Next Article in Journal
Humanization of the Prostate Microenvironment Reduces Homing of PC3 Prostate Cancer Cells to Human Tissue-Engineered Bone
Next Article in Special Issue
Immune Gene Signature Delineates a Subclass of Papillary Thyroid Cancer with Unfavorable Clinical Outcomes
Previous Article in Journal
Focal Adhesion Genes Refine the Intermediate-Risk Cytogenetic Classification of Acute Myeloid Leukemia
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

CCND1 Splice Variant as A Novel Diagnostic and Predictive Biomarker for Thyroid Cancer

1
Department of Hospital Pathology, College of Medicine, The Catholic University of Korea, Seoul 06591, Korea
2
Department of Biomedicine & Health Sciences, Graduate School, The Catholic University of Korea, Seoul 06591, Korea
3
Cancer Research Institute, College of Medicine, The Catholic University of Korea, Seoul 06591, Korea
4
Department of Surgery, College of Medicine, The Catholic University of Korea, Seoul 06591, Korea
*
Author to whom correspondence should be addressed.
Cancers 2018, 10(11), 437; https://doi.org/10.3390/cancers10110437
Submission received: 20 October 2018 / Revised: 11 November 2018 / Accepted: 12 November 2018 / Published: 13 November 2018
(This article belongs to the Special Issue Thyroid Cancer)

Abstract

Cyclin D1 protein is aberrantly overexpressed in thyroid cancers, but mutations of the CCND1 gene are rare in these tumors. We investigated the CCND1 rs9344 (G870A) polymorphism and the expression profiles of wild-type CCND1a and shortened oncogenic isoform CCND1b at the mRNA and protein levels in 286 thyroid tumors. Genotype AA of rs9344 was associated with high expression of CCND1b mRNA and was more frequently found in thyroid cancer than in benign tumors. The mRNA expression levels of CCND1b were higher in papillary thyroid carcinoma (PTC) than in benign or other malignant tumors. However, the expression of CCND1a mRNA showed no association with the parameters. Noninvasive follicular thyroid neoplasm with papillary-like nuclear features (NIFTP) was distinguished from PTC by low expression of CCND1b at mRNA and protein levels. We further observed that cyclin D1b immunostaining helped to avoid the misdiagnosis of classic PTC with predominant follicular pattern as NIFTP in a separate cohort. Nuclear cyclin D1b expression was associated with aggressive clinicopathologic features in PTC. These findings suggest that cyclin D1b overexpression can be used as a diagnostic and predictive biomarker in thyroid tumors and may be functionally involved in the development and progression of the disease.

Graphical Abstract

1. Introduction

Thyroid cancers constitute the majority of endocrine malignancies. Differentiated thyroid cancers, arising from follicular cells, constitute more than 95% of all thyroid cancers and are histologically classified as either papillary thyroid carcinoma (PTC), follicular thyroid carcinoma, or poorly differentiated thyroid carcinoma [1]. The 2017 World Health Organization Classification of Tumors of Endocrine Organs incorporates the newly defined entity noninvasive follicular thyroid neoplasm with papillary-like nuclear features (NIFTP), which is a neoplasm with an unspecified, borderline, or uncertain clinical behavior, but not a benign or malignant tumor [1,2]. Anaplastic thyroid carcinoma also arises from follicular cells but is a highly aggressive disease, while differentiated thyroid cancer is generally considered an indolent disease. Medullary thyroid carcinoma, a tumor derived from parafollicular C cells (neural crest origin), has biologic features that differ from those of follicular cell-derived cancers. The incidence of thyroid cancer has been increasing steadily worldwide over the last few decades [3,4,5,6]. The most rapid rise in the incidence of thyroid cancer was observed in South Korea, where the rate increased nearly 15-fold from 1993 to 2011 [5,7]. This increase is primarily attributed to the rising incidence of PTC, and specifically to that of low-risk PTC including subcentimeter-sized cancer or encapsulated follicular variant [4,7,8]. PTC accounts for 85% of thyroid cancers in most countries, whereas in Korea PTC accounts for more than 95% of thyroid cancers (www.cancer.go.kr) [7,8]. Differentiated thyroid cancers are generally considered indolent; therefore, there is a need to develop preoperative diagnostic markers that can be used to identify thyroid cancers requiring surgical removal from thyroid nodules.
The cyclin D1 protein, coded by the CCND1 gene, is a gate-keeper regulating the transition from the G1 phase into the S phase of the cell cycle [9,10]. Overexpression of cyclin D1 is observed in a variety of human cancers and is involved in tumorigenesis [9,10]. The overexpression of cyclin D1 in human cancers can result from genetic alterations, changes in epigenetic regulation, gene transcription, and protein translation of CCND1. We have shown that cyclin D1 is consistently overexpressed in PTC, and cyclin D1 immunostaining is useful for identifying the extent of tumor involvement [11]. However, mutations and amplification of the CCND1 gene have rarely been found in the differentiated thyroid cancer [12,13]. The CCND1 gene encodes two major splice variants: wild-type (CCND1a mRNA) and an oncogenic isoform (CCND1b mRNA) [9]. CCND1a consists of five exons containing a coding DNA sequence of 888 bp, which encodes a 295-amino acid protein (cyclin D1a). Failure to splice at the exon 4-intron 4 boundary of the CCND1 pre-mRNA generates the CCND1b splice variant that contains intron 4 [9]. Because intron 4 contains a translation stop codon, CCND1b lacks exon 5 and encodes a 275-amino acid protein (cyclin D1b) with early termination of transcription at the intron 4 region [9]. Degradation of cyclin D1 is regulated by C-terminal PEST domain and threonine residue 286 [10]. However, the absence of a protein-destabilizing (PEST) domain and threonine residue 286 in cyclin D1b suggests that cyclin D1b is regulated by a different mechanism and is more stable than cyclin D1a [10]. Polymorphism rs9344 (G870A) at the critical exon 4 splice junction is associated with the expression of CCND1b [9]. The G allele at nucleotide 870 (codon 242) preferentially encodes the CCND1a transcript, and the A870 allele preferentially encodes CCND1b [14]. However, expression of CCND1b can be found in tumors homozygous for G/G [15]. Cyclin D1b expression is related to tumorigenesis, tumor progression, and poor outcomes in various human cancers such as those of the brain, esophagus, lung, breast, colon, prostate, and bladder, as well as in Ewing sarcoma and lymphoma [9,14,15,16,17,18,19,20,21,22,23,24,25]. However, the roles of cyclin D1b expression and G870A polymorphism in thyroid cancer have not been fully defined.
In this study, we evaluated the diagnostic and clinical utility of mRNA and protein expression of CCND1 isoforms in thyroid tumors, and assessed the correlation between G870A polymorphism and expression of CCND1. We also investigated using the expression of cyclin D1b to differentiate NIFTP from benign thyroid tumors and PTC.

2. Results

2.1. CCND1 G870A Polymorphism (rs9344) and CCND1 mRNA Expression

The CCND1 G870A genotypes were significantly correlated with mRNA expression of CCND1b but not with expression of CCND1a, as shown in Figure 1a. The level of CCND1b expression was significantly higher in the genotype AA group than in the genotype GG group (p = 0.010). As shown in Figure 1b, there was a trend toward increasing percentage of the AA genotype with increasing disease aggressiveness from nodular hyperplasia to well differentiated thyroid cancer (p trend = 0.042).

2.2. Relationship between the mRNA Expression of CCND1 Isoforms and Types of Thyroid Tumor

Figure 2 shows the mRNA expression level of CCND1 isoforms according to the type of thyroid tumor. The expression of CCND1a and CCND1b mRNA was significantly increased in PTC compared to that in benign lesions (nodular hyperplasia and follicular adenoma). NIFTP showed a lower level of CCND1b mRNA expression than that observed in PTC (p = 0.039). However, there was no difference in the expression level of CCND1a mRNA between NIFTP and PTC (p = 0.174). No significant differences in the expression levels of CCND1a and CCND1b mRNA were found among nodular hyperplasia, follicular adenoma, and NIFTP. Follicular thyroid carcinoma and medullary thyroid carcinoma showed a lower expression level of CCND1b mRNA than that of PTC (p < 0.001). However, there were no differences in the expression level of CCND1a mRNA among PTC, follicular thyroid carcinoma, and medullary thyroid carcinoma.

2.3. Protein Expression of Cyclin D1 Isoforms in Different Types of Thyroid Tumors

The expression of cyclin D1a was observed in a great majority of tumor cells (50–100%) in NIFTP, PTC, follicular thyroid carcinoma, poorly differentiated thyroid carcinoma, and medullary thyroid carcinoma, as shown in Figure 3. All cases of nodular hyperplasia were negative for the expression of cyclin D1a and cyclin D1b, as shown in Table 1. Positivity for cyclin D1a was observed in 8 (33%) of 33 follicular adenomas and all cases of NIFTP. All cases of nodular hyperplasia and follicular adenoma were negative for cyclin D1b. One (11%) of 9 NIFTP cases showed nuclear expression of cyclin D1b in cohort 1, as shown in Table 1. In PTC, cyclin D1b showed a patchy immunostaining pattern in the central areas of tumor tissue, and diffuse expression in the periphery and at the invasive front, as shown in Figure 4. In other tumors, immunostaining for cyclin D1b showed a patchy pattern of expression regardless of the areas of tumor tissue, as shown in Figure 3. The expression rate of cyclin D1b was significantly lower in the follicular variant of PTC and follicular thyroid carcinoma than in other types of malignant thyroid tumors, as shown in Table 1. The adjacent non-tumor thyroid tissue was negative for both cyclin D1a and cyclin D1b; however, Hürthle cells in Hashimoto’s thyroiditis were strongly positive for cyclin D1a, but negative for cyclin D1b, as shown in Supplementary Figure S1. Parathyroid cells were positive for cyclin D1a, but negative for cyclin D1b.

2.4. Clinical Impact of Expression of CCND1 mRNA Isoforms and Cyclin D1b Protein in PTC

The mRNA expression levels of the two CCND1 isoforms were grouped as high or low based on the median value, as shown in Table 2. High expression of CCND1a mRNA was associated with old age (≥55 years; p = 0.042), histologic variant (p < 0.001), distant metastasis (p = 0.028), and advanced stage as designated by the American Joint Committee on Cancer (AJCC) 8th edition (p = 0.022). High expression of CCND1b mRNA was associated with lymph node metastasis (p = 0.047) and advanced stage, designated by AJCC 7th (p = 0.001) and 8th (p = 0.011) editions. Expression profiles of nuclear and cytoplasmic cyclin D1b are shown in Table 2. The expression of nuclear cyclin D1b was associated with histologic variant (p = 0.009), lymph node metastasis (p = 0.002), risk of recurrence (p = 0.043), and advanced stage as designated by AJCC 7th edition (p = 0.047). The expression of cytoplasmic cyclin D1b was associated with histologic variant (p < 0.001), lymph node metastasis (p < 0.001), and high risk for cancer recurrence (p = 0.010).
We further investigated the clinical impact of CCND1 mRNA and cyclin D1b protein expression in 125 patients with classic type of PTC, as shown in Table 3. High expression of CCND1a mRNA was associated with old age (≥55 years; p = 0.022), distant metastasis (p = 0.007), and advanced stage as designated by AJCC 7th (p = 0.014) and 8th (p = 0.004) editions. High expression of CCND1b mRNA was associated with lymph node metastasis (p = 0.038), and advanced stage as designated by AJCC 7th (p = 0.007) and 8th (p = 0.008) editions. The expression of nuclear cyclin D1b was associated with lymph node metastasis (p = 0.006) and advanced stage as designated by AJCC 8th edition (p = 0.038). The expression of cytoplasmic cyclin D1b was associated with lymph node metastasis (p = 0.005) and advanced stage as designated by AJCC 7th edition (p = 0.025).

2.5. Expression of CCND1b mRNA and Cyclin D1b Protein in NIFTP and Invasive Encapsulated Follicular Variant of PTC

We further evaluated the diagnostic utility of CCND1b mRNA and cyclin D1 protein expression in an independent cohort of NIFTP and invasive encapsulated follicular variant of PTC, as shown in Table 4 and Figure 5. There was no difference in the expression of CCND1b mRNA between NIFTP and invasive encapsulated follicular variant of PTC, as shown in Table 4. Nuclear expression of cyclin D1b was significantly higher in invasive encapsulated follicular variant of PTC than in NIFTP, as shown in Table 4 (p = 0.046). However, there was no difference in the cytoplasmic expression of cyclin D1b between these two diseases (p = 0.096).

2.6. A Case of Noninvasive Encapsulated PTC with Predominant Follicular Growth and BRAF V600E Mutation

Among the 175 PTCs in cohort 1, one was a noninvasive encapsulated tumor measuring 1.1 cm in diameter, and showing predominantly follicular growth and less than 1% of papillae, as shown in Figure 6. Tumor cells showed the typical nuclear features of PTC. Immunohistochemistry for BRAF V600E (VE1) showed a diffuse strong cytoplasmic staining. Sanger sequencing for BRAF exon 15 confirmed the BRAF V600E mutation. This tumor was also positive for cyclin D1b immunostaining. Therefore, this tumor was classified as noninvasive encapsulated classic PTC with predominantly follicular growth according to the revised diagnostic criteria for NIFTP [26].

2.7. CCND1 Mutation and mRNA Expression in TCGA Dataset

Genetic alteration of CCND1 was not found in the Cancer Genome Atlas (TCGA) dataset of PTC. The high expression level of CCND1 mRNA was correlated with the BRAF-like cancer (p < 0.001). However, there was no association between CCND1 mRNA expression and clinicopathologic features, as shown in Supplementary Table S1.

3. Discussion

To the best of our knowledge, this study is the first to demonstrate the clinicopathologic significance of mRNA and protein expression of CCND1 isoforms in thyroid tumors. NIFTP was distinguished from PTC by low expression of CCND1b mRNA and protein, whereas the expression level of CCND1a mRNA and protein in NIFTP did not differ from that observed in PTC. Cyclin D1b expression, as assessed by immunohistochemistry, was significantly lower in NIFTP than in its closest mimic, which is invasive encapsulated follicular variant of PTC. In PTC, nuclear expression of cyclin D1b was associated with aggressive clinicopathologic features including lymph node metastasis, risk of tumor recurrence, and advanced stage.
The association of CCND1 rs9344 (G870A) polymorphism and risk of thyroid cancer has been reported in a few studies [27,28]. In the Polish population, the AA genotype was more frequently found in patients with PTC than in the healthy population (23.1% vs. 18.5%). The AA genotype may be a risk factor for the development of this type of cancer (odds ratio, 1.452; 95% confidence interval, 1.059–1.989) [27]. A study on the Turkish population showed that the frequency of the AA genotype was significantly higher in patients with PTC than in healthy individuals (37.3% vs. 28.7%) [28]. In our study, the polymorphism rs9344 was associated with the AA genotype. Frequency of the AA genotype was significantly higher in patients with PTC than in those with nodular hyperplasia (33% vs. 13%), although we did not compare these results with a healthy control group. Nevertheless, the CCND1 rs9344 (G870A) polymorphism may also be a risk factor for developing PTC in the Korean population; this notion is supported by the agreement of our results with the data obtained from studies of the Polish and Turkish populations.
Previous studies showed that high expression of nuclear cyclin D1 is associated with lymph node metastases in PTCs [29,30]. This association, however, is not consistent. In other studies, lymph node metastasis of PTC was not associated with the intensity or distribution of cyclin D1 immunostaining [31]. In our previous studies, as well as in the present study, we observed that cyclin D1a was consistently overexpressed in PTC and there was no correlation between its overexpression and lymph node metastasis [11]. The expression level of CCND1a mRNA also had no impact on lymph node metastasis, as assessed using our study cohort and TCGA dataset. With respect to pathologic diagnosis of thyroid tumors, cyclin D1a immunostaining was useful for the differential diagnosis of non-neoplastic hyperplasia and thyroid neoplasms; this is because nodular hyperplasia was completely negative for the expression of cyclin D1a. However, the expression of cyclin D1a did not show clinically- or diagnostically-significant differences between NIFTP and other types of thyroid cancers, provided that all these tumors exhibited overexpression of cyclin D1a. Previous studies exploring the diagnostic role of cyclin D1a in tumors with a follicular pattern showed no difference in cyclin D1a immunostaining among follicular adenoma, follicular thyroid carcinoma, and follicular variant of PTC [31]. Another study showed the expression of cyclin D1a in nodular goiter [31]. These conflicting results described in the literature, as well as in our studies, may reflect variations in population diversity, cut-off values used for the evaluation of cyclin D1 expression, and various conditions used for performing immunohistochemistry.
With respect to the expression of cyclin D1b in thyroid tumor, no preexisting data were found in the literature. In this study, we showed that cyclin D1b was not expressed in follicular adenoma and rarely expressed in NIFTP. In PTC, 64.7% of the samples were positive for nuclear expression of cyclin D1b, which was associated with tumor metastasis, advanced stage, and increased risk of recurrence. These results are consistent with previous findings showing that as an oncogenic isoform, cyclin D1b plays a role in tumorigenesis and progression, and is correlated with poor outcomes in various non-thyroidal cancers [9,14,15,16,17,18,19,20,21,22,23,24,25]. A recent study showed that knockdown of CCND1b promoted apoptosis and suppressed cancer-cell stemness and epithelial mesenchymal transition in human bladder cancer cells [32]. These results indicate that the cyclin D1b oncoprotein may play a role in thyroid cancer progression.
Cyclin D1 is a nuclear protein regulating cell cycle progression from the G1 to the S phase and has been implicated in tumor invasion and metastasis in human cancers [33]. Phosphorylation of threonine residue 286 within the PEST domain enables cyclin D1 nuclear exportation and subsequent ubiquitin-dependent degradation in the cytoplasm [34]. Altered ubiquitin-proteasome system is responsible for cyclin D1 overexpression in tumor cells [10,34]. Cytoplasmic expression of cyclin D1 can control cancer cell migration, invasion, and metastasis, but not cell proliferation [33,35,36]. In this study, cytoplasmic immunoreactivity of cyclin D1a was observed in most thyroid cancers, but rarely found in follicular adenoma and NIFTP. The cytoplasmic expression of cyclin D1b was observed only in thyroid cancers and was associated with lymph node metastasis and advanced stage in PTC patients. Further studies are necessary to elucidate the cytoplasmic cyclin D1-dependent mechanisms that control cell adhesion and migration in thyroid cancer.
In some cases, the initial histologic criteria for NIFTP have resulted in the misdiagnosing of encapsulated classic PTC with predominant follicular growth as NIFTP in some cases [26,37,38,39]. Our previous study showed that several encapsulated follicular patterned tumors with nuclear features of PTC developed micro-metastases in regional lymph nodes or harbored the BRAF V600E mutation, when criteria of less than 1% papillae was allowed [37]. In another study, a 6.0-cm thyroid tumor, which met the initial criteria for NIFTP, had concurrent RAS and TERT promoter mutations [40]. As a result, the diagnostic criteria of NIFTP have recently been updated to avoid misdiagnosing these thyroid cancers as NIFTP [2,26]. The revised diagnostic criteria recommend using the criterion of “no (0%) well-formed papillae” and thorough examination of the whole-tumor capsule to exclude the presence of capsular or vascular invasion [26]. Furthermore, the entire tumor tissue should be submitted for histologic examination to exclude the presence of any papillae when the tumor has florid nuclear features (nuclear score of 3) of PTC [26]. Exclusion criteria include the presence of BRAF V600E and BRAF V600E-like mutations, or that of high-risk mutations (such as those in TERT promoter, TP53), even if the tumor meets the histologic criteria for NIFTP. Molecular testing, however, is not mandatory for NIFTP diagnosis. In our present study, one case met the former microscopic criteria for NIFTP [2], but was positive for the BRAF V600E mutation and showed positive immunostaining for cyclin D1b and BRAF VE1. Our findings further support the recommended detection of BRAF V600E by molecular testing or immunohistochemistry in order to differentiate classic PTC from NIFTP. Immunohistochemical staining for nuclear cyclin D1b can be helpful in diagnosing NIFPT, provided that nuclear cyclin D1b is rarely expressed in NIFTP but is highly expressed in PTC. We also observed a significantly higher nuclear expression of cyclin D1b in invasive encapsulated follicular variant of PTC than in NIFTP, as assessed in an independent cohort. These observations suggest that cyclin D1b immunostaining can be used in distinguishing NIFTP from its closest histologic mimic, invasive encapsulated follicular variant of PTC. In this context, the nuclear positivity for cyclin D1b immunostain indicates that the entire tumor tissue should be evaluated for evidence of malignancy such as true papillae, high-grade features, or invasion.
Various benign thyroid nodules can show atypical nuclear features, mimicking those of PTC. Hashimoto’s thyroiditis is the most common cause of false positive results in preoperative aspiration cytology. Immunostaining for cytokeratin-19, galectin-3, HBME1, and loss of expression l of CD56 are frequently used to diagnose PTC. However, the expression of cytokeratin-19, galectin-3, HBME1, and loss of expression of CD56 are also detected in 20%, 20–40%, 20%, and 7–90% of patients with Hashimoto’s thyroiditis, respectively [41,42]. In the present study, cyclin D1b was not expressed in Hashimoto’s thyroiditis, as shown in Supplementary Figure S1. However, immunostaining for cyclin D1a was strongly positive in the Hürthle cells of Hashimoto’s thyroiditis, as shown in Supplementary Figure S1. These findings suggest that immunostaining for cyclin D1b, rather than for cyclin D1a, can be used to differentiate between Hashimoto’s thyroiditis and PTC in limited biopsy samples or cell blocks.
RNA extracted from formalin-fixed paraffin-embedded (FFPE) tissue blocks has often suffered degradation over time. The quality of RNA derived from FFPE samples is affected by pre-analytical procedures including time to fixation from tumor removal, tissue-processing and paraffin-embedding methods, and sample storage as well as RNA extraction methods [43]. Nevertheless, RNA has been successfully extracted from stored FFPE specimens and used for quantitative measurement of mRNA levels by quantitative reverse transcription polymerase chain reaction (qRT-PCR), microarray analysis, and next-generation sequencing with successful results [43]. In our study, we used standardized protocols for pre-analytical workflow, extraction of RNA from FFPE blocks, and RNA gene expression analysis. The majority of FFPE samples showed a RIN (RNA Integrity Number) between 2 and 4. Quantification cycle (Cq) values of the qRT-PCR amplifications were between 24 and 30 for GAPDH mRNA (internal control). There was no significant correlation between RIN values and Cq values, which was consistent with the results from a previous study of RIN values and its effect on qRT-PCR in FFPE samples [43].

4. Materials and Methods

4.1. Patient and Clinical Samples

This study was approved by the Institutional Review Board of Seoul St. Mary’s Hospital of the Catholic University of Korea (KC13SISI0198, valid from 1 March 2013 to 31 March 2016, for study cohort 1; KC16SISI0709, valid from 1 November 2016 to 31 October 2019, for study cohort 2). We used a series of 282 surgical resection specimens, obtained at Seoul St. Mary’s Hospital from 2009 to 2013, to investigate the prevalence and clinicopathologic significance of G870A polymorphism and CCND1 expression at the gene and protein levels in various types of thyroid tumors. We also included a separate cohort of 58 patients with NIFTP (n = 34) and invasive encapsulated follicular variant of PTC (n = 24), diagnosed from 2014 to 2017, to validate the significance of the expression of CCND1 mRNA and cyclin D1 protein. All histologic slides were reviewed by an endocrine pathologist. Pathologic cancer stages were categorized according to the 7th and 8th editions of the American Joint Committee on Cancer (AJCC) staging manual. Recurrence risk was evaluated using the American Thyroid Association classification for risk of recurrence [44].

4.2. Isolation of Nucleic Acids

Genomic DNA and total RNA were isolated from formalin-fixed paraffin-embedded specimens using a RecoverAll Total Nucleic Acid Isolation kit (Ambion, Austin, TX, USA) according to the manufacturer’s protocol. Briefly, microdissected samples from deparaffinized slides were digested with a protease for 60 min at 50 °C, then for 15 min at 80 °C for total RNA isolation, and for 16 to 48 h at 50 °C for isolation of genomic DNA. Nucleic acid was isolated by capture on a glass-fiber filter. The DNase mix and RNase mix included in the kit were used for the isolation of RNA and DNA, respectively. RNA was eluted using elution solution at room temperature and DNA was eluted using nuclease-free water preheated to 95 °C.

4.3. Genotyping of CCND1 G870A Polymorphism

Genomic DNA was analyzed with polymerase chain reaction (PCR) analysis using specific primers, as shown in Supplementary Table S2. Polymorphism was evaluated using endpoint real-time PCR after validation by Sanger sequencing. We used a FastStart Essential DNA Probes Master containing FastStart Taq DNA Polymerase for hot start PCR (Roche Applied Science, Barcelona, Spain). The procedure was conducted using a LightCycler 96 real-time PCR system (Roche Applied Science). The probes for the alleles A and G were labeled with fluorescent HEX dye and fluorescent FAM dye, respectively, to identify the CCND1 polymorphism at end point real-time PCR. Genotype was evaluated on a LightCycler® 96 Software version 1.1.0.1320 (Roche Diagnostics GmbH, Mannheim, Germany).

4.4. Quantitative Real-Time PCR for CCND1 Alternative Transcripts

Total RNA was reverse-transcribed using First Strand cDNA Synthesis kit (Roche Applied Science). Quantitative real-time PCR was performed on a LightCycler 96 Real-Time PCR System (Roche Applied Science) using FastStart Essential DNA Probes Master (Roche Applied Science). Gene-specific primers and probes were designed to recognize transcripts CCND1a and CCND1b, as shown in Supplementary Table S2. The probes were selected from the Universal Probe Library (Roche Applied Science). Quantitative real-time PCR for glyceraldehyde-3-phosphate dehydrogenase (GAPDH) as reference gene to normalize the mRNA levels of CCND1 was performed simultaneously using the same conditions.

4.5. Molecular Analysis of BRAF, NRAS, HRAS, and KRAS Genes

Exon 15 of the BRAF gene, exon 3 of the NRAS and HRAS genes, and exons 2 and 3 of the KRAS gene were amplified via PCR using specific primers, as shown in Supplementary Table S3. Sanger sequencing of PCR amplicons was performed using PCR primers described as previously described [37].

4.6. Antibody Preparation

The rabbit monoclonal cyclin D1 (clone SP4, Cat. No. 241R-18) antibody for in vitro diagnostic use was purchased from Cell Marque (Rocklin, CA, USA). A rabbit polyclonal antibody to cyclin D1b was generated using intron 4 cyclin D1b specific C-terminal peptides from Abfrontier (Seoul, Korea). Antiserum was collected after primary immunization (1 mg antigen/rabbit in Complete Freund’s Adjuvant) and three boosters (500 µg antigen/rabbit in Incomplete Freund’s Adjuvant). Rabbit immunization protocol is shown in Supplementary Table S4. The polyclonal antibody against cyclin D1b was purified from the rabbit immune serum using Protein A purification. We used Western blotting to assess antibody specificity by the presence of a single band at the expected molecular weight of 31 kDa in thyroid cancer cell lines, as shown in Supplementary Figure S2.

4.7. Western Blotting for Assessing Antibody Specificity

Human thyroid cancer cell lines were homogenized in radio-immunoprecipitation assay buffer (Thermo Scientific, Fremont, CA, USA) and a mixture of 5 mM EDTA and protease inhibitors (Thermo Scientific). Protein extracts were separated on 10% SDS-PAGE gels and transferred to polyvinylidene difluoride membrane (Merck Millipore, Darmstadt, Germany). After blocked in Starting Block T20 (TBS) Blocking buffer (Thermo Scientific), the membrane was incubated with primary antibodies (cyclin D1a, 1:1500; cyclin D1b, 1:1000) for 16 h at 4 °C on an orbital shaker. Primary antibodies were diluted in the blocking buffer. The membrane was washed three times for 10 min with Tris-buffered saline with Tween 20 (TBST, Thermo Scientific), followed by incubation with goat anti-rabbit IgG horseradish peroxidase conjugated antibody (1:2500, Santa Cruz Biotechnology, CA, USA) for 60 min at room temperature (22–25 °C) on an orbital shaker. The detection of immunoreaction was achieved using an enhanced SuperSignal West Pico Chemiluminescent Substrate kit (Thermo Scientific). Immuno-reactive bands were visualized using the PXi Touch Imaging System (Syngene, Frederick, MD, USA) and quantified using the GeneTools Analysis Software (Syngene).

4.8. Immunohistochemistry

Formalin-fixed paraffin-embedded 4-μm-thick whole-tumor sections were deparaffinized and rehydrated. Endogenous peroxidase activity was blocked by incubating the tissue sections in 3% hydrogen peroxide for 15 min at room temperature. Cyclin D1a immunostaining was performed using an automated Ventana Benchmark system (Ventana Medical Systems, Tucson, AZ, USA) in accordance with the manufacturer’s instructions. Antigen retrieval was performed for 48 min using the Ventana Benchmark CC1 standard program. Tissue sections were incubated with primary rabbit anti-cyclin D1a monoclonal antibody (pre-diluted by supplier, clone SP4, Cell Marque) for 16 min at 37 °C, followed by visualization with Ventana OptiView DAB IHC Detection Kit (OptiView HQ Linker for 8 min and OptiView HRP Multimer for 8 min) and OptiView Amplification Kit. The specimens were then counterstained with Ventana Hematoxylin II for 4 min, followed by bluing reagent (Ventana) for 4 min. Cyclin D1b immunostaining was manually performed using a Polink-2 plus HRP Rabbit DAB kit (GBI Labs, Mukilteo, WA, USA) according to the manufacturer’s instructions. Antigen retrieval for cyclin D1b was conducted by heating the slides containing the sections in 0.01 mol/L citrate buffer (pH 6.0) for 20 min using an electric pressure cooker. Tissue sections were incubated with primary rabbit anti-cyclin D1b polyclonal antibody (5 µg/mL, Abfrontier) for 30 min at room temperature. Slides were incubated with HRP Polymer-anti-Rabbit IgG (GBI Labs) for 15 min at room temperature in a humidified chamber. The antibody-antigen interaction was visualized using 3,3′-diaminobenzidine tetrahydrochloride. Sections were then counterstained with Harris’s hematoxylin (YD diagnostics, Seoul, Korea). The negative control used nonspecific rabbit IgG in place of the primary antibody. The immunostained slides were assessed in a blinded manner by a thyroid pathologist. Cyclin D1a positivity was defined as moderate to strong nuclear staining in 10% or more of tumor cells. For cyclin D1b, nuclear and cytoplasmic immunostaining was separately evaluated and considered positive if ≥10% of tumor cells showed moderate to strong expression of cyclin D1b [25].

4.9. The Cancer Genome Atlas Data Analysis for CCND1

We mined the Cancer Genome Atlas (TCGA) database for data on mutations and normalized mRNA expression of CCND1 in PTC; data were downloaded from the cBioPortal website (http://www.cbioportal.org). Clinicopathologic data were downloaded from the Genomic Data Commons Data Portal website (https://portal.gdc.cancer.gov).

4.10. Statistical Analysis

Association between expression levels of CCND1 mRNA isoforms and rs9344 genotypes or types of thyroid tumors was analyzed using Student’s t-test (normally distributed variables) or Mann–Whitney U-test (non-normally distributed variables) for comparing two unpaired groups. A Kolmogorov–Smirnov’s test for normal distribution was used to decide whether to apply the parametric or nonparametric test. Values of mRNA expression were presented as median and interquartile range. Correlation between clinicopathologic features and relative expression of CCND1 mRNA isoforms and cyclin D1b protein were analyzed by the chi-square test (parametric) or the Fisher’s exact (non-parametric) where appropriate. All statistical values were calculated using Prism (version 6.05, GraphPad Software, La Jolla, CA, USA) and statistical software program SPSS (version 21.0, IBM Corp, Armonk, NY, USA). P values of less than 0.05 were considered to indicate statistically significant differences.

5. Conclusions

The AA genotype of the rs9344 polymorphism was associated with the overexpression of cyclin D1b in thyroid cancer. The expression of cyclin D1b (the oncogenic form) can be an effective surrogate marker for differentiating among the types of thyroid tumors and for predicting prognosis for patients with PTC. Immunostaining for cyclin D1b can improve the diagnostic accuracy of morphologically-based interpretation of NIFTP. Positive immunostaining for cyclin D1a (wild-type form) favors a neoplastic over a hyperplastic nodule, but has no diagnostic or prognostic value in NIFTP and PTC.

Supplementary Materials

The following are available online at https://www.mdpi.com/2072-6694/10/11/437/s1, Figure S1: Hürthle cells in Hashimoto’s thyroiditis are positive for cyclin D1a (a, × 400) and negative for cyclin D1b (b, ×400). Most chronic inflammatory cells mixed with Hürthle cells are negative for cyclin D1a and positive for cyclin D1b. Parathyroid cells are positive for cyclin D1a (c, ×400) and negative for cyclin D1b (d, ×400). Figure S2: The rabbit polyclonal cyclin D1b antibody was derived from the intron 4 sequence (VSEGDVPGSLAGAYRGRHLVPRKCRGWCQGPQG). This rabbit polyclonal cyclin D1b antibody was used in Western blot to detect cyclin D1b in two thyroid cancer cell lines, SNU80 (anaplastic thyroid carcinoma) with BRAF G469R mutation and SNU790 (papillary thyroid carcinoma) with BRAF V600E mutation, which were obtained from the Korea Cell Line Bank (Seoul National University, Seoul, Korea). Cyclin D1b runs as a 31 kDa molecule on 10% SDS-PAGE gel. Table S1: Correlation between clinicopathologic features and expression of CCND1 mRNA in The Cancer Genome Atlas (TCGA) dataset of papillary thyroid carcinoma. Table S2: Sequences of primers and probes for the analysis of CCND1 gene. Table S3: Sequences of primers for the molecular analysis of BRAF, NRAS, HRAS, and KRAS genes. Table S4: Rabbit immunization protocol for polyclonal cyclin D1b antibody production.

Author Contributions

Conceptualization, C.K.J.; methodology, S.J., Y.K., Y.M.J., and C.K.J.; software, S.J., Y.K., and C.K.J.; validation, S.J., J.S.B., and C.K.J.; formal analysis, S.J., Y.K., and C.K.J.; investigation, S.J. and C.K.J.; resources, S.J., J.S.B., and C.K.J.; data curation, S.J., Y.K., Y.M.J., and C.K.J.; writing—original draft preparation, S.J. and C.K.J.; writing—review and editing, S.J., Y.K., Y.M.J., J.S.B., and C.K.J.; visualization, S.J., Y.K., Y.M.J., J.S.B., and C.K.J.; supervision, C.K.J; project administration, S.J.; funding acquisition, C.K.J. All authors read and approved the final manuscript.

Funding

This research was supported by a grant (2017R1D1A1B03029597) from the Basic Science Research Program through the National Research Foundation of Korea (Daejeon, Korea) funded by the Ministry of Science and ICT. This study was also supported by a grant (HI16C2013) from the Korean Health Technology R&D Project (Cheongju-si, Chungcheongbuk-do, Korea), Ministry of Health &Welfare, Republic of Korea.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Nikiforov, Y.E.; Baloch, Z.W.; Belge, G.; Chan, J.K.C.; Derwahl, K.M.; Evans, H.L.; Fagin, J.A.; Ghossein, R.A.; Lloyd, R.V.; Oriola, J.; et al. Tumors of the thyroid gland. In WHO Classification of Tumours of Endocrine Organs; Lloyd, R.V., Osamura, R.Y., Klöppel, G., Rosai, J., Eds.; WHO Press: Geneva, Switzerland, 2017; Volume 10, pp. 66–103. [Google Scholar]
  2. Nikiforov, Y.E.; Seethala, R.R.; Tallini, G.; Baloch, Z.W.; Basolo, F.; Thompson, L.D.; Barletta, J.A.; Wenig, B.M.; Al Ghuzlan, A.; Kakudo, K.; et al. Nomenclature Revision for Encapsulated Follicular Variant of Papillary Thyroid Carcinoma: A Paradigm Shift to Reduce Overtreatment of Indolent Tumors. JAMA Oncol. 2016, 2, 1023–1029. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. Cho, B.Y.; Choi, H.S.; Park, Y.J.; Lim, J.A.; Ahn, H.Y.; Lee, E.K.; Kim, K.W.; Yi, K.H.; Chung, J.K.; Youn, Y.K.; et al. Changes in the clinicopathological characteristics and outcomes of thyroid cancer in Korea over the past four decades. Thyroid 2013, 23, 797–804. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Jung, C.K.; Little, M.P.; Lubin, J.H.; Brenner, A.V.; Wells, S.A., Jr.; Sigurdson, A.J.; Nikiforov, Y.E. The increase in thyroid cancer incidence during the last four decades is accompanied by a high frequency of BRAF mutations and a sharp increase in RAS mutations. J. Clin. Endocrinol. Metab. 2014, 99, E276–E285. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Ahn, H.S.; Kim, H.J.; Welch, H.G. Korea’s thyroid-cancer “epidemic”—Screening and overdiagnosis. N. Engl. J. Med. 2014, 371, 1765–1767. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  6. Vaccarella, S.; Franceschi, S.; Bray, F.; Wild, C.P.; Plummer, M.; Dal Maso, L. Worldwide thyroid-cancer epidemic? The increasing impact of overdiagnosis. N. Engl. J. Med. 2016, 375, 614–617. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  7. Ahn, H.S.; Kim, H.J.; Kim, K.H.; Lee, Y.S.; Han, S.J.; Kim, Y.; Ko, M.J.; Brito, J.P. Thyroid cancer screening in South Korea increases detection of papillary cancers with no impact on other subtypes or thyroid cancer mortality. Thyroid 2016, 26, 1535–1540. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  8. Fagin, J.A.; Wells, S.A., Jr. Biologic and clinical perspectives on thyroid cancer. N. Engl. J. Med. 2016, 375, 1054–1067. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  9. Knudsen, K.E.; Diehl, J.A.; Haiman, C.A.; Knudsen, E.S. Cyclin D1: Polymorphism, aberrant splicing and cancer risk. Oncogene 2006, 25, 1620–1628. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  10. Alao, J.P. The regulation of cyclin D1 degradation: Roles in cancer development and the potential for therapeutic invention. Mol. Cancer 2007, 6, 24. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  11. Jung, C.K.; Kang, Y.G.; Bae, J.S.; Lim, D.J.; Choi, Y.J.; Lee, K.Y. Unique patterns of tumor growth related with the risk of lymph node metastasis in papillary thyroid carcinoma. Mod. Pathol. 2010, 23, 1201–1208. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  12. Agrawal, N.; Akbani, R.; Aksoy, B.A.; Ally, A.; Arachchi, H.; Asa, S.L.; Auman, J.T.; Balasundaram, M.; Balu, S.; Baylin, S.B.; et al. Integrated genomic characterization of papillary thyroid carcinoma. Cell 2014, 159, 676–690. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  13. Landa, I.; Ibrahimpasic, T.; Boucai, L.; Sinha, R.; Knauf, J.A.; Shah, R.H.; Dogan, S.; Ricarte-Filho, J.C.; Krishnamoorthy, G.P.; Xu, B.; et al. Genomic and transcriptomic hallmarks of poorly differentiated and anaplastic thyroid cancers. J. Clin. Investig. 2016, 126, 1052–1066. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Comstock, C.E.; Augello, M.A.; Benito, R.P.; Karch, J.; Tran, T.H.; Utama, F.E.; Tindall, E.A.; Wang, Y.; Burd, C.J.; Groh, E.M.; et al. Cyclin D1 splice variants: Polymorphism, risk, and isoform-specific regulation in prostate cancer. Clin. Cancer Res. 2009, 15, 5338–5349. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Kim, C.J.; Tambe, Y.; Mukaisho, K.; Sugihara, H.; Isono, T.; Sonoda, H.; Shimizu, T.; Kondoh, G.; Inoue, H. Female-specific rectal carcinogenesis in cyclin D1b transgenic mice. Carcinogenesis 2014, 35, 227–236. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  16. Sanchez, G.; Bittencourt, D.; Laud, K.; Barbier, J.; Delattre, O.; Auboeuf, D.; Dutertre, M. Alteration of cyclin D1 transcript elongation by a mutated transcription factor up-regulates the oncogenic D1b splice isoform in cancer. Proc. Natl. Acad. Sci. USA 2008, 105, 6004–6009. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Kim, C.J.; Nishi, K.; Isono, T.; Okuyama, Y.; Tambe, Y.; Okada, Y.; Inoue, H. Cyclin D1b variant promotes cell invasiveness independent of binding to CDK4 in human bladder cancer cells. Mol. Carcinog. 2009, 48, 953–964. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Millar, E.K.; Dean, J.L.; McNeil, C.M.; O’Toole, S.A.; Henshall, S.M.; Tran, T.; Lin, J.; Quong, A.; Comstock, C.E.; Witkiewicz, A.; et al. Cyclin D1b protein expression in breast cancer is independent of cyclin D1a and associated with poor disease outcome. Oncogene 2009, 28, 1812–1820. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  19. Li, R.; An, S.J.; Chen, Z.H.; Zhang, G.C.; Zhu, J.Q.; Nie, Q.; Xie, Z.; Guo, A.L.; Mok, T.S.; Wu, Y.L. Expression of cyclin D1 splice variants is differentially associated with outcome in non-small cell lung cancer patients. Hum. Pathol. 2008, 39, 1792–1801. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  20. Gupta, V.K.; Feber, A.; Xi, L.; Pennathur, A.; Wu, M.; Luketich, J.D.; Godfrey, T.E. Association between CCND1 G/A870 polymorphism, allele-specific amplification, cyclin D1 expression, and survival in esophageal and lung carcinoma. Clin. Cancer Res. 2008, 14, 7804–7812. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  21. Hong, Y.; Eu, K.W.; Seow-Choen, F.; Fook-Chong, S.; Cheah, P.Y. GG genotype of cyclin D1 G870A polymorphism is associated with increased risk and advanced colorectal cancer in patients in Singapore. Eur. J. Cancer 2005, 41, 1037–1044. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  22. Shakir, R.; Ngo, N.; Naresh, K.N. Correlation of cyclin D1 transcript levels, transcript type and protein expression with proliferation and histology among mantle cell lymphoma. J. Clin. Pathol. 2008, 61, 920–927. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Zeybek, U.; Yaylim, I.; Ozkan, N.E.; Korkmaz, G.; Turan, S.; Kafadar, D.; Cacina, C.; Kafadar, A.M. Cyclin D1 gene G870A variants and primary brain tumors. Asian Pac. J. Cancer Prev. 2013, 14, 4101–4106. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Jeyapalan, J.N.; Doctor, G.T.; Jones, T.A.; Alberman, S.N.; Tep, A.; Haria, C.M.; Schwalbe, E.C.; Morley, I.C.; Hill, A.A.; LeCain, M.; et al. DNA methylation analysis of paediatric low-grade astrocytomas identifies a tumour-specific hypomethylation signature in pilocytic astrocytomas. Acta. Neuropathol. Commun. 2016, 4, 54. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Abramson, V.G.; Troxel, A.B.; Feldman, M.; Mies, C.; Wang, Y.; Sherman, L.; McNally, S.; Diehl, A.; Demichele, A. Cyclin D1b in human breast carcinoma and coexpression with cyclin D1a is associated with poor outcome. Anticancer Res. 2010, 30, 1279–1285. [Google Scholar] [PubMed]
  26. Nikiforov, Y.E.; Baloch, Z.W.; Hodak, S.P.; Giordano, T.J.; Lloyd, R.V.; Seethala, R.R.; Wenig, B.M. Change in Diagnostic Criteria for Noninvasive Follicular Thyroid Neoplasm With Papillarylike Nuclear Features. JAMA Oncol. 2018. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  27. Hryhorowicz, S.; Ziemnicka, K.; Kaczmarek-RyŚ, M.; Hoppe-GoŁĘBiewska, J.; PŁAwski, A.; Skrzypczak-ZieliŃSka, M.; Szkudlarek, M.; GoŁĄB, M.; Budny, B.; RuchaŁA, M.; et al. CCND1 gene polymorphic variants in patients with differentiated thyroid carcinoma. Oncol Lett. 2015, 9, 442–448. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  28. Aytekin, T.; Aytekin, A.; Maralcan, G.; Gokalp, M.A.; Ozen, D.; Borazan, E.; Yilmaz, L. A cyclin D1 (CCND1) gene polymorphism contributes to susceptibility to papillary thyroid cancer in the Turkish population. Asian Pac. J. Cancer Prev. 2014, 15, 7181–7185. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  29. Pešutić-Pisac, V.; Punda, A.; Glunčić, I.; Bedeković, V.; Pranić-Kragić, A.; Kunac, N. Cyclin D1 and p27 expression as prognostic factor in papillary carcinoma of the thyroid: Association with clinicopathological parameters. Croat Med. J. 2008, 49, 643–649. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  30. Khoo, M.L.; Ezzat, S.; Freeman, J.L.; Asa, S.L. Cyclin D1 protein expression predicts metastatic behavior in thyroid papillary microcarcinomas but is not associated with gene amplification. J. Clin. Endocrinol. Metab. 2002, 87, 1810–1813. [Google Scholar] [CrossRef] [PubMed]
  31. Seybt, T.P.; Ramalingam, P.; Huang, J.; Looney, S.W.; Reid, M.D. Cyclin D1 expression in benign and differentiated malignant tumors of the thyroid gland: Diagnostic and biologic implications. Appl. Immunohistochem. Mol. Morphol. 2012, 20, 124–130. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  32. Kim, C.J.; Terado, T.; Tambe, Y.; Mukaisho, K.I.; Sugihara, H.; Kawauchi, A.; Inoue, H. Anti-oncogenic activities of cyclin D1b siRNA on human bladder cancer cells via induction of apoptosis and suppression of cancer cell stemness and invasiveness. Int. J. Oncol. 2018, 52, 231–240. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Fuste, N.P.; Fernandez-Hernandez, R.; Cemeli, T.; Mirantes, C.; Pedraza, N.; Rafel, M.; Torres-Rosell, J.; Colomina, N.; Ferrezuelo, F.; Dolcet, X.; et al. Cytoplasmic cyclin D1 regulates cell invasion and metastasis through the phosphorylation of paxillin. Nat. Commun. 2016, 7, 11581. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Lin, D.I.; Barbash, O.; Kumar, K.G.; Weber, J.D.; Harper, J.W.; Klein-Szanto, A.J.; Rustgi, A.; Fuchs, S.Y.; Diehl, J.A. Phosphorylation-dependent ubiquitination of cyclin D1 by the SCF(FBX4-alphaB crystallin) complex. Mol. Cell. 2006, 24, 355–366. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Fuste, N.P.; Castelblanco, E.; Felip, I.; Santacana, M.; Fernandez-Hernandez, R.; Gatius, S.; Pedraza, N.; Pallares, J.; Cemeli, T.; Valls, J.; et al. Characterization of cytoplasmic cyclin D1 as a marker of invasiveness in cancer. Oncotarget 2016, 7, 26979–26991. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Body, S.; Esteve-Arenys, A.; Miloudi, H.; Recasens-Zorzo, C.; Tchakarska, G.; Moros, A.; Bustany, S.; Vidal-Crespo, A.; Rodriguez, V.; Lavigne, R.; et al. Cytoplasmic cyclin D1 controls the migration and invasiveness of mantle lymphoma cells. Sci. Rep. 2017, 7, 13946. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Cho, U.; Mete, O.; Kim, M.H.; Bae, J.S.; Jung, C.K. Molecular correlates and rate of lymph node metastasis of non-invasive follicular thyroid neoplasm with papillary-like nuclear features and invasive follicular variant papillary thyroid carcinoma: The impact of rigid criteria to distinguish non-invasive follicular thyroid neoplasm with papillary-like nuclear features. Mod. Pathol. 2017, 30, 810–825. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Lee, S.E.; Hwang, T.S.; Choi, Y.L.; Kim, W.Y.; Han, H.S.; Lim, S.D.; Kim, W.S.; Yoo, Y.B.; Kim, S.K. Molecular profiling of papillary thyroid carcinoma in Korea with a high prevalence of BRAF(V600E) Mutation. Thyroid 2017, 27, 802–810. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  39. Parente, D.N.; Kluijfhout, W.P.; Bongers, P.J.; Verzijl, R.; Devon, K.M.; Rotstein, L.E.; Goldstein, D.P.; Asa, S.L.; Mete, O.; Pasternak, J.D. Clinical safety of renaming encapsulated follicular variant of papillary thyroid carcinoma: Is NIFTP truly benign? World J. Surg. 2018, 42, 321–326. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  40. Jiang, X.S.; Harrison, G.P.; Datto, M.B. Young Investigator Challenge: Molecular testing in noninvasive follicular thyroid neoplasm with papillary-like nuclear features. Cancer Cytopathol. 2016, 124, 893–900. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  41. Huang, L.; Wang, X.; Huang, X.; Gui, H.; Li, Y.; Chen, Q.; Liu, D.; Liu, L. Diagnostic significance of CK19, galectin-3, CD56, TPO and Ki67 expression and BRAF mutation in papillary thyroid carcinoma. Oncol Lett. 2018, 15, 4269–4277. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  42. Nasr, M.R.; Mukhopadhyay, S.; Zhang, S.; Katzenstein, A.L. Absence of the BRAF mutation in HBME1+ and CK19+ atypical cell clusters in Hashimoto thyroiditis: Supportive evidence against preneoplastic change. Am. J. Clin. Pathol. 2009, 132, 906–912. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  43. Kashofer, K.; Viertler, C.; Pichler, M.; Zatloukal, K. Quality control of RNA preservation and extraction from paraffin-embedded tissue: Implications for RT-PCR and microarray analysis. PLoS ONE 2013, 8, e70714. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Haugen, B.R.; Alexander, E.K.; Bible, K.C.; Doherty, G.M.; Mandel, S.J.; Nikiforov, Y.E.; Pacini, F.; Randolph, G.W.; Sawka, A.M.; Schlumberger, M.; et al. 2015 American Thyroid Association Management Guidelines for Adult Patients with Thyroid Nodules and Differentiated Thyroid Cancer: The American Thyroid Association Guidelines Task Force on Thyroid Nodules and Differentiated Thyroid Cancer. Thyroid 2016, 26, 1–133. [Google Scholar] [CrossRef] [Scilit] [PubMed]
Figure 1. Association of CCND1 G870A polymorphism (rs9344) and the levels of CCND1 mRNA expression in thyroid tumors. (a) The AA genotype is associated with high levels of CCND1b mRNA but not with those of CCND1a mRNA. (b) The distribution of rs9344 genotypes with respect to the various types of thyroid tumors. NH, nodular hyperplasia; FA, follicular adenoma; NIFTP, noninvasive follicular thyroid neoplasm with papillary-like nuclear features; PTC, papillary thyroid carcinoma; FTC, follicular thyroid carcinoma; PDTC, poorly differentiated thyroid carcinoma; MTC, medullary thyroid carcinoma.
Figure 1. Association of CCND1 G870A polymorphism (rs9344) and the levels of CCND1 mRNA expression in thyroid tumors. (a) The AA genotype is associated with high levels of CCND1b mRNA but not with those of CCND1a mRNA. (b) The distribution of rs9344 genotypes with respect to the various types of thyroid tumors. NH, nodular hyperplasia; FA, follicular adenoma; NIFTP, noninvasive follicular thyroid neoplasm with papillary-like nuclear features; PTC, papillary thyroid carcinoma; FTC, follicular thyroid carcinoma; PDTC, poorly differentiated thyroid carcinoma; MTC, medullary thyroid carcinoma.
Cancers 10 00437 g001
Figure 2. Expression of CCND1 mRNA isoforms relative to that of GAPDH in various types of thyroid tumors. NH, nodular hyperplasia; FA, follicular adenoma; NIFTP, noninvasive follicular thyroid neoplasm with papillary-like nuclear features; PTC, papillary thyroid carcinoma; FTC, follicular thyroid carcinoma; PDTC, poorly differentiated thyroid carcinoma; MTC, medullary thyroid carcinoma.
Figure 2. Expression of CCND1 mRNA isoforms relative to that of GAPDH in various types of thyroid tumors. NH, nodular hyperplasia; FA, follicular adenoma; NIFTP, noninvasive follicular thyroid neoplasm with papillary-like nuclear features; PTC, papillary thyroid carcinoma; FTC, follicular thyroid carcinoma; PDTC, poorly differentiated thyroid carcinoma; MTC, medullary thyroid carcinoma.
Cancers 10 00437 g002
Figure 3. Immunohistochemical staining of cyclin D1a and cyclin D1b in various types of thyroid tumors (×400).
Figure 3. Immunohistochemical staining of cyclin D1a and cyclin D1b in various types of thyroid tumors (×400).
Cancers 10 00437 g003
Figure 4. Heterogeneous immunostaining for cyclin D1b in papillary thyroid carcinoma. (a) Low magnification (×12) shows a classical papillary thyroid carcinoma with insets corresponding to high-power view of immunostaining for cyclin D1b shown in (bd). (b) The central areas show a patchy staining pattern (×400). (cd) Tumor cells at the invasive front show a diffuse staining pattern (×400).
Figure 4. Heterogeneous immunostaining for cyclin D1b in papillary thyroid carcinoma. (a) Low magnification (×12) shows a classical papillary thyroid carcinoma with insets corresponding to high-power view of immunostaining for cyclin D1b shown in (bd). (b) The central areas show a patchy staining pattern (×400). (cd) Tumor cells at the invasive front show a diffuse staining pattern (×400).
Cancers 10 00437 g004
Figure 5. Immunohistochemistry for cyclin D1a and cyclin D1b in noninvasive follicular thyroid neoplasm with papillary-like nuclear features (ad) and invasive encapsulated follicular variant of papillary thyroid carcinoma (eh). (a) Image of noninvasive follicular thyroid neoplasm with papillary-like nuclear features shows clear demarcation and follicular growth pattern (×40). (b) This tumor shows the nuclear features of papillary thyroid carcinoma characterized by nuclear enlargement, overlapping, and membrane irregularities (×400). (c) Immunohistochemical staining positive for cyclin D1a (c, ×100) and negative for cyclin D1b (d, ×100). (e) Histologic features of an invasive encapsulated follicular variant of papillary thyroid carcinoma (×40). (f) Positive immunostaining for cyclin D1a demarcates the site of invasive growth (indicated by arrows, ×100). High magnification (×400) showing positive immunostaining for cyclin D1a (g) and cyclin D1b (h).
Figure 5. Immunohistochemistry for cyclin D1a and cyclin D1b in noninvasive follicular thyroid neoplasm with papillary-like nuclear features (ad) and invasive encapsulated follicular variant of papillary thyroid carcinoma (eh). (a) Image of noninvasive follicular thyroid neoplasm with papillary-like nuclear features shows clear demarcation and follicular growth pattern (×40). (b) This tumor shows the nuclear features of papillary thyroid carcinoma characterized by nuclear enlargement, overlapping, and membrane irregularities (×400). (c) Immunohistochemical staining positive for cyclin D1a (c, ×100) and negative for cyclin D1b (d, ×100). (e) Histologic features of an invasive encapsulated follicular variant of papillary thyroid carcinoma (×40). (f) Positive immunostaining for cyclin D1a demarcates the site of invasive growth (indicated by arrows, ×100). High magnification (×400) showing positive immunostaining for cyclin D1a (g) and cyclin D1b (h).
Cancers 10 00437 g005
Figure 6. Noninvasive encapsulated classic papillary thyroid carcinoma with predominant follicular growth and BRAF V600E mutation. (a) Low magnification shows a well-circumscribed follicular tumor measuring 1.1 cm in greatest dimension (×12). (b) The tumor is clearly demarcated from normal thyroid tissue by a fibrous capsule (×100). (c) The nuclear features of tumor cells show nuclear enlargement, membrane irregularities, pseudoinclusions (indicated by arrows), and grooves (×400). (d) Follicles with abortive papillae are observed (×400). Immunohistochemistry shows diffuse positivity for BRAF VE1 (e) and focal positivity for cyclin D1b (f).
Figure 6. Noninvasive encapsulated classic papillary thyroid carcinoma with predominant follicular growth and BRAF V600E mutation. (a) Low magnification shows a well-circumscribed follicular tumor measuring 1.1 cm in greatest dimension (×12). (b) The tumor is clearly demarcated from normal thyroid tissue by a fibrous capsule (×100). (c) The nuclear features of tumor cells show nuclear enlargement, membrane irregularities, pseudoinclusions (indicated by arrows), and grooves (×400). (d) Follicles with abortive papillae are observed (×400). Immunohistochemistry shows diffuse positivity for BRAF VE1 (e) and focal positivity for cyclin D1b (f).
Cancers 10 00437 g006
Table 1. Expression of cyclin D1a and cyclin D1b in thyroid tumors from cohort 1 and cohort 2.
Table 1. Expression of cyclin D1a and cyclin D1b in thyroid tumors from cohort 1 and cohort 2.
Tumor TypenCyclin D1aCyclin D1b
NuclearNuclearCytoplasmic
Cohort 1281
Nodular hyperplasia16000
Follicular adenoma338 (33%)00
NIFTP99 (100%)1 (11%)0
Papillary thyroid carcinoma170170 (100%)110 (64.7%)124 (72.9%)
Classic125125 (100%)83 (66.4%)93 (74.4%)
Follicular variant1212 (100%)3 (25%)3 (25%)
Tall cell variant3333 (100%)24 (73%)28 (85%)
Follicular thyroid carcinoma3232 (100%)14 (13%)15 (16%)
Poorly differentiated thyroid carcinoma44 (100%)2 (50%)4 (100%)
Medullary thyroid carcinoma1717 (100%)12 (71%)12 (71%)
Cohort 258
NIFTP3434 (100%)5 (15%)4 (12%)
Invasive encapsulated follicular variant of papillary thyroid carcinoma2424 (100%)9 (38%)7 (29%)
Table 2. Correlation between clinicopathologic features and expression of CCND1 mRNA isoforms and cyclin D1b protein in 170 patients with papillary thyroid carcinoma. AJCC: American Joint Committee on Cancer.
Table 2. Correlation between clinicopathologic features and expression of CCND1 mRNA isoforms and cyclin D1b protein in 170 patients with papillary thyroid carcinoma. AJCC: American Joint Committee on Cancer.
CharacteristicnHigh Expression of CCND1 mRNA IsoformsHigh Expression of Cyclin D1b Protein
CCND1ap-ValueCCND1bp-ValueNuclearp-ValueCytoplasmicp-Value
Age (years) 0.042 0.660 0.422 0.801
<5512757 (44.9%) 63 (49.6%) 80 (63.0%) 92 (72.4%)
≥554327 (62.8%) 23 (53.5%) 30 (69.8%) 32 (74.4%)
Gender 0.396 0.916 0.423 0.208
Female13368 (51.1%) 67 (50.4%) 84 (63.2%) 94 (70.7%)
Male3716 (43.2%) 19 (51.4%) 26 (70.3%) 30 (81.1%)
Primary tumor size (cm) 0.070 0.268 0.357 0.149
≤1.09340 (42.1%) 43 (45.3%) 60 (63.2%) 66 (69.5%)
1.0–2.04927 (55.1%) 29 (59.2%) 30 (61.2%) 35 (71.4%)
>2.02617 (65.4%) 14 (53.8%) 20 (76.9%) 23 (88.5%)
Histologic variant 0.000 0.668 0.009 0.000
Classic12547 (37.6%) 61 (48.8%) 83 (66.4%) 93 (74.4%)
Follicular variant129 (75.0%) 6 (50.0%) 3 (25.0%) 3 (25.0%)
Tall cell variant3328 (84.8%) 19 (57.6%) 24 (72.7%) 28 (84.8%)
Extrathyroidal extension 0.219 0.633 0.516 0.150
Absent7532 (42.7%) 35 (46.7%) 47 (62.7%) 51 (68.0%)
Microscopic8143 (53.1%) 44 (54.3%) 52 (64.2%) 60 (74.1%)
Gross149 (64.3%) 7 (50.0%) 11 (78.6%) 13 (92.9%)
Lymph node metastasis 0.638 0.047 0.002 0.000
Absent8038 (47.5%) 34 (42.5%) 42 (52.5%) 48 (60.0%)
Present9046 (51.1%) 52 (57.8%) 68 (75.6%) 76 (84.4%)
Lateral lymph node metastasis 0.152 0.613 0.059 0.010
Absent13764 (46.7%) 68 (49.6%) 84 (61.3%) 94 (68.6%)
Present3320 (60.6%) 18 (54.5%) 26 (78.8%) 30 (90.9%)
Distant metastasis 0.028 0.059 0.163 0.325
Absent16579 (47.9%) 81 (49.1%) 105 (63.6%) 119 (72.1%)
Present55 (100%) 5 (100%) 5 (100%) 5 (100%)
BRAF V600E mutation 0.276 0.893 0.108 0.323
Negative2917 (58.6%) 15 (51.7%) 15 (51.7%) 19 (65.5%)
Positive14167 (47.5%) 71 (50.4%) 95 (67.4%) 105 (74.5%)
Recurrence risk 0.060 0.286 0.043 0.010
Low5520 (36.4%) 23 (41.8%) 32 (58.2%) 35 (63.6%)
Intermediate8446 (54.8%) 46 (54.8%) 52 (61.9%) 60 (71.4%)
High3118 (58.1%) 17 (54.8%) 26 (83.9%) 29 (93.5%)
AJCC stage, 7th edition 0.233 0.001 0.047 0.303
I9744 (45.4%) 39 (40.2%) 57 (58.8%) 66 (68.0%)
II32 (66.7%) 2 (66.7%) 2 (66.7%) 2 (66.7%)
III6735 (52.2%) 42 (62.7%) 48 (71.6%) 53 (79.1%)
IV33 (100%) 3 (100%) 3 (100%) 3 (100%)
AJCC stage, 8th edition 0.022 0.011 0.081 0.282
I14969 (46.3%) 70 (47.0%) 93 (62.4%) 107 (71.8%)
II1913 (68.4%) 14 (73.7%) 15 (78.9%) 15 (78.9%)
IV22 (100%) 2 (100%) 2 (100%) 2 (100%)
Table 3. Correlation between clinicopathologic features and expression of mRNA CCND1 isoforms and cyclin D1b protein in 125 patients with classic variant of papillary thyroid carcinoma.
Table 3. Correlation between clinicopathologic features and expression of mRNA CCND1 isoforms and cyclin D1b protein in 125 patients with classic variant of papillary thyroid carcinoma.
CharacteristicnHigh Expression of CCND1 mRNA IsoformsHigh Expression of Cyclin D1b Protein
CCND1ap-ValueCCND1bp-ValueNuclearp-ValueCytoplasmicp-Value
Age (years) 0.022 0.438 0.289 0.358
<559430 (31.9%) 44 (46.8%) 60 (63.8%) 68 (72.3%)
≥553117 (54.8%) 17 (54.8%) 23 (74.2%) 25 (80.6%)
Gender 0.499 0.885 0.122 0.040
Female9738 (39.2%) 47 (48.5%) 61 (62.9%) 68 (70.1%)
Male289 (32.1%) 14 (50.0%) 22 (78.6%) 25 (89.3%)
Primary tumor size (cm) 0.709 0.078 0.473 0.156
≤1.08028 (35.0%) 33 (41.3%) 51 (63.8%) 56 (70.0%)
1.0–2.03013 (43.3%) 19 (63.3%) 20 (66.7%) 23 (76.7%)
>2.0156 (40.0%) 9 (60.0%) 12 (80.0%) 14 (93.3%)
Extrathyroidal extension 0.206 0.084 0.823 0.411
Absent5919 (32.2%) 24 (40.7%) 38 (64.4%) 41 (69.5%)
Microscopic5824 (41.4%) 32 (55.2%) 39 (67.2%) 45 (77.6%)
Gross84 (50.0%) 5 (62.5%) 6 (75.0%) 7 (87.5%)
Lymph node metastasis 0.661 0.038 0.006 0.005
Absent5921 (35.6%) 23 (39.0%) 32 (54.2%) 37 (62.7%)
Present6626 (39.4%) 38 (57.6%) 51 (77.3%) 56 (84.8%)
Lateral lymph node metastasis 0.142 0.144 0.202 0.065
Absent9934 (34.3%) 45 (45.5%) 63 (63.6%) 70 (70.7%)
Present2613 (50.0%) 16 (61.5%) 20 (76.9%) 23 (88.5%)
Distant metastasis 0.007 0.059 0.167 0.327
Absent12042 (35.0%) 81 (49.1%) 78 (65.0%) 88 (73.3%)
Present55 (100%) 5 (100%) 5 (100%) 5 (100%)
BRAF V600E mutation 0.743 0.713 0.694 0.234
Negative177 (41.2%) 9 (52.9%) 12 (70.6%) 15 (88.2%)
Positive10840 (37.0%) 52 (48.1%) 71 (65.7%) 78 (72.2%)
Recurrence risk 0.258 0.056 0.190 0.111
Low4814 (29.2%) 17 (35.4%) 30 (62.5%) 33 (68.8%)
Intermediate5422 (40.7%) 30 (55.6%) 34 (63.0%) 39 (72.2%)
High2311 (47.8%) 14 (60.9%) 19 (82.6%) 21 (91.3%)
AJCC stage, 7th edition 0.014 0.007 0.065 0.025
I7020 (28.6%) 27 (38.6%) 42 (60.0%) 47 (67.1%)
II32 (66.7%) 2 (66.7%) 2 (66.7%) 2 (66.7%)
III4722 (44.9%) 29 (59.2%) 36 (73.5%) 41 (83.7%)
IV33 (100%) 3 (100%) 3 (100%) 3 (100%)
AJCC stage, 8th edition 0.004 0.008 0.038 0.131
I10735 (32.7%) 47 (43.9%) 67 (62.6%) 77 (72.0%)
II1610 (62.5%) 12 (75.0%) 14 (87.5%) 14 (87.5%)
IV22 (100%) 2 (100%) 2 (100%) 2 (100%)
Table 4. Expression of CCND1b mRNA and cyclin D1b protein in an independent cohort of noninvasive follicular thyroid neoplasm with papillary-like nuclear features (NIFTP) and invasive encapsulated follicular variant of papillary thyroid carcinoma.
Table 4. Expression of CCND1b mRNA and cyclin D1b protein in an independent cohort of noninvasive follicular thyroid neoplasm with papillary-like nuclear features (NIFTP) and invasive encapsulated follicular variant of papillary thyroid carcinoma.
Molecular AlterationNIFTP (n = 34)Invasive Encapsulated Follicular Variant of Papillary Thyroid Carcinoma (n = 24)p-Value
High expression of CCND1b mRNA18 (52.9%)13 (54.2%)0.927
High expression of nuclear cyclin D1b5 (14.7%)9 (37.5%)0.046
High expression of cytoplasmic cyclin D1b4 (11.8%)7 (29.2%)0.096
BRAF V600E mutation00
BRAF K601E mutation2 (5.9%)00.339
RAS mutation (total)20 (58.8%)13 (54.2%)0.724
NRAS mutation14 (41.2%)8 (33.3%)0.544
HRAS mutation6 (17.6%)4 (16.7%)0.605
KRAS mutation02 (8.3%)0.167

Share and Cite

MDPI and ACS Style

Jeon, S.; Kim, Y.; Jeong, Y.M.; Bae, J.S.; Jung, C.K. CCND1 Splice Variant as A Novel Diagnostic and Predictive Biomarker for Thyroid Cancer. Cancers 2018, 10, 437. https://doi.org/10.3390/cancers10110437

AMA Style

Jeon S, Kim Y, Jeong YM, Bae JS, Jung CK. CCND1 Splice Variant as A Novel Diagnostic and Predictive Biomarker for Thyroid Cancer. Cancers. 2018; 10(11):437. https://doi.org/10.3390/cancers10110437

Chicago/Turabian Style

Jeon, Sora, Yourha Kim, Young Mun Jeong, Ja Seong Bae, and Chan Kwon Jung. 2018. "CCND1 Splice Variant as A Novel Diagnostic and Predictive Biomarker for Thyroid Cancer" Cancers 10, no. 11: 437. https://doi.org/10.3390/cancers10110437

APA Style

Jeon, S., Kim, Y., Jeong, Y. M., Bae, J. S., & Jung, C. K. (2018). CCND1 Splice Variant as A Novel Diagnostic and Predictive Biomarker for Thyroid Cancer. Cancers, 10(11), 437. https://doi.org/10.3390/cancers10110437

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop