Genomic Identification, Evolution, and Expression Analysis of Bromodomain Genes Family in Buffalo
Abstract
:1. Introduction
2. Materials and Methods
2.1. Identification of the BRD Genes in Buffalo
2.2. Sequence Analysis of BRD Family
2.3. Comparative Transcriptomic Analysis of SCs
2.4. Isolation of SCs from Buffalo Testicular Material
2.5. Real-Time Quantitative PCR
2.6. Statistical Analysis
3. Results
3.1. Identification of BRD Genes and Proteins
3.2. Sequence Analysis of Buffalo BRD Family
3.3. Chromosomal Distribution and Collinearity Analysis of BRD Genes
3.4. Comparative Transcriptional Analysis of BRD Genes in SCs
4. Discussion
4.1. Physiochemical Properties and Phylogenetic Analysis of BRD Families
4.2. Sequence and Structure Analysis of BRD Family
4.3. Chromosomal Distribution and Collinearity Analysis of BRD Genes
4.4. Expression Analysis of BRD Genes in Immature and Mature SCs
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Haynes, S.R.; Dollard, C.; Winston, F.; Beck, S.; Trowsdale, J.; Dawid, I.B. The bromodomain: A conserved sequence found in human, Drosophila and yeast proteins. Nucleic Acids Res. 1992, 20, 2603. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jeanmougin, F.; Wurtz, J.M.; Le Douarin, B.; Chambon, P.; Losson, R. The bromodomain revisited. Trends Biochem. Sci. 1997, 22, 151–153. [Google Scholar] [CrossRef]
- Tamkun, J.W.; Deuring, R.; Scott, M.P.; Kissinger, M.; Pattatucci, A.M.; Kaufman, T.C.; Kennison, J.A. brahma: A regulator of Drosophila homeotic genes structurally related to the yeast transcriptional activator SNF2/SWI2. Cell 1992, 68, 561–572. [Google Scholar] [CrossRef]
- Filippakopoulos, P.; Picaud, S.; Mangos, M.; Keates, T.; Lambert, J.-P.; Barsyte-Lovejoy, D.; Felletar, I.; Volkmer, R.; Müller, S.; Pawson, T.; et al. Histone recognition and large-scale structural analysis of the human bromodomain family. Cell 2012, 149, 214–231. [Google Scholar] [CrossRef] [Green Version]
- Dhalluin, C.; Carlson, J.E.; Zeng, L.; He, C.; Aggarwal, A.K.; Zhou, M.M. Structure and ligand of a histone acetyltransferase bromodomain. Nature 1999, 399, 491–496. [Google Scholar] [CrossRef] [PubMed]
- Fujisawa, T.; Filippakopoulos, P. Functions of bromodomain-containing proteins and their roles in homeostasis and cancer. Nat. Rev. Mol. Cell Biol. 2017, 18, 246–262. [Google Scholar] [CrossRef]
- Shang, E.; Salazar, G.; Crowley, T.E.; Wang, X.; Lopez, R.A.; Wang, X.; Wolgemuth, D.J. Identification of unique, differentiation stage-specific patterns of expression of the bromodomain-containing genes Brd2, Brd3, Brd4, and Brdt in the mouse testis. Gene Expr. Patterns 2004, 4, 513–519. [Google Scholar] [CrossRef]
- Kim, M.-S.; Pinto, S.M.; Getnet, D.; Nirujogi, R.S.; Manda, S.S.; Chaerkady, R.; Madugundu, A.K.; Kelkar, D.S.; Isserlin, R.; Jain, S.; et al. A draft map of the human proteome. Nature 2014, 509, 575–581. [Google Scholar] [CrossRef] [Green Version]
- Wilhelm, M.; Schlegl, J.; Hahne, H.; Gholami, A.M.; Lieberenz, M.; Savitski, M.M.; Ziegler, E.; Butzmann, L.; Gessulat, S.; Marx, H.; et al. Mass-spectrometry-based draft of the human proteome. Nature 2014, 509, 582–587. [Google Scholar] [CrossRef] [PubMed]
- Wang, N.; Wu, R.; Tang, D.; Kang, R. The BET family in immunity and disease. Signal Transduct. Target. Ther. 2021, 6, 23. [Google Scholar] [CrossRef]
- Muller, S.; Filippakopoulos, P.; Knapp, S. Bromodomains as therapeutic targets. Expert Rev. Mol. Med. 2011, 13, e29. [Google Scholar] [CrossRef] [Green Version]
- Belkina, A.C.; Denis, G. V BET domain co-regulators in obesity, inflammation and cancer. Nat. Rev. Cancer 2012, 12, 465–477. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wang, C.Y.; Filippakopoulos, P. Beating the odds: BETs in disease. Trends Biochem. Sci. 2015, 40, 468–479. [Google Scholar] [CrossRef]
- Gaucher, J.; Boussouar, F.; Montellier, E.; Curtet, S.; Buchou, T.; Bertrand, S.; Hery, P.; Jounier, S.; Depaux, A.; Vitte, A.-L.; et al. Bromodomain-dependent stage-specific male genome programming by Brdt. EMBO J. 2012, 31, 3809–3820. [Google Scholar] [CrossRef] [Green Version]
- Chavez, D.R.; Lee, P.-C.; Comizzoli, P. Oocyte Meiotic Competence in the Domestic Cat Model: Novel Roles for Nuclear Proteins BRD2 and NPM1. Front. Cell Dev. Biol. 2021, 9, 670021. [Google Scholar] [CrossRef] [PubMed]
- Florence, B.; Faller, D. V You bet-cha: A novel family of transcriptional regulators. Front Biosci. 2001, 6, D1008-18. [Google Scholar] [CrossRef]
- Bryant, J.M.; Berger, S.L. Low-hanging fruit: Targeting Brdt in the testes. EMBO J. 2012, 31, 3788–3789. [Google Scholar] [CrossRef] [Green Version]
- Berkovits, B.D.; Wolgemuth, D.J. The role of the double bromodomain-containing BET genes during mammalian spermatogenesis. Curr. Top. Dev. Biol. 2013, 102, 293–326. [Google Scholar] [CrossRef] [Green Version]
- Matzuk, M.M.; McKeown, M.R.; Filippakopoulos, P.; Li, Q.; Ma, L.; Agno, J.E.; Lemieux, M.E.; Picaud, S.; Yu, R.N.; Qi, J.; et al. Small-molecule inhibition of BRDT for male contraception. Cell 2012, 150, 673–684. [Google Scholar] [CrossRef] [Green Version]
- França, L.R.; Hess, R.A.; Dufour, J.M.; Hofmann, M.C.; Griswold, M.D. The Sertoli cell: One hundred fifty years of beauty and plasticity. Andrology 2016, 4, 189–212. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ni, F.-D.; Hao, S.-L.; Yang, W.-X. Multiple signaling pathways in Sertoli cells: Recent findings in spermatogenesis. Cell Death Dis. 2019, 10, 541. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cheung, K.L.; Kim, C.; Zhou, M.-M. The Functions of BET Proteins in Gene Transcription of Biology and Diseases. Front. Mol. Biosci. 2021, 8, 728777. [Google Scholar] [CrossRef]
- Du, C.; Deng, T.; Zhou, Y.; Ye, T.; Zhou, Z.; Zhang, S.; Shao, B.; Wei, P.; Sun, H.; Khan, F.A.; et al. Systematic analyses for candidate genes of milk production traits in water buffalo (Bubalus bubalis). Anim. Genet. 2019, 50, 207–216. [Google Scholar] [CrossRef] [PubMed]
- Vohra, V.; Chhotaray, S.; Gowane, G.; Alex, R.; Mukherjee, A.; Verma, A.; Deb, S.M. Genome-Wide Association Studies in Indian Buffalo Revealed Genomic Regions for Lactation and Fertility. Front. Genet. 2021, 12, 696109. [Google Scholar] [CrossRef]
- Rehman, S.U.; Hassan, F.; Luo, X.; Li, Z.; Liu, Q. Whole-Genome Sequencing and Characterization of Buffalo Genetic Resources: Recent Advances and Future Challenges. Animals 2021, 11, 904. [Google Scholar] [CrossRef]
- Liu, J.; Wang, Z.; Li, J.; Li, H.; Yang, L. Genome-wide identification of Diacylglycerol Acyltransferases (DGAT) family genes influencing Milk production in Buffalo. BMC Genet. 2020, 21, 26. [Google Scholar] [CrossRef] [Green Version]
- Lu, X.; Duan, A.; Liang, S.; Ma, X.; Deng, T. Genomic Identification, Evolution, and Expression Analysis of Collagen Genes Family in Water Buffalo during Lactation. Genes 2020, 11, 515. [Google Scholar] [CrossRef] [PubMed]
- Rehman, S.U.; Nadeem, A.; Javed, M.; Hassan, F.-U.; Luo, X.; Khalid, R.B.; Liu, Q. Genomic Identification, Evolution and Sequence Analysis of the Heat-Shock Protein Gene Family in Buffalo. Genes 2020, 11, 1388. [Google Scholar] [CrossRef]
- Low, W.Y.; Tearle, R.; Bickhart, D.M.; Rosen, B.D.; Kingan, S.B.; Swale, T.; Thibaud-Nissen, F.; Murphy, T.D.; Young, R.; Lefevre, L.; et al. Chromosome-level assembly of the water buffalo genome surpasses human and goat genomes in sequence contiguity. Nat. Commun. 2019, 10, 260. [Google Scholar] [CrossRef] [Green Version]
- Williams, J.L.; Iamartino, D.; Pruitt, K.D.; Sonstegard, T.; Smith, T.P.L.; Low, W.Y.; Biagini, T.; Bomba, L.; Capomaccio, S.; Castiglioni, B.; et al. Genome assembly and transcriptome resource for river buffalo, Bubalus bubalis (2n = 50). Gigascience 2017, 6, gix088. [Google Scholar] [CrossRef] [Green Version]
- Mintoo, A.A.; Zhang, H.; Chen, C.; Moniruzzaman, M.; Deng, T.; Anam, M.; Emdadul Huque, Q.M.; Guang, X.; Wang, P.; Zhong, Z.; et al. Draft genome of the river water buffalo. Ecol. Evol. 2019, 9, 3378–3388. [Google Scholar] [CrossRef] [PubMed]
- Deng, T.; Pang, C.; Lu, X.; Zhu, P.; Duan, A.; Tan, Z.; Huang, J.; Li, H.; Chen, M.; Liang, X. De Novo Transcriptome Assembly of the Chinese Swamp Buffalo by RNA Sequencing and SSR Marker Discovery. PLoS ONE 2016, 11, e0147132. [Google Scholar] [CrossRef] [Green Version]
- Potter, S.C.; Luciani, A.; Eddy, S.R.; Park, Y.; Lopez, R.; Finn, R.D. HMMER web server: 2018 update. Nucleic Acids Res. 2018, 46, W200–W204. [Google Scholar] [CrossRef] [Green Version]
- Finn, R.D.; Clements, J.; Eddy, S.R. HMMER web server: Interactive sequence similarity searching. Nucleic Acids Res. 2011, 39, W29–W37. [Google Scholar] [CrossRef] [Green Version]
- Prakash, A.; Jeffryes, M.; Bateman, A.; Finn, R.D. The HMMER Web Server for Protein Sequence Similarity Search. Curr. Protoc. Bioinforma. 2017, 60, 3.15.1–3.15.23. [Google Scholar] [CrossRef] [PubMed]
- Kumar, S.; Stecher, G.; Li, M.; Knyaz, C.; Tamura, K. MEGA X: Molecular Evolutionary Genetics Analysis across Computing Platforms. Mol. Biol. Evol. 2018, 35, 1547–1549. [Google Scholar] [CrossRef]
- Gasteiger, E.; Gattiker, A.; Hoogland, C.; Ivanyi, I.; Appel, R.D.; Bairoch, A. ExPASy: The proteomics server for in-depth protein knowledge and analysis. Nucleic Acids Res. 2003, 31, 3784–3788. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Artimo, P.; Jonnalagedda, M.; Arnold, K.; Baratin, D.; Csardi, G.; De Castro, E.; Duvaud, S.; Flegel, V.; Fortier, A.; Gasteiger, E.; et al. ExPASy: SIB bioinformatics resource portal. Nucleic Acids Res. 2012, 40, W597–W603. [Google Scholar] [CrossRef]
- Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools: An Integrative Toolkit Developed for Interactive Analyses of Big Biological Data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar] [CrossRef]
- Hu, B.; Jin, J.; Guo, A.-Y.; Zhang, H.; Luo, J.; Gao, G. GSDS 2.0: An upgraded gene feature visualization server. Bioinformatics 2015, 31, 1296–1297. [Google Scholar] [CrossRef] [Green Version]
- Bailey, T.L.; Gribskov, M. Combining evidence using p-values: Application to sequence homology searches. Bioinformatics 1998, 14, 48–54. [Google Scholar] [CrossRef] [Green Version]
- Bailey, T.L.; Williams, N.; Misleh, C.; Li, W.W. MEME: Discovering and analyzing DNA and protein sequence motifs. Nucleic Acids Res. 2006, 34, W369–W373. [Google Scholar] [CrossRef] [PubMed]
- Bailey, T.L.; Boden, M.; Buske, F.A.; Frith, M.; Grant, C.E.; Clementi, L.; Ren, J.; Li, W.W.; Noble, W.S. MEME SUITE: Tools for motif discovery and searching. Nucleic Acids Res. 2009, 37, W202–W208. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Tang, H.; Debarry, J.D.; Tan, X.; Li, J.; Wang, X.; Lee, T.; Jin, H.; Marler, B.; Guo, H.; et al. MCScanX: A toolkit for detection and evolutionary analysis of gene synteny and collinearity. Nucleic Acids Res. 2012, 40, e49. [Google Scholar] [CrossRef] [Green Version]
- Wang, Y.; Li, J.; Paterson, A.H. MCScanX-transposed: Detecting transposed gene duplications based on multiple colinearity scans. Bioinformatics 2013, 29, 1458–1460. [Google Scholar] [CrossRef] [Green Version]
- Zheng, G.X.Y.; Terry, J.M.; Belgrader, P.; Ryvkin, P.; Bent, Z.W.; Wilson, R.; Ziraldo, S.B.; Wheeler, T.D.; McDermott, G.P.; Zhu, J.; et al. Massively parallel digital transcriptional profiling of single cells. Nat. Commun. 2017, 8, 14049. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Butler, A.; Hoffman, P.; Smibert, P.; Papalexi, E.; Satija, R. Integrating single-cell transcriptomic data across different conditions, technologies, and species. Nat. Biotechnol. 2018, 36, 411–420. [Google Scholar] [CrossRef]
- Zhang, P.; He, W.; Huang, Y.; Xiao, K.; Tang, Y.; Huang, L.; Huang, X.; Zhang, J.; Yang, W.; Liu, R.; et al. Proteomic and phosphoproteomic profiles of Sertoli cells in buffalo. Theriogenology 2021, 170, 1–14. [Google Scholar] [CrossRef] [PubMed]
- Kala, S.; Kaushik, R.; Singh, K.P.; Kadam, P.H.; Singh, M.K.; Manik, R.S.; Singla, S.K.; Palta, P.; Chauhan, M.S. In vitro culture and morphological characterization of prepubertal buffalo (Bubalus bubalis) putative spermatogonial stem cell. J. Assist. Reprod. Genet. 2012, 29, 1335–1342. [Google Scholar] [CrossRef] [Green Version]
- Pramod, R.K.; Mitra, A. In vitro culture and characterization of spermatogonial stem cells on Sertoli cell feeder layer in goat (Capra hircus). J. Assist. Reprod. Genet. 2014, 31, 993–1001. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, T.T.; Geng, S.S.; Xu, H.Y.; Luo, A.L.; Zhao, P.W.; Yang, H.; Liang, X.W.; Lu, Y.Q.; Yang, X.G.; Lu, K.H. Effects of different culture systems on the culture of prepuberal buffalo (Bubalus bubalis) spermatogonial stem cell-like cells in vitro. J. Vet. Sci. 2020, 21, e13. [Google Scholar] [CrossRef]
- Zhang, H.; Liu, B.; Qiu, Y.; Fan, J.F.; Yu, S.J. Pure cultures and characterization of yak Sertoli cells. Tissue Cell 2013, 45, 414–420. [Google Scholar] [CrossRef]
- Barber, R.D.; Harmer, D.W.; Coleman, R.A.; Clark, B.J. GAPDH as a housekeeping gene: Analysis of GAPDH mRNA expression in a panel of 72 human tissues. Physiol. Genom. 2005, 21, 389–395. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, Q.; Domig, K.J.; Ettle, T.; Windisch, W.; Mair, C.; Schedle, K. Evaluation of potential reference genes for relative quantification by RT-qPCR in different porcine tissues derived from feeding studies. Int. J. Mol. Sci. 2011, 12, 1727–1734. [Google Scholar] [CrossRef] [Green Version]
- Klein, C.; Rutllant, J.; Troedsson, M.H. Expression stability of putative reference genes in equine endometrial, testicular, and conceptus tissues. BMC Res. Notes 2011, 4, 120. [Google Scholar] [CrossRef] [Green Version]
- Gong, Z.-K.; Wang, S.-J.; Huang, Y.-Q.; Zhao, R.-Q.; Zhu, Q.-F.; Lin, W.-Z. Identification and validation of suitable reference genes for RT-qPCR analysis in mouse testis development. Mol. Genet. Genom. 2014, 289, 1157–1169. [Google Scholar] [CrossRef] [PubMed]
- Livak, K.J.; Schmittgen, T.D. Analysis of Relative Gene Expression Data Using Real-Time Quantitative PCR and the 2−ΔΔCT Method. Methods 2001, 25, 402–408. [Google Scholar] [CrossRef]
- Curtis, S.K.; Amann, R.P. Testicular Development and Establishment of Spermatogenesis in Holstein Bulls. J. Anim. Sci. 1981, 53, 1645–1657. [Google Scholar] [CrossRef] [PubMed]
- Rawlings, N.; Evans, A.C.O.; Chandolia, R.K.; Bagu, E.T. Sexual Maturation in the Bull. Reprod. Domest. Anim. 2008, 43, 295–301. [Google Scholar] [CrossRef]
- Filippakopoulos, P.; Qi, J.; Picaud, S.; Shen, Y.; Smith, W.B.; Fedorov, O.; Morse, E.M.; Keates, T.; Hickman, T.T.; Felletar, I.; et al. Selective inhibition of BET bromodomains. Nature 2010, 468, 1067–1073. [Google Scholar] [CrossRef] [Green Version]
- Nakamura, T.; Blechman, J.; Tada, S.; Rozovskaia, T.; Itoyama, T.; Bullrich, F.; Mazo, A.; Croce, C.M.; Geiger, B.; Canaani, E. huASH1 protein, a putative transcription factor encoded by a human homologue of the Drosophila ash1 gene, localizes to both nuclei and cell-cell tight junctions. Proc. Natl. Acad. Sci. USA 2000, 97, 7284–7289. [Google Scholar] [CrossRef] [Green Version]
- Freeling, M. Bias in Plant Gene Content Following Different Sorts of Duplication: Tandem, Whole-Genome, Segmental, or by Transposition. Annu. Rev. Plant Biol. 2009, 60, 433–453. [Google Scholar] [CrossRef]
- Conant, G.C.; Wolfe, K.H. Turning a hobby into a job: How duplicated genes find new functions. Nat. Rev. Genet. 2008, 9, 938–950. [Google Scholar] [CrossRef]
- He, X.; Zhang, J. Gene Complexity and Gene Duplicability. Curr. Biol. 2005, 15, 1016–1021. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Liu, G.E.; Ventura, M.; Cellamare, A.; Chen, L.; Cheng, Z.; Zhu, B.; Li, C.; Song, J.; Eichler, E.E. Analysis of recent segmental duplications in the bovine genome. BMC Genom. 2009, 10, 571. [Google Scholar] [CrossRef] [Green Version]
- Cheung, J.; Wilson, M.D.; Zhang, J.; Khaja, R.; MacDonald, J.R.; Heng, H.H.Q.; Koop, B.F.; Scherer, S.W. Recent segmental and gene duplications in the mouse genome. Genome Biol. 2003, 4, R47. [Google Scholar] [CrossRef] [Green Version]
- Dennis, M.Y.; Eichler, E.E. Human adaptation and evolution by segmental duplication. Curr. Opin. Genet. Dev. 2016, 41, 44–52. [Google Scholar] [CrossRef] [Green Version]
- Bovine Genome, S.; Analysis, C.; Elsik, C.G.; Tellam, R.L.; Worley, K.C.; Gibbs, R.A.; Muzny, D.M.; Weinstock, G.M.; Adelson, D.L.; Eichler, E.E.; et al. The genome sequence of taurine cattle: A window to ruminant biology and evolution. Science 2009, 324, 522–528. [Google Scholar] [CrossRef] [Green Version]
- Sharpe, R.M.; McKinnell, C.; Kivlin, C.; Fisher, J.S. Proliferation and functional maturation of Sertoli cells, and their relevance to disorders of testis function in adulthood. Reproduction 2003, 125, 769–784. [Google Scholar] [CrossRef] [PubMed]
- Berndtson, W.E.; Igboeli, G.; Parker, W.G. The Numbers of Sertoli Cells in Mature Holstein Bulls and their Relationship to Quantitative Aspects of Spermatogenesis1. Biol. Reprod. 1987, 37, 60–67. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Orth, J.M.; Gunsalus, G.L.; Lamperti, A.A. Evidence from Sertoli Cell-Depleted Rats Indicates That Spermatid Number in Adults Depends on Numbers of Sertoli Cells Produced During Perinatal Development. Endocrinology 1988, 122, 787–794. [Google Scholar] [CrossRef]
- Denis, G.V.; McComb, M.E.; Faller, D.V.; Sinha, A.; Romesser, P.B.; Costello, C.E. Identification of transcription complexes that contain the double bromodomain protein Brd2 and chromatin remodeling machines. J. Proteome Res. 2006, 5, 502–511. [Google Scholar] [CrossRef] [Green Version]
- Nakamura, Y.; Umehara, T.; Nakano, K.; Jang, M.K.; Shirouzu, M.; Morita, S.; Uda-Tochio, H.; Hamana, H.; Terada, T.; Adachi, N.; et al. Crystal structure of the human BRD2 bromodomain: Insights into dimerization and recognition of acetylated histone H4. J. Biol. Chem. 2007, 282, 4193–4201. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lamonica, J.M.; Deng, W.; Kadauke, S.; Campbell, A.E.; Gamsjaeger, R.; Wang, H.; Cheng, Y.; Billin, A.N.; Hardison, R.C.; Mackay, J.P.; et al. Bromodomain protein Brd3 associates with acetylated GATA1 to promote its chromatin occupancy at erythroid target genes. Proc. Natl. Acad. Sci. USA 2011, 108, E159–E168. [Google Scholar] [CrossRef] [Green Version]
- Jang, M.K.; Mochizuki, K.; Zhou, M.; Jeong, H.-S.; Brady, J.N.; Ozato, K. The Bromodomain Protein Brd4 Is a Positive Regulatory Component of P-TEFb and Stimulates RNA Polymerase II-Dependent Transcription. Mol. Cell 2005, 19, 523–534. [Google Scholar] [CrossRef] [PubMed]
- Wilson, B.G.; Roberts, C.W.M. SWI/SNF nucleosome remodellers and cancer. Nat. Rev. Cancer 2011, 11, 481–492. [Google Scholar] [CrossRef]
- Kadoch, C.; Hargreaves, D.C.; Hodges, C.; Elias, L.; Ho, L.; Ranish, J.; Crabtree, G.R. Proteomic and bioinformatic analysis of mammalian SWI/SNF complexes identifies extensive roles in human malignancy. Nat. Genet. 2013, 45, 592–601. [Google Scholar] [CrossRef] [PubMed]
- Podcheko, A.; Northcott, P.; Bikopoulos, G.; Lee, A.; Bommareddi, S.R.; Kushner, J.A.; Farhang-Fallah, J.; Rozakis-Adcock, M. Identification of a WD40 repeat-containing isoform of PHIP as a novel regulator of beta-cell growth and survival. Mol. Cell. Biol. 2007, 27, 6484–6496. [Google Scholar] [CrossRef] [Green Version]
- Li, S.; Francisco, A.B.; Han, C.; Pattabiraman, S.; Foote, M.R.; Giesy, S.L.; Wang, C.; Schimenti, J.C.; Boisclair, Y.R.; Long, Q. The full-length isoform of the mouse pleckstrin homology domain-interacting protein (PHIP) is required for postnatal growth. FEBS Lett. 2010, 584, 4121–4127. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kimura, J.; Nguyen, S.T.; Liu, H.; Taira, N.; Miki, Y.; Yoshida, K. A functional genome-wide RNAi screen identifies TAF1 as a regulator for apoptosis in response to genotoxic stress. Nucleic Acids Res. 2008, 36, 5250–5259. [Google Scholar] [CrossRef] [PubMed]
- Wang, D.; Qi, H.; Zhang, H.; Zhou, W.; Li, Y.; Li, A.; Liu, Q.; Wang, Y. TAF1L promotes development of oral squamous cell carcinoma via decreasing autophagy-dependent apoptosis. Int. J. Biol. Sci. 2020, 16, 1180–1193. [Google Scholar] [CrossRef] [PubMed]
Motif | Protein Sequence | Length | Pfam Domain |
---|---|---|---|
MEME-1 | APDYYKIIKKPMDLSTIKERLENNYYQS | 28 | BRD |
MEME-2 | FVADVRLIFSNCRKYNPPDSEVYKAAKKL | 29 | BRD |
MEME-3 | QLKHCSGILKEMLSKKHAAYAWPFYKPVDVEALGLHDYHDIIKHPMDLST | 50 | BRD |
MEME-4 | ASECIQDFNTMFTNCYIYNKPGDDIVLMAQALEKJFLQKVAQMPQEE | 47 | BRD |
MEME-5 | PMSYDEKRQLSLDINKLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFET | 50 | BET |
MEME-6 | DAVCCVCLDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRRCLQ | 50 | ___ |
MEME-7 | NPPPPEVSNPKKPGRLTNQLQYLQKVVLKALWKHQFAWPFQQPVDAVKLN | 50 | ___ |
MEME-8 | VCFANTVFLEPIDGIDNIPPARWKLTCYICKQKGVGACIQCHKANCYTAF | 50 | ___ |
MEME-9 | HFACTDSHGHLLIFGFGCSKPYEKIPDQMFFHTDYRPLIRDANNYVLDEQ | 50 | ___ |
MEME-10 | RGHSAEISDMAVNYENTMIAAGSCDKIIRVWCLRTCAPVAVLQGHSASIT | 50 | ___ |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Zhang, J.; Huang, L.; Zhang, P.; Huang, X.; Yang, W.; Liu, R.; Sun, Q.; Lu, Y.; Zhang, M.; Fu, Q. Genomic Identification, Evolution, and Expression Analysis of Bromodomain Genes Family in Buffalo. Genes 2022, 13, 103. https://doi.org/10.3390/genes13010103
Zhang J, Huang L, Zhang P, Huang X, Yang W, Liu R, Sun Q, Lu Y, Zhang M, Fu Q. Genomic Identification, Evolution, and Expression Analysis of Bromodomain Genes Family in Buffalo. Genes. 2022; 13(1):103. https://doi.org/10.3390/genes13010103
Chicago/Turabian StyleZhang, Junjun, Liangfeng Huang, Pengfei Zhang, Xingchen Huang, Weihan Yang, Runfeng Liu, Qinqiang Sun, Yangqing Lu, Ming Zhang, and Qiang Fu. 2022. "Genomic Identification, Evolution, and Expression Analysis of Bromodomain Genes Family in Buffalo" Genes 13, no. 1: 103. https://doi.org/10.3390/genes13010103
APA StyleZhang, J., Huang, L., Zhang, P., Huang, X., Yang, W., Liu, R., Sun, Q., Lu, Y., Zhang, M., & Fu, Q. (2022). Genomic Identification, Evolution, and Expression Analysis of Bromodomain Genes Family in Buffalo. Genes, 13(1), 103. https://doi.org/10.3390/genes13010103