A Bee Trp-Arg Dense Peptide with Antiproliferation Efficacy against the Prostate Cancer Cell Line DU145
Abstract
1. Introduction
2. Materials and Methods
2.1. Cell Line and Cell Culture
2.2. Identification and Structural Analysis of Trp-Arg Peptides Derived from Honey Bee DNA
2.3. MTT Assay
2.4. The Formation of Prostate Cancer Spheroids and Three-Dimensional (3D) Culture Assay
2.5. Flow Cytometry
2.6. Quantitative Real-Time PCR
2.7. Western Blot
2.8. JC-1 Staining
2.9. Statistical Analysis
3. Results
3.1. N0820 and N0821 Had Antiproliferation Activity against Androgen-Independent Prostate Cancer Cells
3.2. N0820 and N0821 Suppressed the Prostate Cancer Spheroid Size in a 3D Environment
3.3. N0820 and N0821 Had Ion-Channel-Like Activity and Overloaded Ca2+ into the Mitochondria by Reducing the Expression and Phosphorylation of p53
3.4. N0820 and N0821 Induced Apoptosis in the Androgen-Independent Prostate Cancer Cell Line DU145
3.5. N0820 and N0821 Induced S/G2 Phase Cell Cycle Arrest in the Androgen-Independent Prostate Cancer Cell Line DU145
4. Discussion
5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Goodarzi, E.; Khazaei, Z.; Sohrabivafa, M.; Momenabadi, V.; Moayed, L. Global cancer statistics 2018: Globocan estimates of incidence and mortality worldwide prostate cancers and their relationship with the human development index. Adv. Hum. Biol. 2019, 9, 245–250. [Google Scholar] [CrossRef]
- Bentel, J.M.; Tilley, W.D. Androgen receptors in prostate cancer. J. Endocrinol. 1996, 151, 1–11. [Google Scholar] [CrossRef]
- Small, E.J.; Vogelzang, N.J. Second-line hormonal therapy for advanced prostate cancer: A shifting paradigm. J. Clin. Oncol. 1997, 15, 382–388. [Google Scholar] [CrossRef]
- Chen, M.; Zhou, B.; Zhong, P.; Rajamanickam, V.; Dai, X.; Karvannan, K.; Zhou, H.; Zhang, X.; Liang, G. Increased Intracellular Reactive Oxygen Species Mediates the Anti-Cancer Effects of WZ35 via Activating Mitochondrial Apoptosis Pathway in Prostate Cancer Cells. Prostate 2017, 77, 489–504. [Google Scholar] [CrossRef]
- Devlin, H.-L.; Mudryj, M. Progression of prostate cancer: Multiple pathways to androgen independence. Cancer Lett. 2009, 274, 177–186. [Google Scholar] [CrossRef]
- Chen, X.; Zhang, M.; Zhou, C.; Kallenbach, N.R.; Ren, D. Control of bacterial persister cells by Trp/Arg-containing antimicrobial peptides. Appl. Environ. Microbiol. 2011, 77, 4878–4885. [Google Scholar] [CrossRef] [PubMed]
- Liu, S.; Yu, M.; He, Y.; Xiao, L.; Wang, F.; Song, C.; Sun, S.; Ling, C.; Xu, Z. Melittin prevents liver cancer cell metastasis through inhibition of the Rac1-dependent pathway. J. Hepatol. 2008, 47, 1964–1973. [Google Scholar] [CrossRef] [PubMed]
- Yang, S.-T.; Shin, S.Y.; Kim, Y.-C.; Kim, Y.; Hahm, K.-S.; Kim, J.I. Conformation-dependent antibiotic activity of tritrpticin, a cathelicidin-derived antimicrobial peptide. Biochem. Biophys. Res. Commun. 2002, 296, 1044–1050. [Google Scholar] [CrossRef] [PubMed]
- Arias, M.; Nguyen, L.T.; Kuczynski, A.M.; Lejon, T.; Vogel, H.J. Position-dependent influence of the three trp residues on the membrane activity of the antimicrobial peptide, tritrpticin. Antibiotics 2014, 3, 595–616. [Google Scholar] [CrossRef] [PubMed]
- Ming Yin, C.; Ho Wong, J.; Xia, J.; Bun Ng, T. Studies on anticancer activities of lactoferrin and lactoferricin. Curr. Protein Pept. Sci. 2013, 14, 492–503. [Google Scholar]
- Gifford, J.L.; Hunter, H.N.; Vogel, H.J. Lactoferricin: Lactoferricin: A lactoferrin-derived peptide with antimicrobial, antiviral, antitumor and immunological properties. Cell. Mol. Life Sci. 2005, 62, 2588–2598. [Google Scholar] [CrossRef]
- Staubitz, P.; Peschel, A.; Nieuwenhuizen, W.F.; Otto, M.; Götz, F.; Jung, G.; Jack, R.W. Structure–function relationships in the tryptophan-rich, antimicrobial peptide indolicidin. J. Pept.Sci. Off. Publ. Eur. Pept. Soc. 2007, 7, 552–564. [Google Scholar] [CrossRef]
- Casteels, P.; Ampe, C.; Jacobs, F.; Vaeck, M.; Tempst, P. Apidaecins: Antibacterial peptides from honeybees. EMBO J. 1989, 8, 2387–2391. [Google Scholar] [CrossRef]
- Hoskin, D.W.; Ramamoorthy, A. Studies on anticancer activities of antimicrobial peptides. Biochim. Biophys. Acta Biomembr. 2008, 1778, 357–375. [Google Scholar] [CrossRef]
- Arias, M.; Haney, E.F.; Hilchie, A.L.; Corcoran, J.A.; Hyndman, M.E.; Hancock, R.E.; Vogel, H.J. Selective anticancer activity of synthetic peptides derived from the host defence peptide tritrpticin. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183228. [Google Scholar] [CrossRef] [PubMed]
- Stutz, K.; Müller, A.T.; Hiss, J.A.; Schneider, P.; Blatter, M.; Pfeiffer, B.; Posselt, G.; Kanfer, G.; Kornmann, B.; Wrede, P.; et al. Peptide–Membrane interaction between targeting and lysis. ACS Chem. Biol. 2017, 12, 2254–2259. [Google Scholar] [CrossRef] [PubMed]
- Chan, D.I.; Prenner, E.J.; Vogel, H.J. Tryptophan-and arginine-rich antimicrobial peptides: Structures and mechanisms of action. Biochim. Biophys. Acta Biomembr. 2006, 1758, 1184–1202. [Google Scholar] [CrossRef]
- Avci, F.G.; Sariyar Akbulut, B.; Ozkirimli, E. Membrane active peptides and their biophysical characterization. Biomolecules 2018, 8, 77. [Google Scholar] [CrossRef] [PubMed]
- Jin, L.; Bai, X.; Luan, N.; Yao, H.; Zhang, Z.; Liu, W.; Chen, Y.; Yan, X.; Rong, M.; Lai, R.; et al. A designed tryptophan- and lysine/arginine-rich antimicrobial peptide with therapeutic potential for clinical antibiotic-resistant Candida albicans vaginitis. J. Med. Chem. 2016, 59, 1791–1799. [Google Scholar] [CrossRef]
- Theisen-Jones, H.; Bienefeld, K. The asian honey bee (Apis cerana) is significantly in decline. Bee World 2016, 93, 90–97. [Google Scholar] [CrossRef]
- Paar, J.; Oldroyd, B.P.; Huettinger, E.; Kastberger, G. Genetic structure of an apis dorsata population: The significance of migration and colony aggregation. J. Hered. 2004, 95, 119–126. [Google Scholar] [CrossRef] [PubMed]
- Ilyasov, R.A.; Lee, M.-L.; Takahashi, J.-I.; Kwon, H.W.; Nikolenko, A.G. A revision of subspecies structure of western honey bee Apis mellifera. Saudi J. Biol. Sci. 2020, 27, 3615–3621. [Google Scholar] [CrossRef]
- Oldroyd, B.P.; Wongsiri, S. Asian Honey Bees: Biology, Conservation, and Human Interactions; Harvard University Press: Cambridge, MA, USA, 2009. [Google Scholar]
- Tufféry, P.; Derreumaux, P. A refined pH-dependent coarse-grained model for peptide structure prediction in aqueous solution. Front. Bioinform. 2023, 3, 1113928. [Google Scholar] [CrossRef]
- Kim, M.; Kim, J.G.; Kim, K.Y. Trichosanthes kirilowii Extract Promotes Wound Healing through the Phosphorylation of ERK1/2 in Keratinocytes. Biomimetics 2022, 7, 154. [Google Scholar] [CrossRef] [PubMed]
- Park, S.C.; Kim, J.G.; Shin, Y.K.; Kim, K.Y. Antimicrobial activity of 4-hydroxyderricin, sophoraflavanone G, acetylshikonin, and kurarinone against the bee pathogenic bacteria Paenibacillus larvae and Melissococcus plutonius. J. Apic. Res. 2021, 60, 118–122. [Google Scholar] [CrossRef]
- Edmondson, R.; Broglie, J.J.; Adcock, A.F.; Yang, L. Three-dimensional cell culture systems and their applications in drug discovery and cell-based biosensors. ASSAY Drug Dev. Technol. 2014, 12, 207–218. [Google Scholar] [CrossRef]
- Kapałczyńska, M.; Kolenda, T.; Przybyła, W.; Zajączkowska, M.; Teresiak, A.; Filas, V.; Ibbs, M.; Bliźniak, R.; Łuczewski, L.; Lamperska, K. 2D and 3D cell cultures—A comparison of different types of cancer cell cultures. Arch. Med. Sci. 2018, 14, 910–919. [Google Scholar] [CrossRef]
- Bresciani, G.; Hofland, L.J.; Dogan, F.; Giamas, G.; Gagliano, T.; Zatelli, M.C. Evaluation of Spheroid 3D Culture Methods to Study a Pancreatic Neuroendocrine Neoplasm Cell Line. Front. Endocrinol. 2019, 10, 682. [Google Scholar] [CrossRef]
- Rieger, A.M.; Nelson, K.L.; Konowalchuk, J.D.; Barreda, D.R. Modified annexin V/propidium iodide apoptosis assay for accurate assessment of cell death. J. Vis. Exp. 2011, 50, e2597. [Google Scholar]
- Biosciences, B.D. Detection of Apoptosis Using the BD Annexin V FITC Assay on the BD FACSVerse™ System. 2011. Available online: https://www.bdbiosciences.com/content/dam/bdb/marketing-documents/BD_FACSVerse_Apoptosis_Detection_AppNote.pdf (accessed on 29 December 2023).
- Kim, Y.E.; Kim, K.Y.; Min, J.W.; Kim, M.J.; Kang, H.C. Exosomal AZGP1 as a New Diagnostic Marker Candidate for Pancreatic Cancer. Biomark J. 2022, 8, 162. [Google Scholar]
- Kim, C.; Kim, J.G.; Kim, K.Y. Anti-Candida Potential of Sclareol in Inhibiting Growth, Biofilm Formation, and Yeast-Hyphal Transition. J. Fungi 2023, 9, 98. [Google Scholar] [CrossRef] [PubMed]
- Yamada, Y.; Watanabe, Y.; Zhang, J.; Haraoka, J.; Ito, H. Changes in cortical and cerebellar bcl-2 mRNA levels in the developing hydrocephalic rat (LEW-HYR) as measured by a real time quantified RT-PCR. Neuroscience 2002, 114, 165–171. [Google Scholar] [CrossRef] [PubMed]
- Nguyen, A.T.; Kim, K.-Y. Inhibition of Proinflammatory Cytokines in Cutibacterium acnes-Induced Inflammation in HaCaT Cells by Using Buddleja davidii Aqueous Extract. Int. J. Inflamm. 2020, 2020, 8063289. [Google Scholar] [CrossRef]
- Wen, Y.; Mirji, N.; Irudayaraj, J. Epigenetic toxicity of PFOA and GenX in HepG2 cells and their role in lipid metabolism. Toxicol. Vitr. 2020, 65, 104797. [Google Scholar] [CrossRef] [PubMed]
- Kim, M.; Kim, J.; Shin, Y.K.; Kim, K.Y. Gentisic Acid Stimulates Keratinocyte Proliferation through ERK1/2 Phosphorylation. Int. J. Med. Sci. 2020, 17, 626–631. [Google Scholar] [CrossRef] [PubMed]
- Dariush, G.; Gholamhossein, R.; Rouhollah, F.; Mahmood, G.S.; Abdolhossein, S.; Mohsen, S.; Loghman, A. The application of ultrasonic vibration in human sperm cryopreservation as a novel method for the modification of physicochemical characteristics of freezing media. Sci. Rep. 2019, 9, 10066. [Google Scholar] [CrossRef] [PubMed]
- Kim, J.; Shin, Y.K.; Kim, K.Y. Promotion of Keratinocyte Proliferation by Tracheloside through ERK1/2 Stimulation. Evid. Based Complement. Altern. Med. 2018, 2018, 4580627. [Google Scholar] [CrossRef] [PubMed]
- Salay, L.C.; Procopio, J.; Oliveira, E.; Nakaie, C.R.; Schreier, S. Ion channel-like activity of the antimicrobial peptide tritrpticin in planar lipid bilayers. FEBS Lett. 2004, 565, 171–175. [Google Scholar]
- Bittremieux, M.; Bultynck, G. p53 and Ca2+ signaling from the endoplasmic reticulum: Partners in anti-cancer therapies. Oncoscience 2015, 2, 233–238. [Google Scholar] [CrossRef]
- Chen, L.; Sun, Q.; Zhou, D.; Song, W.; Yang, Q.; Ju, B.; Zhang, L.; Xie, H.; Zhou, L.; Hu, Z.; et al. HINT2 triggers mitochondrial Ca2+ influx by regulating the mitochondrial Ca2+ uniporter (MCU) complex and enhances gemcitabine apoptotic effect in pancreatic cancer. Cancer Lett. 2017, 411, 106–116. [Google Scholar] [CrossRef]
- Giorgi, C.; Baldassari, F.; Bononi, A.; Bonora, M.; De Marchi, E.; Marchi, S.; Missiroli, S.; Patergnani, S.; Rimessi, A.; Suski, J.M.; et al. Mitochondrial Ca2+ and apoptosis. Cell Calcium 2012, 52, 36–43. [Google Scholar] [CrossRef] [PubMed]
- Tyagi, A.; Kapoor, P.; Kumar, R.; Chaudhary, K.; Gautam, A.; Raghava, G.P.S. In silico models for designing and discovering novel anticancer peptides. Sci. Rep. 2013, 3, 2984. [Google Scholar] [CrossRef] [PubMed]





| Bee Species | Trp-Arg Rich Region in Bee Sequence |
|---|---|
| Apis cerana | RRSWWCCCWYWWWWRWWRKILGRARWKCRR |
| Apis dorsata | RRSWWCCCWYWWWWRWWRKIFGRARWKCRR |
| Apis mellifera | RRSWWCCCWYWWWWRWWRKMFGRARWKCRR |
| Apis florea | RRSWWCCCWYWWWWRWWRKMFGRARWKCRR |
| Bee Species | Species Characteristics |
|---|---|
| Apis cerana | The species referred to as the Oriental honeybee is predominantly distributed throughout East Asia. Characterized by their relatively smaller size, they predominantly inhabit forested regions. |
| Apis dorsata | The species commonly referred to as the giant honeybee is primarily found in Asia and the South Pacific region. These bees are known for their large size and gregarious nature, forming expansive colonies. They typically construct their hives on tree branches, often in large clusters. |
| Apis mellifera | The Western honeybee exhibits a global distribution and is recognized as one of the most widely studied species of honey bee. With variations in size, they demonstrate adaptability to diverse environmental conditions and are capable of reproductive success across various habitats. |
| Apis florea | The species referred to as the Little Oriental Bee inhabits regions of East and South Asia. It is distinguished by its diminutive size and primarily forages nectar from small flowers. |
| Name | Peptide Sequence |
|---|---|
| N0820 | WWWWRWWRKI |
| N0821 | YWWWWRWWRKI |
![]() | |
| Gene | Primer Sequence (5′ to 3′) | Annealing Temp. (°C) | References |
|---|---|---|---|
| GAPDH | F: GTGAAGGTCGGAGTCAACG R: TGAGGTCAATGAAGGGGTC | 57.1 55.3 | [35] |
| CDKN2A (p14) | F: GGTTCTTGGTGACCCTC R: CTAGACGCTGGCTCCTCAGT | 59.5 58.4 | [This study] |
| CDKN1B (p27) | F: AAGGTTTGGAGAGCGGCTG R: GATCAAATGGACTGGCGAGC | 53.0 52.8 | [This study] |
| CCNA2 (Cyclin A2) | F: AGTAAACAGCCTGCGTTCACC R: GAGGGACCAATGGTTTTCTGG | 59.1 57.1 | [36] |
| CCNB1 (Cyclin B1) | F: TAAGGCGAAGATCAACATGG R: GCTTCCTTCTTCATAGGCAT | 53.0 52.8 | [37] |
| CCND1 (Cyclin D1) | F: CTGTGCTGCGAAGTGGAAACC R: GACGATCTTCCGCATGGAC | 60.6 57.3 | [25] |
| CCNE1 (Cyclin E1) | F: ACACCATGAAGGAGGACG R: CACAGACTGCATTATTGTCCC | 55.6 54.5 | [25] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Kim, Y.-e.; Kim, K.-Y. A Bee Trp-Arg Dense Peptide with Antiproliferation Efficacy against the Prostate Cancer Cell Line DU145. Curr. Issues Mol. Biol. 2024, 46, 2251-2262. https://doi.org/10.3390/cimb46030144
Kim Y-e, Kim K-Y. A Bee Trp-Arg Dense Peptide with Antiproliferation Efficacy against the Prostate Cancer Cell Line DU145. Current Issues in Molecular Biology. 2024; 46(3):2251-2262. https://doi.org/10.3390/cimb46030144
Chicago/Turabian StyleKim, Ye-eun, and Ki-Young Kim. 2024. "A Bee Trp-Arg Dense Peptide with Antiproliferation Efficacy against the Prostate Cancer Cell Line DU145" Current Issues in Molecular Biology 46, no. 3: 2251-2262. https://doi.org/10.3390/cimb46030144
APA StyleKim, Y.-e., & Kim, K.-Y. (2024). A Bee Trp-Arg Dense Peptide with Antiproliferation Efficacy against the Prostate Cancer Cell Line DU145. Current Issues in Molecular Biology, 46(3), 2251-2262. https://doi.org/10.3390/cimb46030144


