 20, 403–407. [Google Scholar]
- Torchia, J.; Glass, C.; Rosenfeld, M.G. Co-activators and co-repressors in the integration of transcriptional responses. Curr. Opin. Cell Biol 1998, 10, 373–383. [Google Scholar]
- Jiang, P.; Hu, Q.; Ito, M.; Meyer, S.; Waltz, S.; Khan, S.; Roeder, R.G.; Zhang, X. Key roles for MED1 LxxLL motifs in pubertal mammary gland development and luminal-cell differentiation. Proc. Natl. Acad. Sci. USA 2010, 107, 6765–6770. [Google Scholar]
- Bersten, D.C.; Sullivan, A.E.; Peet, D.J.; Whitelaw, M.L. bHLH-PAS proteins in cancer. Nat. Rev. Cancer 2013, 13, 827–841. [Google Scholar]
- Karmakar, S.; Foster, E.A.; Smith, C.L. Unique roles of p160 coactivators for regulation of breast cancer cell proliferation and estrogen receptor-alpha transcriptional activity. Endocrinology 2009, 150, 1588–1596. [Google Scholar]
- Watkins, C.L.; Sayers, E.J.; Allender, C.; Barrow, D.; Fegan, C.; Brennan, P.; Jones, A.T. Co-operative membrane disruption between cell-penetrating peptide and cargo: Implications for the therapeutic use of the Bcl-2 converter peptide D-NuBCP-9-r8. Mol. Ther 2011, 19, 2124–2132. [Google Scholar]
- Kurebayashi, S.; Nakajima, T.; Kim, S.C.; Chang, C.Y.; McDonnell, D.P.; Renaud, J.P.; Jetten, A.M. Selective LXXLL peptides antagonize transcriptional activation by the retinoid-related orphan receptor RORgamma. Biochem. Biophys. Res. Commun 2004, 315, 919–927. [Google Scholar]
- Mettu, N.B.; Stanley, T.B.; Dwyer, M.A.; Jansen, M.S.; Allen, J.E.; Hall, J.M.; McDonnell, D.P. The nuclear receptor-coactivator interaction surface as a target for peptide antagonists of the peroxisome proliferator-activated receptors. Mol. Endocrinol 2007, 21, 2361–2377. [Google Scholar]
- Bhoumik, A.; Huang, T.G.; Ivanov, V.; Gangi, L.; Qiao, R.F.; Woo, S.L.; Chen, S.H.; Ronai, Z. An ATF2-derived peptide sensitizes melanomas to apoptosis and inhibits their growth and metastasis. J. Clin. Investig 2002, 110, 643–650. [Google Scholar]
- Montigiani, S.; Muller, R.; Kontermann, R.E. Inhibition of cell proliferation and induction of apoptosis by novel tetravalent peptides inhibiting DNA binding of E2F. Oncogene 2003, 22, 4943–4952. [Google Scholar]
Abbreviation | Sequence |
---|---|
TP10 | NLS-AGYLLGKINLKALAALAKKIL |
R7 | NLS-RRRRRRR |
TP10-SRC1LXXLL | NLS-AGYLLGKINLKALAALAKKIL-YSQTSHKLVQLLTTAEQQ |
R7-SRC1LXXLL | NLS-RRRRRRR-YSQTSHKLVQLLTTAEQQ |
TP10-SRC11222–1245 | NLS-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF |
R7-SRC11222–1245 | NLS-RRRRRRR-PQMQQNVFQYPGAGMVPQGEANF |
© 2014 by the authors; licensee MDPI, Basel, Switzerland This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/).
Share and Cite
Tints, K.; Prink, M.; Neuman, T.; Palm, K. LXXLL Peptide Converts Transportan 10 to a Potent Inducer of Apoptosis in Breast Cancer Cells. Int. J. Mol. Sci. 2014, 15, 5680-5698. https://doi.org/10.3390/ijms15045680
Tints K, Prink M, Neuman T, Palm K. LXXLL Peptide Converts Transportan 10 to a Potent Inducer of Apoptosis in Breast Cancer Cells. International Journal of Molecular Sciences. 2014; 15(4):5680-5698. https://doi.org/10.3390/ijms15045680
Chicago/Turabian StyleTints, Kairit, Madis Prink, Toomas Neuman, and Kaia Palm. 2014. "LXXLL Peptide Converts Transportan 10 to a Potent Inducer of Apoptosis in Breast Cancer Cells" International Journal of Molecular Sciences 15, no. 4: 5680-5698. https://doi.org/10.3390/ijms15045680
APA StyleTints, K., Prink, M., Neuman, T., & Palm, K. (2014). LXXLL Peptide Converts Transportan 10 to a Potent Inducer of Apoptosis in Breast Cancer Cells. International Journal of Molecular Sciences, 15(4), 5680-5698. https://doi.org/10.3390/ijms15045680