Layer-By-Layer Nanoparticle Vaccines Carrying the G Protein CX3C Motif Protect against RSV Infection and Disease
Abstract
:1. Introduction
2. Materials and Methods
2.1. Animals
2.2. Virus Infection
2.3. Peptide Synthesis
Peptide | Sequence of Designed Peptide a |
---|---|
CX2C c | NFVPCSICSNNPTCW-ICKRIPNKKPGKKT |
CX3C b | NFVPCSICSNNPTCWAICKRIPNKKPGKKT |
CX4C c | NFVPCSICSNNPTCWAAICKRIPNKKPGKKT |
CX5C c | NFVPCSICSNNPTCWAAAICKRIPNKKPGKKT |
CH17 b | NFVPCSICSNNPTCWDICKRIPNKKPGKKT |
B1 b | NFVPCSICGNNQLCKSICKTIPSKKPKKKP |
scramble | NCTCPINKRIFACPTSIKKPNNWSGCVPKK |
2.4. Nanoparticle Fabrication and Quality Control
LbL-NP | Peptide | Sequence of Designed Peptide a |
---|---|---|
GA2 | CX3C b | NFVPCSICSNNPTCWAICKRIPNKKPGKKT(K20Y) |
GCH17 | CH17 b | NFVPCSICSNNPTCWDICKRIPNKKPGKKT(K20Y) |
GB1 | B1 b | NFVPCSICGNNQLCKSICKTIPSKKPKKKP(K20Y) |
2.5. Vaccination
2.6. Purification of Total IgG and Passive Transfer of Antibodies
2.7. Indirect ELISA
2.8. G Protein-CX3CR1 Binding Inhibition Assay
2.9. Lung Virus Titers
2.10. ELISPOT Analysis
2.11. BAL Cell Collection
2.12. Flow Cytometry
2.13. Statistics
3. Results
3.1. Vaccination with Candidates Having Modified G Protein CX3C Motifs Induce Antibodies that Bind Poorly to the RSV G Protein
3.2. Vaccinations with Candidates Having Modified CX3C Motifs Induces Antibodies That Do Not Block G Protein-CX3CR1 Binding
3.3. LbL-NP Carrying the G Protein CX3C Motif Induce Strong Humoral and T Cell Response That Protect against RSV Infection
3.4. Antibodies Induced by G Protein CX3C Nanoparticles Vaccination Protect against RSV Replication and Disease Pathogenesis
4. Discussion
5. Conclusions
Acknowledgements
Author Contributions
Appendix
GA2 Nanoparticle | Size (d.nm): | % Number | Width (d.nm) | ||
---|---|---|---|---|---|
Z-Averge (d.nm): | 1779 | Peak 1: | 1593 | 12.9 | 261.2 |
Pdl: | 0.450 | Peak 2: | 482.0 | 87.1 | 59.96 |
Intercept: | 0.896 | Peak 3: | 0.000 | 0.0 | 0.000 |
GB1 Nanoparticle | Size (d.nm): | % Number | Width (d.nm) | ||
---|---|---|---|---|---|
Z-Averge (d.nm): | 2178 | Peak 1: | 1708 | 18.3 | 254.1 |
Pdl: | 0.496 | Peak 2: | 437.0 | 81.7 | 54.79 |
Intercept: | 0.919 | Peak 3: | 0.000 | 0.0 | 0.000 |
GH17 Nanoparticle | Size (d.nm): | % Number | Width (d.nm) | ||
---|---|---|---|---|---|
Z-Averge (d.nm): | 957.6 | Peak 1: | 697.3 | 100 | 104.3 |
Pdl: | 0.491 | Peak 2: | 0.000 | 0.0 | 0.000 |
Intercept: | 0.924 | Peak 3: | 0.000 | 0.0 | 0.000 |
Conflicts of Interest
References
- Haynes, L.M.; Jones, L.P.; Barskey, A.; Anderson, L.J.; Tripp, R.A. Enhanced disease and pulmonary eosinophilia associated with formalin-inactivated respiratory syncytial virus vaccination are linked to G glycoprotein CX3C-CX3CR1 interaction and expression of Substance P. J. Virol. 2003, 77, 9831–9844. [Google Scholar] [CrossRef] [PubMed]
- Escribano-Romero, E.; Rawling, J.; García-Barreno, B.; Melero, J.A. The soluble form of human respiratory syncytial virus attachment protein differs from the membrane-bound form in its oligomeric state but is still capable of binding to cell surface proteoglycans. J. Virol. 2004, 78, 3524–3532. [Google Scholar] [CrossRef] [PubMed]
- Martinez, I.; Dopazo, J.; Melero, J.A. Antigenic structure of the human respiratory syncytial virus G glycoprotein and relevance of hypermutation events for the generation of antigenic variants. J. Gen. Virol. 1997, 78, 2419–2429. [Google Scholar] [CrossRef] [PubMed]
- Hall, C.B.; Walsh, E.E.; Long, C.E.; Schnabel, K.C. Immunity to and frequency of reinfection with respiratory syncytial virus. J. Infect. Dis. 1991, 163, 693–698. [Google Scholar] [CrossRef] [PubMed]
- Stott, E.J.; Taylor, G.; Ball, L.A.; Anderson, K.; Young, K.K.; King, A.M.; Wertz, G.W. Immune and histopathological responses in animals vaccinated with recombinant vaccinia viruses that express individual genes of human respiratory syncytial virus. J. Virol. 1987, 61, 3855–3861. [Google Scholar] [PubMed]
- Connors, M.; Collins, P.L.; Firestone, C.Y.; Murphy, B.R. Respiratory syncytial virus (RSV) F, G, M2 (22K), and N proteins each induce resistance to RSV challenge, but resistance induced by M2 and N proteins is relatively short-lived. J. Virol. 1991, 65, 1634–1637. [Google Scholar] [PubMed]
- IMpact-RSV Study Group. Palivizumab, a humanized respiratory syncytial virus monoclonal antibody, reduces hospitalization from respiratory syncytial virus infection in high-risk infants. Pediatrics 1998, 102, 531–537. [Google Scholar]
- Feltes, T.F.; Cabalka, A.K.; Meissner, H.C.; Piazza, F.M.; Carlin, D.A.; Top, F.H., Jr.; Connor, E.M.; Sondheimer, H.M. Cardiac Synagis Study Group. Palivizumab prophylaxis reduces hospitalization due to respiratory syncytial virus in young children with hemodynamically significant congenital heart disease. J. Pediatr. 2003, 143, 532–540. [Google Scholar] [CrossRef]
- Tripp, R.A.; Moore, D.; Winter, J.; Anderson, L.J. Respiratory syncytial virus infection and G and/or SH protein expression contribute to Substance P, which mediates inflammation and enhanced pulmonary disease in BALB/c mice. J. Virol. 2000, 74, 1614–1622. [Google Scholar] [CrossRef] [PubMed]
- Becker, Y. Respiratory syncytial virus (RSV) evades the human adaptive immune system by skewing the Th1/Th2 cytokine balance toward increased levels of Th2 cytokines and IgE, markers of allergy—A review. Virus Genes 2006, 33, 235–252. [Google Scholar] [PubMed]
- Tripp, R.A.; Dakhama, A.; Jones, L.P.; Barskey, A.; Gelfand, E.W.; Anderson, L.J. The G glycoprotein of respiratory syncytial virus depresses respiratory rates through the CX3C motif and Substance P. J. Virol. 2003, 77, 6580–6584. [Google Scholar] [CrossRef] [PubMed]
- Tripp, R.A.; Jones, L.P.; Haynes, L.M.; Zheng, H.; Murphy, P.M.; Anderson, L.J. CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein. Nat. Immunol. 2001, 2, 732–738. [Google Scholar] [CrossRef] [PubMed]
- Harcourt, J.; Alvarez, R.; Jones, L.P.; Henderson, C.; Anderson, L.J.; Tripp, R.A. Respiratory syncytial virus G protein and G protein CX3C motif adversely affect CX3CR1+ T cell responses. J. Immunol. 2006, 176, 1600–1608. [Google Scholar] [CrossRef] [PubMed]
- Haynes, L.M.; Caidi, H.; Radu, G.U.; Miao, C.; Harcourt, J.L.; Tripp, R.A.; Anderson, L.J. Therapeutic monoclonal antibody treatment targeting respiratory syncytial virus (RSV) G protein mediates viral clearance and reduces the pathogenesis of RSV infection in BALB/c mice. J. Infect. Dis. 2009, 200, 439–447. [Google Scholar] [CrossRef] [PubMed]
- Miao, C.; Radu, G.U.; Caidi, H.; Tripp, R.A.; Anderson, L.J.; Haynes, L.M. Treatment with respiratory syncytial virus G glycoprotein monoclonal antibody or F(ab’)2 components mediates reduced pulmonary inflammation in mice. J. Gen. Virol. 2009, 90, 1119–1123. [Google Scholar] [CrossRef] [PubMed]
- Radu, G.U.; Caidi, H.; Miao, C.; Tripp, R.A.; Anderson, L.J.; Haynes, L.M. Prophylactic treatment with a G glycoprotein monoclonal antibody reduces pulmonary inflammation in respiratory syncytial virus (RSV)-challenged naive and formalin-inactivated RSV-immunized BALB/c mice. J. Virol. 2010, 84, 9632–9636. [Google Scholar] [CrossRef] [PubMed]
- Caidi, H.; Harcourt, J.L.; Tripp, R.A.; Anderson, L.J.; Haynes, L.M. Combination therapy using monoclonal antibodies against respiratory syncytial virus (RSV) G glycoprotein protects from RSV disease in BALB/c mice. PLoS ONE 2012, 7, e51485. [Google Scholar] [CrossRef] [PubMed]
- Boyoglu-Barnum, S.; Gaston, K.A.; Todd, S.O.; Boyoglu, C.; Chirkova, T.; Barnum, T.R.; Jorquera, P.; Haynes, L.M.; Tripp, R.A.; Moore, M.L.; et al. A respiratory syncytial virus (RSV) anti-G protein F(ab’)2 monoclonal antibody suppresses mucous production and breathing effort in RSV rA2-line19F-infected BALB/c mice. J. Virol. 2013, 87, 10955–10967. [Google Scholar] [CrossRef] [PubMed]
- Boyoglu-Barnum, S.; Todd, S.O.; Chirkova, T.; Barnum, T.R.; Gaston, K.A.; Haynes, L.M.; Tripp, R.A.; Moore, M.L.; Anderson, L.J. An anti-G protein monoclonal antibody treats RSV disease more effectively than an anti-F monoclonal antibody in BALB/c mice. Virology 2015, 483, 117–125. [Google Scholar] [CrossRef] [PubMed]
- Choi, Y.; Mason, C.S.; Jones, L.P.; Crabtree, J.; Jorquera, P.A.; Tripp, R.A. Antibodies to the central conserved region of respiratory syncytial virus (RSV) G protein block RSV G protein CX3C-CX3CR1 binding and cross-neutralize RSV A and B strains. Viral Immunol. 2012, 25, 193–203. [Google Scholar] [CrossRef] [PubMed]
- Zhang, W.; Choi, Y.; Haynes, L.M.; Harcourt, J.L.; Anderson, L.J.; Jones, L.P.; Tripp, R.A. Vaccination to induce antibodies blocking the CX3C-CX3CR1 interaction of respiratory syncytial virus G protein reduces pulmonary inflammation and virus replication in mice. J. Virol. 2010, 84, 1148–1157. [Google Scholar] [CrossRef] [PubMed]
- Jorquera, P.A.; Choi, Y.; Oakley, K.E.; Powell, T.J.; Boyd, J.G.; Palath, N.; Haynes, L.M.; Anderson, L.J.; Tripp, R.A. Nanoparticle vaccines encompassing the respiratory syncytial virus (RSV) G protein CX3C chemokine motif induce robust immunity protecting from challenge and disease. PLoS ONE 2013, 8, e74905. [Google Scholar] [CrossRef] [PubMed]
- Tripp, R.A.; Moore, D.; Jones, L.; Sullender, W.; Winter, J.; Anderson, L.J. Respiratory syncytial virus G and/or SH protein alters Th1 cytokines, natural killer cells, and neutrophils responding to pulmonary infection in BALB/c mice. J. Virol. 1999, 73, 7099–7107. [Google Scholar] [PubMed]
- Lieggi, C.C.; Artwohl, J.E.; Leszczynski, J.K.; Rodriguez, N.A.; Fickbohm, B.L.; Fortman, J.D. Efficacy and safety of stored and newly prepared tribromoethanol in ICR mice. Contemp. Top. Lab. Anim. Sci. 2005, 44, 17–22. [Google Scholar] [PubMed]
- Lieggi, C.C.; Fortman, J.D.; Kleps, R.A.; Sethi, V.; Anderson, J.A.; Brown, C.E.; Artwohl, J.E. An evaluation of preparation methods and storage conditions of tribromoethanol. Contemp. Top. Lab. Anim. Sci. 2005, 44, 11–16. [Google Scholar] [PubMed]
- Powell, T.J.; Palath, N.; DeRome, M.E.; Tang, J.; Jacobs, A.; Boyd, J.G. Synthetic nanoparticle vaccines produced by layer-by-layer assembly of artificial biofilms induce potent protective T-cell and antibody responses in vivo. Vaccine 2011, 29, 558–569. [Google Scholar] [CrossRef] [PubMed]
- Brown, R.E.; Jarvis, K.L.; Hyland, K.J. Protein measurement using bicinchoninic acid: Elimination of interfering substances. Anal. Biochem. 1989, 180, 136–139. [Google Scholar] [CrossRef]
- Stevens, W.W.; Kim, T.S.; Pujanauski, L.M.; Hao, X.; Braciale, T.J. Detection and quantitation of eosinophils in the murine respiratory tract by flow cytometry. J. Immunol. Methods 2007, 327, 63–74. [Google Scholar] [CrossRef] [PubMed]
- Delano, M.J.; Scumpia, P.O.; Weinstein, J.S.; Coco, D.; Nagaraj, S.; Kelly-Scumpia, K.M.; O’Malley, K.A.; Wynn, J.L.; Antonenko, S.; Al-Quran, S.Z.; et al. MyD88-dependent expansion of an immature GR-1(+)CD11b(+) population induces T cell suppression and Th2 polarization in sepsis. J. Exp. Med. 2007, 204, 1463–1474. [Google Scholar] [CrossRef]
- Ajibade, A.A.; Wang, Q.; Cui, J.; Zou, J.; Xia, X.; Wang, M.; Tong, Y.; Hui, W.; Liu, D.; Su, B.; et al. TAK1 negatively regulates NF-kappaB and p38 MAP kinase activation in Gr-1+CD11b+ neutrophils. Immunity 2012, 36, 43–54. [Google Scholar] [CrossRef] [PubMed]
- Harcourt, J.L.; Karron, R.A.; Tripp, R.A. Anti-G protein antibody responses to respiratory syncytial virus infection or vaccination are associated with inhibition of G protein CX3C-CX3CR1 binding and leukocyte chemotaxis. J. Infect. Dis. 2004, 190, 1936–1940. [Google Scholar] [CrossRef] [PubMed]
- Boyoglu-Barnum, S.; Chirkova, T.; Todd, S.O.; Barnum, T.R.; Gaston, K.A.; Jorquera, P.; Haynes, L.M.; Tripp, R.A.; Moore, M.L.; Anderson, L.J. Prophylaxis with a respiratory syncytial virus (RSV) anti-G protein monoclonal antibody shifts the adaptive immune response to RSV rA2-line19F infection from Th2 to Th1 in BALB/c mice. J. Virol. 2014, 88, 10569–10583. [Google Scholar] [CrossRef] [PubMed]
- Tripp, R.A.; Oshansky, C.; Alvarez, R. Cytokines and respiratory syncytial virus infection. Proc. Am. Thorac. Soc. 2005, 2, 147–149. [Google Scholar] [CrossRef] [PubMed]
- Chirkova, T.; Boyoglu-Barnum, S.; Gaston, K.A.; Malik, F.M.; Trau, S.P.; Oomens, A.G.; Anderson, L.J. Respiratory syncytial virus G protein CX3C motif impairs human airway epithelial and immune cell responses. J. Virol. 2013, 87, 13466–13479. [Google Scholar] [CrossRef] [PubMed]
- Powell, T.J.; Tang, J.; Derome, M.E.; Mitchell, R.A.; Jacobs, A.; Deng, Y.; Palath, N.; Cardenas, E.; Boyd, J.G.; Nardin, E. Plasmodium falciparum synthetic LbL microparticle vaccine elicits protective neutralizing antibody and parasite-specific cellular immune responses. Vaccine 2013, 31, 1898–1904. [Google Scholar] [CrossRef] [PubMed]
- Del Guercio, M.F.; Alexander, J.; Kubo, R.T.; Arrhenius, T.; Maewal, A.; Appella, E.; Hoffman, S.L.; Jones, T.; Valmori, D.; Sakaguchi, K.; et al. Potent immunogenic short linear peptide constructs composed of B cell epitopes and Pan DR T helper epitopes (PADRE) for antibody responses in vivo. Vaccine 1997, 15, 441–448. [Google Scholar] [CrossRef]
- Audran, R.; Peter, K.; Dannull, J.; Men, Y.; Scandella, E.; Groettrup, M.; Gander, B.; Corradin, G. Encapsulation of peptides in biodegradable microspheres prolongs their MHC class-I presentation by dendritic cells and macrophages in vitro. Vaccine 2003, 21, 1250–1255. [Google Scholar] [CrossRef]
- Uto, T.; Wang, X.; Sato, K.; Haraguchi, M.; Akagi, T.; Akashi, M.; Baba, M. Targeting of antigen to dendritic cells with poly(gamma-glutamic acid) nanoparticles induces antigen-specific humoral and cellular immunity. J. Immunol. 2007, 178, 2979–2986. [Google Scholar] [CrossRef] [PubMed]
- Yang, Y.W.; Hsu, P.Y. The effect of poly(d,l-lactide-co-glycolide) microparticles with polyelectrolyte self-assembled multilayer surfaces on the cross-presentation of exogenous antigens. Biomaterials 2008, 29, 2516–2526. [Google Scholar] [CrossRef] [PubMed]
- Kwon, Y.J.; Standley, S.M.; Goh, S.L.; Fréchet, J.M. Enhanced antigen presentation and immunostimulation of dendritic cells using acid-degradable cationic nanoparticles. J. Control. Release 2005, 105, 199–212. [Google Scholar] [CrossRef] [PubMed]
- Su, L.; Zhang, W.; Wu, X.; Zhang, Y.; Chen, X.; Liu, G.; Chen, G.; Jiang, M. Glycocalyx-mimicking nanoparticles for stimulation and polarization of macrophages via specific interactions. Small 2015, 11, 4191–4200. [Google Scholar] [CrossRef] [PubMed]
- Kuhn, D.A.; Vanhecke, D.; Michen, B.; Blank, F.; Gehr, P.; Petri-Fink, A.; Rothen-Rutishauser, B. Different endocytotic uptake mechanisms for nanoparticles in epithelial cells and macrophages. Beilstein J. Nanotechnol. 2014, 5, 1625–1636. [Google Scholar] [CrossRef] [PubMed]
- Manolova, V.; Flace, A.; Bauer, M.; Schwarz, K.; Saudan, P.; Bachmann, M.F. Nanoparticles target distinct dendritic cell populations according to their size. Eur. J. Immunol. 2008, 38, 1404–1413. [Google Scholar] [CrossRef] [PubMed]
© 2015 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Jorquera, P.A.; Oakley, K.E.; Powell, T.J.; Palath, N.; Boyd, J.G.; Tripp, R.A. Layer-By-Layer Nanoparticle Vaccines Carrying the G Protein CX3C Motif Protect against RSV Infection and Disease. Vaccines 2015, 3, 829-849. https://doi.org/10.3390/vaccines3040829
Jorquera PA, Oakley KE, Powell TJ, Palath N, Boyd JG, Tripp RA. Layer-By-Layer Nanoparticle Vaccines Carrying the G Protein CX3C Motif Protect against RSV Infection and Disease. Vaccines. 2015; 3(4):829-849. https://doi.org/10.3390/vaccines3040829
Chicago/Turabian StyleJorquera, Patricia A., Katie E. Oakley, Thomas J. Powell, Naveen Palath, James G. Boyd, and Ralph A. Tripp. 2015. "Layer-By-Layer Nanoparticle Vaccines Carrying the G Protein CX3C Motif Protect against RSV Infection and Disease" Vaccines 3, no. 4: 829-849. https://doi.org/10.3390/vaccines3040829
APA StyleJorquera, P. A., Oakley, K. E., Powell, T. J., Palath, N., Boyd, J. G., & Tripp, R. A. (2015). Layer-By-Layer Nanoparticle Vaccines Carrying the G Protein CX3C Motif Protect against RSV Infection and Disease. Vaccines, 3(4), 829-849. https://doi.org/10.3390/vaccines3040829