Next Article in Journal
Mean Field Multi-Agent Reinforcement Learning Method for Area Traffic Signal Control
Previous Article in Journal
Efficient Encoding Method for Combined Codes in the MWD Telemetry System
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Color Remote Sensing Image Restoration through Singular-Spectra-Derived Self-Similarity Metrics

1
School of Mathematics, Shandong University, Jinan 250100, China
2
Wolfson College, Oxford University, Oxford OX2 6UD, UK
*
Author to whom correspondence should be addressed.
Electronics 2023, 12(22), 4685; https://doi.org/10.3390/electronics12224685
Submission received: 12 October 2023 / Revised: 13 November 2023 / Accepted: 16 November 2023 / Published: 17 November 2023

Abstract

Color remote sensing images have key features of pronounced internal similarity characterized by numerous repetitive local patterns, so the capacity to effectively harness these self-similarity features plays a key role in the enhancement of color images. The main novelty of this study lies in that we utilized an unusual technique (singular spectrum) to derive brand-new similarity metrics inside the quaternion representation of color images and then incorporated these metrics into denoising algorithms. Color image denoising experiments demonstrated that compared with seven mainstream image restoration algorithms (homomorphic filtering (HPF), wavelet transforms (WT), non-local means (NLM), non-local total variation (NLTV), the color adaptation of non-local means (NLMC), quaternion Euclidean metric (QNLM), and quaternion Euclidean metric total variation (QNLTV)), our algorithms with two novel self-similarity metrics achieved maximum peak signal-to-noise ratio (PSNR), structural similarity index (SSIM), average gradient (AG), and information entropy index (IE) values, with average increases of 1.98 dB /2.12 dB, 0.1168/0.1244, 1.824/1.897, and 0.158/0.135. Moreover, for a complex, mixed-noise scenario, two versions of our algorithms also achieved average increases of 0.382 dB/0.394 dB and 0.0207/0.0210 under Motion and Gaussian mixed noise and average increases of 0.129 dB/0.154 dB and 0.0154/0.0158 under Average and Gaussian mixed noise compared with three quaternion-based restoration algorithms (QNLM, QNLTV, and quantization weighted nuclear norm minimization (QWNNM)).

1. Introduction

In the realm of remote sensing imaging, charge-coupled devices (CCDs) serve as instruments for the transformation of captured electromagnetic wave energy into image data. The further analysis and processing of captured images may discern various alterations in surface characteristics which play a pivotal role in resource exploration, agricultural and forestry management, military operations, and environmental surveillance [1]. Unfortunately, the imaging procedure is frequently subject to influences by the sensor itself and the prevailing environmental conditions, introducing various forms of noise [2,3]. The commonly encountered noise type in imaging follows a Gaussian distribution pattern. The intrusion of noise obscures the genuine surface information within remote sensing images, impeding further feature extraction, classification, target identification, and interpretation [4]. Various image enhancement techniques can increase the contrast and prominent features of noisy images and enhance the clarity of blurred images to enhance data utilization and application accuracy.
Due to noise interference, the low-frequency components in color remote sensing images are amplified. In response, an image-restorative approach employs a combination of frequency filtering and grayscale transformation to attenuate low-frequency components generated by noise while enhancing high-frequency components representing ground details. The known homomorphic filtering (HPF) [5,6,7] is designed to attenuate the low-frequency components generated by noise while enhancing the high-frequency components representing ground details. The color image is decomposed into the product of the illumination component and reflectance component, where the illumination component typically contains low-frequency information and the reflectance component contains high-frequency information. By adjusting HPF parameters, specific frequencies can be selectively enhanced or suppressed, achieving effective noise removal. HPF is particularly suitable for enhancing the contrast in specific images in complex lighting conditions. However, the restored colors often lack natural realism, and the resulting images may appear dim.
The emergence of wavelet transforms (WTs) has brought a new approach in image analysis. Due to the strong capacity for time–frequency localization, a discrete wavelet transform may provide sparse representation for smooth regions and textured regions of any image at the same time. The image information is always conserved in just a few high-magnitude wavelet coefficients, while inherent noise is represented by a large number of coefficients with small magnitudes. Johnstone and Silverman [8] showed that for images contaminated by Gaussian noise, level-dependent wavelet thresholding has a near-optimal behavior that cannot be enhanced by any local denoising filter. Lu et al. [9] separated remote sensing image details and noises across different wavelet spectral ranges and then used wavelet reconstruction to achieve the aim of image enhancement. Later on, various improvements in wavelet filters were proposed [10,11]. Although wavelet filters may effectively preserve remote sensing image details, the length of wavelet filters determines largely their regularity and symmetry, leading to artificial distortion and shortcomings in representing local textures [12].
Due to the repetitiveness of features like buildings, rivers, and trees, color remote sensing images exhibit stronger non-local self-similarity features than images from other sources [13]. By using Euclidean distance to extract similar patches inside any image and applying the ensemble mean of these image patches, the non-local means (NLM) algorithm proficiently suppresses noise and extracts important patterns in remote sensing images [14,15]. For a high noise level, the damage degree of the image is too large. If an NLM algorithm was used directly, the enhanced images would be blurred and the edge information would be lost, so the quaternion gaussian filter (QGF) was introduction for pre-processing. Later on, the non-local total variation (NLTV) improved the NLM algorithm by utilizing the contribution of distantly related pixels to the current pixel as the similarity metric [16]. For denoising color images, three improvements to the NLM have been proposed: the color adaptation of non-local means (NLMC) [14,17] was proposed to enhance the robustness of similarity weights between different channels. The quaternion non-local means (QNLM) is intended to apply the NLM directly to the quaternion representation of color images [18,19,20]. Li et al. [21] further developed quaternion-based non-local total variation (QNLTV). Although these improvements can better capture color information, enhancing adaptability to multi-channel data and effectively suppressing noise, they often underestimate the complexity and diversity of similar patches inside remote sensing images.
Restoring a color image from the corresponding corrupted one is usually complicated, especially for complex, mixed-noise scenarios [22]. Due to the fact that the high dimensional matrix inherently has a low-rank structure, restricting the underlying image matrix to a low rank is often a better approach [23]. Nuclear norm minimization (NNM) is a common convex surrogate for the rank minimization problem [24]. The NNM technique treats every singular value equally, which means that it posits that all the singular values contain the same information, regardless of their sizes. Since the larger singular values carry more information [25,26], the NNM often yields only sub-optimal results. Gu et al. [27] proposed using weighted nuclear norm minimization (WNNM) to assign a weight to each singular value in grayscale image denoising. Gu et al. [25] extended the application of WNNM into grayscale image denoising, background subtraction, color image inpainting, and color image denoising. Comparing grayscale and color image denoising schemes, an interesting phenomenon is always observed: some color spots possibly remain in denoised color images, while grayscale images have almost perfect results [25]. Noticing that quaternion matrices have a special multiplication rule which can be exploited to better present the internal structure of color images [28,29], in combination with the quaternion-based principal component analysis [30], in 2020–2022, Chen et al. [31] and Huang et al. [32] proposed denoising color images via quaternion-based low-rank regularization.
Color remote sensing images have key features of pronounced internal similarity characterized by numerous repetitive local patterns. The capacity to effectively harness these non-local similar patches plays a key role in the denoising and enhancement of images; therefore, in this study, we utilized an unusual technique (singular spectrum) to generate brand-new metrics for the measurement of the self-similarity inside the quaternion representation of color image patches and used these metrics as the weight of the ensemble mean of image patches to denoise color images. Denoising experiments indicate that our method surpasses homomorphic filtering (HPF), wavelet transforms (WTs), non-local means (NLM), non-local total variation (NLTV), the color adaptation of non-local means (NLMC), quaternion Euclidean metric (QNLM), quaternion Euclidean metric total variation (QNLTV) and quaternion weighted nuclear norm minimization (QWNNM).
This article is organized as follows: Section 2 provides a theoretical overview of color image denoising, Section 3 develops two novel singular-spectrum-derived metrics to measure the similarity inside the quaternion representation of color images and used these metrics as the weight of the ensemble mean of image patches to enhance color images. Section 4 conducts denoising experiments at both high and low noise levels, offering an analysis and discussion of the efficacy of the simple and updated iterations of our algorithm through comparisons with seven image enhancement techniques. Section 5 delves into an in-depth analysis of contrastive denoising experiments within a larger database and more complex denoising experiments in a complex, mixed-noise scenario. Finally, Section 6 serves as a comprehensive summary of our work and outlines potential avenues for future research.

2. Related Background

The imaging process is frequently impacted by both instrument and environmental factors, resulting in the intrusion of noise into color images and consequently hampering its visual quality. Color image denoising involves reconstructing the true image from a degraded observation, minimizing visual interference. Peng et al. [33] introduced a traditional median filtering for color image restoration. The core idea is to use the median of all pixels in the neighborhood around a pixel to replace the grayscale value of that pixel, thereby reducing noise in the image. Li [34] proposed a Total Variational (TV) image denoising model. Its success lies in utilizing the inherent regularity of natural images, making it easy to reflect the geometric regularity of real images from the solutions of noisy images. However, the restoration processes are relatively straightforward, often yielding less-than-ideal filtering results. To address these limitations, Yuan and He [35] constructed a high-pass filter by combining frequency filtering with grayscale transformation. It is applied to attenuate the low-frequency components generated by noise while enhancing the high-frequency components representing ground details. Homomorphic filtering [6] is a widely studied focus in this approach. In detail, the image f is divided into two components, illumination and reflection:
f ( x , y ) = m ( x , y ) r ( x , y )
where the illumination component m ( x , y ) and reflectance component r x , y , respectively, represent the lighting(low-frequency) and object reflection (high-frequency) information in the image. The strength of this filtering lies in its nonlinear decomposition processing of images and the application of clever filtering operations, adapting to various lighting conditions in color images. It not only preserves detailed information but also enhances overall image quality. Despite its ability to enhance contrast in specific remote sensing images, the restored colors often lack natural realism, and the resulting images may appear dim.
The emergence of wavelet transforms (WTs) has brought a new approach in image analysis. Lu et al. [9] introduced a two-dimensional wavelet transform restoration model, allowing for the extraction of image details across different spectral ranges in two-dimensional images and ultimately leading to image restoration through wavelet reconstruction. Dai et al. [12] pointed out that although wavelet filtering can effectively preserve color image details, different choices of wavelets with enough regularity and symmetry still possibly lead to pixel distortion and shortcomings in representing local spatial textures. Existing wavelet filters manipulate pixel values within a set range, often overlooking local characteristics and limiting restoration. With the help of non-local self-similarity (NSS) prior [14,36], Patch-based non-local means (NLM) was proposed by Buades et al. [14,36] for grayscale image denoising and has become one of the most successful methods in image denoising and image restoration.
All the aforementioned methods always handle grayscale or color image restoration in a monochromatic way. In other words, they treat the three channels of a color image as three independent images and overlook the relationship between them. Clearly, it is not reasonable to process the color image simply as the linear combination of grayscale images. The emergence of quaternion provides a novel approach to solve this issue. Qi and Zhang [37] extended the theory of complex number domain into the quaternion domain. Given the similarity between the three-color channels in color images and the three imaginary parts in pure quaternion matrices, color images may be represented as pure quaternion matrices [29]. Since quaternion matrices have abundant structures and theory, the internal structure of color images can be extracted well through quaternion operations [28].
A quaternion q consists of one real part and three imaginary parts. It is usually represented in the following algebraic:
q = a + b i + c j + d k
where a , b , c , a n d   d are real numbers and i , j , and k are complex operators that satisfy the following rules:
i 2 = j 2 = k 2 = 1 ,   i j = k ,   j k = i ,   k i = j ,   j i = k ,   k j = i ,   i k = j
The modulus and conjugate of a quaternion q are defined, respectively, as follows:
q = a 2 + b 2 + c 2 + d 2 ,     q = a b i c j d k
A color RGB image is commonly represented as the pure quaternion
s ( m , n ) = r ( m ,   n ) i + g ( m ,   n ) j + b ( m ,   n ) k
where r ( m , n ) , g m , n , and b ( m , n ) represent red, green, and blue channels of any color image.
The norms of quaternion matrices and vectors [37,38] are defined as follows. The l 2 -norm of the quaternion vector b = b 0 + b 1 i + b 2 j + b 3 k H n is defined as b 2 : = i b i 2 and can derive the known Euclidean distance, which is widely used as the similarity measure for color image patches in various denoising algorithms [18,19,20].
Chen et al. [39] incorporated singular-value decomposition into the quaternion domain. For any quaternion matrix D with rank r , its singular value decomposition is
D = U Σ V
where U and V are unitary quaternion matrices, Σ = diag λ 1 , λ 2 , , λ r , and represents the conjugate transpose. The sequence λ 1 , λ 2 , , λ r is called the singular spectra of the quaternion matrix D .
Wang et al. [18] and Jia et al. [20] extended the concept of non-local self-similarity to the quaternion domain. Initially, a quaternion matrix of a color image was constructed for each pixel, encompassing multi-channel information, to comprehensively reflect the image’s features. The quaternion metric was used to generate a weight matrix to measure the similarity in different regions of the image. Finally, by employing the quaternion non-local means (QNLM), which performed a weighted average over the entire image, the restoration effect of color images was achieved. The QNLM algorithm, due to its superior performance in multi-channel data processing, makes a significant contribution to improving image quality and noise suppression. The latest weighted nuclear norm minimization (WNNM) [32] for color image denoising is to solve the optimization problem is as follows:
min u λ 2 | | A u f | | 2 2 + u w ,
where λ is a positive parameter, A is a linear operator with quaternion representation, u is the ideal image, f is the observed image with quaternion representation, and   w , denotes the weighted nuclear norm. This model can be solved efficiently using the alternating direction method of multipliers (ADMM). The WNNM worked well, especially for handling complex mixed noises.

3. Our Proposed Algorithms

For any two image patches C i m , n and C j m , n with size w × w , denote their pure quaternion representation by
C i ( m , n ) = C i R ( m ,   n ) i + C i G ( m ,   n ) j + C i B ( m ,   n ) k C j ( m , n ) = C j R ( m ,   n ) i + C j G ( m ,   n ) j + C j B ( m ,   n ) k
where the superscripts R , G , and B represent the RGB channels of images, respectively.
The basic principle of our image denoising algorithms is to make full use of the self-similarity embedded in remote sensing images. To achieve this aim, we propose two singular-spectrum-derived self-similarity metrics as follows:
(a) 
Largest Singular Spectrum (LSS) metric 
The singular value decomposition of the difference of two quaternion representations is
C i C j = U T Σ T V T
where U T and V T are unitary matrices and Σ T = d i a g λ 1 , λ 2 , , λ r . The main features in the difference in image patches are generally related to large singular spectra and the noise information is hidden in the small singular spectra, so we define the largest singular spectrum metric as the similarity measure of two image patches:
M L S S C i , C j = λ 1
It is clear that the closer λ 1 becomes to zero, the more similar the two image patches are. The largest singular value metric not only streamlines calculations and reduces dimensionality but also remains robust to minor sample variations and noises.
(b) 
Full Singular Spectrum (FSS) metric 
Two image patches C i , C j are decomposed via singular value decomposition, respectively:
C i = U C i Σ C i V C i                 C j = U C j Σ C j V C j
The full singular spectrum metric of these two image patches is defined as
M F S S C i , C j = D ( Σ C i Σ C j ) S 1 ( D ( Σ C i Σ C j ) )
where the operator D can map any matrix into a row vector consisting of its diagonal entries, and S is the covariance matrix of all rows in the matrix D ( Σ C i ) , D ( Σ C j ) , where represents the conjugate transpose. In the definition of a full singular spectrum metric, the term D ( Σ C i Σ C j ) is used to measure the difference in the singular spectra of two image patches, and the matrix S is introduced to balance the covariance of different singular spectra in order to avoid this metric only depending on few singular spectra.
Applying quaternion singular value decomposition to the matrix S , we obtain
S = U S Σ S 0 0 0 V S
When the covariance matrix S is not inverse, we use its Moore–Penrose inverse matrix [40]:
S + = V S Σ S 1 0 0 0 U S
Since the largest singular spectrum λ S 1 of the matrix S satisfies
Σ S λ S 1 1 0 0 0
The Moore–Penrose inverse of the matrix S can be approximated by
S + 1 λ S 1 2 S
Therefore, the full singular spectrum (FSS) metric can be calculated approximately as
M F S S C i , C j = 1 λ S 1 D ( Σ C i Σ C j ) S ( D ( Σ C i Σ C j ) )
The noisy image is expressed as Y = X + N , where X is the clean image and N follows the Gaussian noise. The image X ^ enhanced by the simple version of our algorithms is calculated as follows:
X ^ i = j S i ω i j Y j j S i ω i j
where S i is the search window with a center Y i , and the weight ω i j is
ω i j L S S / F S S = e x p ( M L S S / F S S Y i , Y j / σ n 2 h 2 )
where M F S S / S S S Y i , Y j denotes the LSS or FSS metric between two image patches centered at Y i and Y j , respectively.
Noticing that all weights are based on the similarity metrics of two noisy image patches, when some noisy image patches are enhanced, the calculation of weights in the updated version of our algorithms can use these enhanced patches to replace noisy patches.

4. Denoising Experiments

We demonstrated the effectiveness of both the simple version and the updated version of our algorithms by comparing them with seven image enhancement techniques, including homomorphic filtering (HPF) [6], wavelet transforms (WTs) [10,35], non-local means (NLM) [14], non-local total variation (NLTV) [16], the color adaptation of non-local means (NLMC) [17], and quaternion-based methods (QNLM and QNLTV) [18,20,21].
The known UC Merced remote sensing dataset [41] comprises 21 land use classes, each containing 100 images, all with a size of 256 × 256 pixels. The dataset can be downloaded from http://faculty.ucmerced.edu/snewsam, accessed on 1 May 2022. We meticulously chose 14 scenes from the UC Merced dataset and then randomly selected 1–2 images from each class (Figure 1). The 16 color remote sensing images we chose covered various landscape types, such as urban areas, roads, and rivers and some images containing intricate textures, patterns, or fine details in order to rigorously evaluate the enhancement algorithms’ robustness.
We tested the running times of various denoising algorithms. We conducted denoising experiments using MATLAB R2020a on a laptop with a 2.40 GHz Intel Core i5-1135G7 CPU and 8 GB @ 3200 MHz DDR4 memory.
We conducted Gaussian blur tests on these color remote sensing images to evaluate enhancement performance. These images were subjected to varying levels of Gaussian noise, ranging from low noise levels σ = 15 ,35 to high noise levels σ = 55 ,75. Two indicators used to assess the enhancement quality of remote sensing images are the peak signal-to-noise ratio (PSNR) [42] and structural similarity index (SSIM) [43].

4.1. Low Noise Level

Compared with mainstream algorithms (HPF, WT, NLM, NLTV, NLMC, QNLM, and QNLTV), the simple and updated versions of our algorithms consistently exhibited superior performance in the PSNR and SSIM for various types of images (Table 1 and Table 2). In terms of the PSNR results (Table 1), our simple versions achieved significant average PSNR improvements, with enhancements ranging from 3.39 dB to 2.08 dB, 4.26 dB, 2.96 dB, 0.21 dB, 1.20 dB, and 0.66 dB, respectively, compared to the seven mainstream algorithms. This is precisely because using the two newly defined LSS and FSS metrics to measure the similarity between image patches is more robust than the traditional Euclidean distance. In particular, the LSS metric can not only capture self-similarity but is also robust to minor sample variations and noises. The FSS metric balances the effects between different singular spectral dimensions, avoiding the metric relying solely on few singular spectra. Our updated versions achieved approximately 0.32 dB and 0.49 dB over our simple versions. Regarding the SSIM results (Table 2), our simple versions consistently outperformed seven mainstream algorithms, with average advantages of 0.0736, 0.1032, 0.1294, 0.0791, 0.0620, 0.0399, and 0.0300, respectively. Compared with the simple versions, our updated versions further improved the average SSIM results by approximately 0.0057 and 0.0181.
Figure 2 illustrates the enhancement visual effects of various algorithms on storage tank images at a low noise level ( σ = 15 ). Compared with seven mainstream remote sensing image enhancement algorithms, our algorithms demonstrated a more substantial enhancement in the visual quality of the storage tank image. This improvement was particularly evident in the enhancement of storage tank edges and blurred backgrounds, as highlighted in the enlarged image within the red box. The traditional HPF, WT, and NLM algorithms did not adequately consider spectral relationships, resulting in the presence of pseudo-colors and subpar visual effects. The other four mainstream algorithms excessively smoothed the images, leading to the loss of most details in the storage tanks and background. Our simple versions managed to preserve some structure and details, although significant noise remained on the edges and fine details of the storage tanks. The average PSNR/SSIM values of our simple versions with the LSS and FSS metrics were 1.30 dB/0.0661 higher than those of seven mainstream image enhancement algorithms. In contrast, our updated versions effectively preserved a higher level of detailed information. The enhanced storage tank images exhibited clearer edges and a cleaner overall background. Additionally, the storage tank edges, wires, and shadows in the enlarged image were particularly distinct. This underscored the enhanced capabilities of our algorithms in remote sensing image enhancement, especially in achieving clearer and visually more satisfactory results. The average PSNR/SSIM values of our updated versions with the LSS and FSS metrics were 0.69 dB/0.0102 higher than those of simple versions.
At the noise level σ = 35 , the PSNR results of our simple version with the LSS metric in Table 3 showed significant advantages over seven mainstream algorithms (HPF, WT, NLM, NLTV, NLMC, QNLM, and QNLTV). The maximum differences in the PSNR values reached 3.58 dB, 4.46 dB, 5.66 dB, 0.33 dB, 3.31 dB, 0.79 dB, and 1.06 dB, respectively. The PSNR maximum difference between the simple versions with the LSS and FSS metrics was 3.26 dB. The utilization of all singular spectrum of image patches was more closely related to the similarity between image patches than pixel values. As a result, the newly defined quaternion metrics employed in our algorithms outperformed the Euclidean distance measures used in other algorithms. Our updated versions with the LSS and FSS metrics consistently outperformed their corresponding simple versions for nearly all images, and the PSNR maximum difference reached 0.47 dB and 0.42 dB. Using updated image patches to synchronously update weights was more effective at denoising than using weights from noisy image patches. The SSIM results (Table 4) also revealed significant advantages of our simple versions over seven mainstream enhancement algorithms. The maximum differences in the SSIM were 0.0512, 0.505, 0.5711, 0.4421, 0.2341, 0.1802, and 0.2120, respectively. Our updated versions with the LSS and FSS metrics exhibited SSIM maximum differences of 0.0339 and 0.0245 compared to the corresponding simple versions. The noteworthy improvements in the PSNR and SSIM values further underscore the efficacy and potential of our algorithms in addressing image enhancement tasks.
Figure 3 presents an example of overpass enhancement at the noise level σ = 35 . The HPF algorithm exhibited significant over-smoothing, while the WT, NLM, and NLTV introduced significant artifacts, resulting in the enhancement of road edges with pronounced blurriness. The NLMC, QNLM and QNLTV methods reduced artifacts to some extent. In comparison, our simple versions with LSS/FSS metrics demonstrated superior performance. They effectively distinguished the car’s silhouette from the road background and restored the road-to-lawn edges more effectively, resulting in clearer images. Furthermore, our updated versions yielded the clearest details of car contours and shadow edges, resulting in visually pleasing and aesthetically appealing imagery. The higher PSNR and SSIM values, with average increases of 1.80 dB/2.26 dB and 0.0825/0.09001, provided additional evidence of the superiority of our algorithms.

4.2. High Noise Level

At high noise levels, our algorithms consistently surpassed the seven mainstream algorithms in terms of PSNR/SSIM values for both complex updated versions and simple versions (Table 5 and Table 6). For the noise level σ = 55 , our simple versions with LSS/FSS metrics consistently outperformed the HPF, WT, NLM, NLTV, NLMC, QNLM, and QNLTV algorithms, with average PSNR (Table 5) increases of approximately 1.14 dB/1.34 dB, 2.99 dB/3.19 dB, 3.36 dB/3.56 dB, 2.11 dB/2.31 dB, 2.87 dB/3.07 dB, 0.72 dB/0.91 dB, and 0.04 dB/0.23 dB, respectively. The average SSIM (Table 6) increases were 0.0543/0.0500, 0.1855/0.1812, 0.2182/0.2139, 0.1593/0.1550, 0.1779/0.1736, 0.0595/0.0552, and 0.0477/0.0434, respectively. Similarly, our updated versions with LSS/FSS metrics demonstrated further improvements of approximately 0.56 dB/0.11 dB and 0.0290/0.0032, respectively, compared to the corresponding simple versions. Our proposed simple and updated denoising algorithms outperformed other algorithms due to the superior measurement of similarity between image patches via the quaternion LSS and FSS metrics compared to the Euclidean metric and the use of quaternions, which take into account the relationships between different channels of color images.
Figure 4 displays the enhancement of an airplane image using different enhancement algorithms at the noise level σ = 55 . The lower right corner was partially enlarged within a red box, and the upper right corner features a contour map of the entire image, providing clearer and more intuitive enhancement effects. The HPF algorithm introduced additional noise points into the restored image, accompanied by color irregularities. When the damage to airplane images was substantial, the applicability of the HPF algorithm became questionable. Upon close examination of the enlarged area, it became evident that WT/NLM/NLTV and NLMC/QNLM/QNLTV introduced numerous ringing artifacts into the background of the restored airplane image, resulting in blurry boundaries and details of the aircraft. The remote sensing images restored through our simple versions exhibited improved clarity, higher visual quality, and fewer artifacts. Nonetheless, these images still exhibited residual noise, with some artifacts persisting at the aircraft’s edges. Our algorithm had higher PSNR and SSIM values, with average increases of 2.16 dB/2.49 dB and 0.1284/0.1392 compared to other algorithms, showing certain advantages. Since our updated versions can preserve more essential information from the original remote sensing image during the recovery process, our updated versions with LSS/FSS metrics excels in reducing image noise points, preserving aircraft boundary contours, and restoring airport debris details.
At the noise level of σ = 75 , the average PSNR/SSIM values of our simple versions with the LSS and FSS metrics were 0.80 dB/0.0602, 1.79 dB/0.1929, 3.09 dB/0.1956, 1.84 dB/0.2456, 1.06 dB/0.1510, 0.02 dB/0.07350, and 0.05 dB/0.0829 higher than those of seven mainstream image enhancement algorithms (Table 7 and Table 8). Our updated versions achieved an additional improvement of 0.0803 dB/0.0069. Particularly in scenarios in which the remote sensing images suffered severe noise-induced damage, all competing algorithms yielded lower SSIM values. In contrast, our algorithms demonstrate enhanced resilience to high noise levels by maintaining SSIM values of 0.6 or even 0.7. Our proposed simple and updated algorithms with QGF preprocessing not only combined frequency filtering and grayscale transformation with color images but also utilized more robust singular-spectrum values to calculate the similarity between image patches. At high noise levels ( σ > 75 ), our proposed algorithms outperformed seven other algorithms in terms of denoising performance.
Figure 5 illustrates the visual impact on a golf course remote sensing image which had undergone enhancement using various algorithms following σ = 75 noise-induced damage. Clearly, in cases of severe damage to remote sensing images, the WT/NLM algorithms significantly distorted pseudo-colors, resulting in a highly blurred restored image. NLTV/NLMC/QNLM/QNLTV introduced notable artifacts, with road edges appearing particularly blurry. On the other hand, HPF reduced artifacts to some extent. The average PSNR/SSIM values of HPF were 4.09 dB/0.0838 higher than those of six mainstream image enhancement algorithms. In contrast, our simple versions, as evidenced in the contour map in the upper right corner, excelled at restoring the edge information of the golf course’s open space. Our updated versions provided the most visually pleasing golf course depiction in terms of color. Not only does the overall left image better preserve details like grass color and background, but the contour line of the open space in the upper right corner also closely resembled the original image. When the gourd-shaped open space in the golf course remote sensing image was magnified by 2.5 times, it optimally preserved the gourd’s edge. The higher PSNR and SSIM values, with average increases of 3.47 dB/4.21 dB and 0.0849/0.1305, provided additional evidence of the superiority of our algorithms.

5. More Denoising Experiments

5.1. Larger Color Image Sets

We demonstrated the effectiveness of our improvement in successfully restoring images corrupted by Gaussian noise. To further demonstrate the algorithms’ universality, a test set of 30 remote sensing images (Figure 6) were created by randomly selecting image combinations from each category in the UC Merced dataset. The simple and updated versions of our algorithm were compared with the HPF [6], WT [10,35], NLM [14], NLTV [16], NLMC [17], QNLM [18,20], and QNLTV [21] algorithms. Four indicators used to assess the enhancement quality of color images were the peak signal-to-noise ratio (PSNR) [42], structural similarity index (SSIM) [43], average gradient (AG) [44], and information entropy index (IE) [45]. The PSNR assesses restored image quality by comparing grayscale values with real images, while the SSIM assesses restored image quality by comparing structural similarity with real images. The AG and IE indicators do not use real images as a reference; instead, they rely on the human visual system for assessment.
Our algorithms consistently surpassed the seven mainstream algorithms in terms of PSNR/SSIM values for both complex updated versions and simple versions (Table 9). At all noise levels, our simple versions with LSS/FSS metrics consistently outperformed seven algorithms, with average PSNR (Table 9) increases of approximately 1.62 dB/1.65 dB, 2.57 dB/2.61 dB, 3.20 dB/3.23 dB, 1.66 dB/1.69 dB, 1.39 dB/1.42 dB, 2.54 dB/2.57 dB, and 0.79 dB /0.82 dB, respectively. The average SSIM (Table 9) increases were 0.0506/0.0463, 0.1825/0.1782, 0.1913/0.1870, 0.1165/0.1122, 0.1135/0.1092, 0.1141/0.1098, and 0.0637/0.0594, respectively. Similarly, our updated versions with LSS/FSS metrics demonstrated further improvements of approximately 0.04 dB/0.25 dB and 0.0014/0.0139, respectively, compared to the corresponding simple versions. The traditional Euclidean distance metric is sensitive to variations in illumination, contrast, and noise, which can lead to suboptimal performance in measuring image patch similarity. In contrast, the LSS and FSS metrics are designed to capture local and feature-based similarities, thereby providing a more comprehensive and accurate representation of similarity between image patches.
The average gradient (AG) results (Table 9 and Figure 7) of our simple version with the LSS metric showed significant advantages over seven mainstream algorithms. The AG maximum differences reached 2.734, 2.770, 2.801, 2.611, 2.936, 2.726, and 1.574, respectively. The maximum difference in the AG between the simple version with LSS and FSS metrics reached 0.811. Our updated versions with LSS and FSS metrics consistently outperformed their corresponding simple versions for nearly all images, and the AG maximum difference reached 1.120 and 0.842. The entropy index (IE) results (Table 9 and Figure 8) also revealed significant advantages of our simple versions over seven mainstream denoising algorithms. The maximum differences in the IE were 0.251, 0.255, 0.165, 0.548, 0.252, 0.226, and 0.223, respectively. The IE maximum difference between the simple version with LSS and FSS metrics was 0.122. Our updated versions with LSS and FSS metrics exhibited IE maximum differences of 0.133 and 0.034 compared to the corresponding simple versions. The noteworthy improvements in the PSNR, SSIM, AG, and IE values further underscore the efficacy and potential of our algorithms in addressing image enhancement tasks.

5.2. Mixed-Noise Scenario

Image restoration practices often involve a combination of various types of noises, so we considered two types of mixed noise, i.e., the combination of motion/average blur and Gaussian white noise (σ = 25), respectively. To demonstrate the effectiveness of the proposed model when handling mixed noise, we compared our method with several state-of-the-art quaternion-based methods for color image restoration, including QNLM, QNLTV, and QWNNM.
The PSNR and SSIM values of different restoration methods for color images with motion blur MB (20,60)/ σ = 25 and average blur AB (9,9)/ σ = 25 are shown in Table 10 and Table 11, respectively. Our proposed method generated better restoration results with different types of mixed noise. For motion blur MB (20,60)/ σ = 25 , our simple versions with LSS/FSS metrics consistently exhibited superior performance compared to the QNLM/QNLTV/QWNNM algorithms (Table 10), manifesting advantages of approximately 0.73 dB /0.68 dB, 0.30 dB /0.24 dB, and 0.21 dB /0.15 dB in terms of the average PSNR, respectively, and 0.0507/0.0506, 0.0093/0.0091, and 0.0023/0.0021 in terms of the average SSIM, respectively. Similarly, our updated versions with metrics demonstrated further improvements of approximately 0.0115 dB and 0.00034 compared to the simple versions. For average blur AB (9,9)/ σ = 25 , our simple versions with LSS/FSS metrics consistently exhibited superior performance compared to the QNLM/QNLTV/QWNNM algorithms (Table 11), manifesting advantages of approximately 0.07 dB /0.15 dB, 0.13 dB /0.21 dB, and 0.08 dB /0.16 dB in terms of the average PSNR, respectively, and 0.0191/0.020, 0.0163/0.0171, and 0.0097/0.0104 in terms of the average SSIM, respectively. Our updated versions with two metrics demonstrated further improvements of approximately 0.0255 dB and 0.00042 compared to the simple versions. The utilization of local similarity in image denoising exhibits greater efficacy when contrasted with low-rank techniques. Moreover, the use of our similarity metrics (LSS and FSS) to measure the similarity between image patches is indeed a significant advancement over traditional methods.

6. Conclusions

In this paper, we proposed and analyzed two quaternion-based singular spectrum metrics which can overcome the shortcomings of existing similarity measures. The LSS metric can not only capture self-similarity but is also robust to minor sample variations and noises. The FSS metric balances the effects between different singular spectral dimensions, avoiding the metric relying solely on few singular spectra. When the LSS and FSS metrics are used to represent the internal self-similarity of image patches as the weights of non-local denoising processes, they can adapt well to real-world noise scenarios. Among four levels of Gaussian noise and two types of mixed noise, the simple and updated versions of our denoising methods generated better restoration results on the known UC Merced dataset.
It is worth noting that we not only improved the remote sensing restoration algorithm, but more importantly, we established two brand-new similarity measurement tools (LSS and FSS). Since the core of many image denoising and other image analysis techniques actually depends on the measurement of self-similarity, in the future, we will intend to apply our LSS and FSS metrics to a range of denoising algorithms that leverage the local similarity of internal features in color images. Moreover, by leveraging the LSS and FSS metrics, we can expect improved performance in various computer vision tasks, including image recognition, object detection, and image retrieval. This enhanced robustness ultimately contributes to more reliable and effective image processing and analysis.

Author Contributions

X.X. and Z.Z. are co-first author. Conceptualization, Z.Z.; Methodology, X.X. and Z.Z.; Software, X.X.; Formal analysis, Z.Z. and M.J.C.C.; Investigation, M.J.C.C.; Writing—original draft, X.X. and Z.Z.; Writing—review & editing, Z.Z. and M.J.C.C. All authors have read and agreed to the published version of the manuscript.

Funding

The corresponding author was supported by the European Commission Horizon 2020 Framework Program No. 861584 and the Taishan Distinguished Professor Fund No. 20190910.

Data Availability Statement

Data are contained within the article.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Richards, J.A. Analysis of Remotely Sensed Data: The Formative Decades and the Future. IEEE Trans. Geosci. Remote Sens. 2005, 43, 422–432. [Google Scholar] [CrossRef]
  2. Bradley, S.; Daigle, G.A. Atmospheric Acoustic Remote Sensing. Phys. Today 2008, 61, 58. [Google Scholar] [CrossRef]
  3. Power, P.G. With contributions from Clare. In Introductory Remote Sensing Principles and Concepts; Routledge: London, UK, 2000; ISBN 978-0-203-71452-2. [Google Scholar]
  4. Shen, H.; Li, X.; Cheng, Q.; Zeng, C.; Yang, G.; Li, H.; Zhang, L. Missing Information Reconstruction of Remote Sensing Data: A Technical Review. IEEE Geosci. Remote Sens. Mag. 2015, 3, 61–85. [Google Scholar] [CrossRef]
  5. Seow, M.-J.; Asari, V.K. Ratio Rule and Homomorphic Filter for Enhancement of Digital Colour Image. Neurocomputing 2006, 69, 954–958. [Google Scholar] [CrossRef]
  6. Huihui, J.; Zhigang, L.; Jiangjun, J.; Yang, W. Removal of Hyperspectral Stripe Noise Using Low-Pass Filtered Residual Images. Acta Opt. Sin. 2018, 38, 1228002. [Google Scholar] [CrossRef]
  7. Jing-jing, Y.Q.L.D.Z. Improved Algorithm for Removing Thin Cloud in Single Remote Sensing Image. J. Comput. Appl. 2011, 31, 1227. [Google Scholar] [CrossRef]
  8. Johnstone, I.M.; Silverman, B.W. Wavelet Threshold Estimators for Data with Correlated Noise. J. R. Stat. Soc. Ser. B (Stat. Methodol.) 1997, 59, 319–351. [Google Scholar] [CrossRef]
  9. Lu, X.; Han, P.; Wu, R.; Liu, R. An Approach for SAR Image Despeckling Based on 2D-Wavelet Transform and ICA. JEIT 2008, 30, 1052–1055. [Google Scholar] [CrossRef]
  10. Ranjani, J.J.; Thiruvengadam, S.J. Dual-Tree Complex Wavelet Transform Based SAR Despeckling Using Interscale Dependence. IEEE Trans. Geosci. Remote Sens. 2010, 48, 2723–2731. [Google Scholar] [CrossRef]
  11. Liu, S.; Hu, S.; Xiao, Y. SAR Image De-Noising Based on Complex Shearlet Transform Domain Gaussian Mixture Model. Hangkong Xuebao/Acta Aeronaut. Astronaut. Sin. 2013, 34, 173–180. [Google Scholar] [CrossRef]
  12. Dai, M.; Peng, C.; Chan, A.K.; Loguinov, D. Bayesian Wavelet Shrinkage with Edge Detection for SAR Image Despeckling. IEEE Trans. Geosci. Remote Sens. 2004, 42, 1642–1648. [Google Scholar] [CrossRef]
  13. Upla, K.P.; Joshi, M.V.; Khatri, N. A Regularized Pan-Sharpening Approach Based on Self-Similarity and Gabor Prior. Int. J. Remote Sens. 2017, 38, 949–984. [Google Scholar] [CrossRef]
  14. Lisani, J.-L.; Buades, A.; Morel, J.-M. How to Explore the Patch Space. IPI 2013, 7, 813–838. [Google Scholar] [CrossRef]
  15. Deledalle, C.-A.; Denis, L.; Tupin, F.; Reigber, A.; Jäger, M. NL-SAR: A Unified Nonlocal Framework for Resolution-Preserving (Pol)(In)SAR Denoising. IEEE Trans. Geosci. Remote Sens. 2015, 53, 2021–2038. [Google Scholar] [CrossRef]
  16. Liu, Q.; Gao, X.; He, L.; Lu, W. Single Image Dehazing With Depth-Aware Non-Local Total Variation Regularization. IEEE Trans. Image Process. 2018, 27, 5178–5191. [Google Scholar] [CrossRef]
  17. Goossens, B.; Luong, H.; Aelterman, J.; Pižurica, A.; Philips, W. A GPU-Accelerated Real-Time NLMeans Algorithm for Denoising Color Video Sequences. In Advanced Concepts for Intelligent Vision Systems, Proceedings of the 12th International Conference, ACIVS 2010, Sydney, Australia, 13–16 December 2010; Springer: Berlin/Heidelberg, Germany, 2010; pp. 46–57. [Google Scholar]
  18. Wang, G.; Liu, Y.; Xiong, W.; Li, Y. An Improved Non-Local Means Filter for Color Image Denoising. Optik 2018, 173, 157–173. [Google Scholar] [CrossRef]
  19. Chen, B.; Liu, Q.; Sun, X.; Li, X.; Shu, H. Removing Gaussian Noise for Colour Images by Quaternion Representation and Optimisation of Weights in Non-Local Means Filter. IET Image Process. 2014, 8, 591–600. [Google Scholar] [CrossRef]
  20. Jia, Z.; Jin, Q.; Ng, M.K.; Zhao, X.-L. Non-Local Robust Quaternion Matrix Completion for Large-Scale Color Image and Video Inpainting. IEEE Trans. Image Process. 2022, 31, 3868–3883. [Google Scholar] [CrossRef]
  21. Li, X.; Zhou, Y.; Zhang, J. Quaternion Non-Local Total Variation for Color Image Denoising. In Proceedings of the 2019 IEEE International Conference on Systems, Man and Cybernetics (SMC), Bari, Italy, 6–9 October 2019; pp. 1602–1607. [Google Scholar]
  22. Mei, K.; Li, J.; Zhang, J.; Wu, H.; Li, J.; Huang, R. HighEr-Resolution Network for Image Demosaicing and Enhancing. In Proceedings of the 2019 IEEE/CVF International Conference on Computer Vision Workshop (ICCVW), Seoul, Republic of Korea, 27–28 October 2019; pp. 3441–3448. [Google Scholar]
  23. Liu, F.; Wang, S.; Qin, J.; Lou, Y.; Rosenberger, J. Estimating Latent Brain Sources with Low-Rank Representation and Graph Regularization. In Brain Informatics; Lecture Notes in Computer Science; Wang, S., Yamamoto, V., Su, J., Yang, Y., Jones, E., Iasemidis, L., Mitchell, T., Eds.; Springer International Publishing: Cham, Switzerland, 2018; Volume 11309, pp. 304–316. ISBN 978-3-030-05586-8. [Google Scholar]
  24. Jiang, X.; Zhang, L.; Qiao, L.; Shen, D. Estimating Functional Connectivity Networks via Low-Rank Tensor Approximation with Applications to MCI Identification. IEEE Trans. Biomed. Eng. 2020, 67, 1912–1920. [Google Scholar] [CrossRef]
  25. Gu, S.; Xie, Q.; Meng, D.; Zuo, W.; Feng, X.; Zhang, L. Weighted Nuclear Norm Minimization and Its Applications to Low Level Vision. Int. J. Comput. Vis. 2017, 121, 183–208. [Google Scholar] [CrossRef]
  26. Kang, Z.; Peng, C.; Cheng, Q. Robust PCA via Nonconvex Rank Approximation. In Proceedings of the 2015 IEEE International Conference on Data Mining, Atlantic City, NJ, USA, 14–17 November 2015; pp. 211–220. [Google Scholar]
  27. Gu, S.; Zhang, L.; Zuo, W.; Feng, X. Weighted Nuclear Norm Minimization with Application to Image Denoising. In Proceedings of the 2014 IEEE Conference on Computer Vision and Pattern Recognition, Columbus, OH, USA, 23–28 June 2014; IEEE: Columbus, OH, USA, 2014; pp. 2862–2869. [Google Scholar]
  28. Liu, X.; Chen, Y.; Peng, Z.; Wu, J.; Wang, Z. Infrared Image Super-Resolution Reconstruction Based on Quaternion Fractional Order Total Variation with Lp Quasinorm. Appl. Sci. 2018, 8, 1864. [Google Scholar] [CrossRef]
  29. Zhang, F. Quaternions and Matrices of Quaternions. Linear Algebra Its Appl. 1997, 251, 21–57. [Google Scholar] [CrossRef]
  30. Jia, Z.-G.; Ling, S.-T.; Zhao, M.-X. Color Two-Dimensional Principal Component Analysis for Face Recognition Based on Quaternion Model. In Intelligent Computing Theories and Application, Proceedings of 13th International Conference, ICIC 2017, Liverpool, UK, 7–10 August 2017; Huang, D.-S., Bevilacqua, V., Premaratne, P., Gupta, P., Eds.; Springer International Publishing: Cham, Switzerland, 2017; pp. 177–189. [Google Scholar]
  31. Chen, Y.; Xiao, X.; Zhou, Y. Low-Rank Quaternion Approximation for Color Image Processing. IEEE Trans. Image Process. 2020, 29, 1426–1439. [Google Scholar] [CrossRef] [PubMed]
  32. Huang, C.; Li, Z.; Liu, Y.; Wu, T.; Zeng, T. Quaternion-Based Weighted Nuclear Norm Minimization for Color Image Restoration. Pattern Recognit. 2022, 128, 108665. [Google Scholar] [CrossRef]
  33. Peng, L.U.; Cai, L.; Wang-Song, L.; Li-Xin, X.; Yang, L.; Dian, W. The Application of the Median Filter in the Remote Sensing Image Processing. J. Jiling Univ. (Earth Sci. Ed.) 2005, 151–154. [Google Scholar]
  34. Li, M. A Fast Algorithm for Color Image Enhancement with Total Variation Regularization. Sci. China Inf. Sci. 2010, 53, 1913–1916. [Google Scholar] [CrossRef][Green Version]
  35. Yuan, J.; He, G. Application of an Anisotropic Diffusion Based Preprocessing Filtering Algorithm for High Resolution Remote Sensing Image Segmentation. In Proceedings of the 2008 Congress on Image and Signal Processing, Sanya, China, 27–30 May 2008; Volume 3, pp. 629–633. [Google Scholar]
  36. Buades, A.; Coll, B.; Morel, J.-M. A Non-Local Algorithm for Image Denoising. In Proceedings of the 2005 IEEE Computer Society Conference on Computer Vision and Pattern Recognition (CVPR’05), San Diego, CA, USA, 20–25 June 2005; Volume 2, pp. 60–65. [Google Scholar]
  37. Qi, L.; Luo, Z.; Wang, Q.; Zhang, X. Quaternion Matrix Optimization and The Underlying Calculus. arXiv 2020, arXiv:2009.13884v10. [Google Scholar]
  38. Yang, T.; Ma, J.; Miao, Y.; Wang, X.; Xiao, B.; He, B.; Meng, Q. Quaternion Weighted Spherical Bessel-Fourier Moment and Its Invariant for Color Image Reconstruction and Object Recognition. Inf. Sci. 2019, 505, 388–405. [Google Scholar] [CrossRef]
  39. Chen, Y.; Jia, Z.; Peng, Y.; Peng, Y. Robust Dual-Color Watermarking Based on Quaternion Singular Value Decomposition. IEEE Access 2020, 8, 30628–30642. [Google Scholar] [CrossRef]
  40. Huang, L.; Wang, Q.-W.; Zhang, Y. The Moore–Penrose Inverses of Matrices over Quaternion Polynomial Rings. Linear Algebra Its Appl. 2015, 475, 45–61. [Google Scholar] [CrossRef]
  41. Yang, Y.; Newsam, S. Bag-of-Visual-Words and Spatial Extensions for Land-Use Classification. In Proceedings of the 18th SIGSPATIAL International Conference on Advances in Geographic Information Systems, San Jose, CA, USA, 2–5 November 2010; Association for Computing Machinery: New York, NY, USA, 2010; pp. 270–279. [Google Scholar]
  42. Slanina, M. Estimating PSNR in High Definition H.264/AVC Video Sequences Using Artificial Neural Networks. Radioengineering 2008, 17, 103–108. [Google Scholar]
  43. Wang, Z.; Bovik, A.C.; Sheikh, H.R.; Simoncelli, E.P. Image Quality Assessment: From Error Visibility to Structural Similarity. IEEE Trans. Image Process. 2004, 13, 600–612. [Google Scholar] [CrossRef] [PubMed]
  44. Li, Z.; Jing, Z.; Yang, X.; Sun, S. Color Transfer Based Remote Sensing Image Fusion Using Non-Separable Wavelet Frame Transform. Pattern Recognit. Lett. 2005, 26, 2006–2014. [Google Scholar] [CrossRef]
  45. Li, C.; Ju, Y.; Li, W.; Wu, X. A Novel No-Reference Perceptual Blur Metric. In Proceedings of the 2012 International Conference on Electronics, Communications and Control, Washington, DC, USA, 16–18 October 2012; IEEE Computer Society: Washington, DC, USA, 2012; pp. 3331–3334. [Google Scholar]
Figure 1. The 16 test remote sensing images used in the enhancement experiments.
Figure 1. The 16 test remote sensing images used in the enhancement experiments.
Electronics 12 04685 g001
Figure 2. Enhancement performance comparison for the ‘storagetanks_91’ image at the noise level σ = 15 : (a) The original image. (b) The noisy image. (c) HPF (PSNR = 24.45 dB, SSIM = 0.7672). (d) WT (PSNR = 29.83 dB, SSIM = 0.7987). (e) NLM (PSNR = 24.16 dB, SSIM = 0.7357). (f) NLTV (PSNR = 24.54 dB, SSIM = 0.7679). (g) NLMC (PSNR = 29.74 dB, SSIM = 0.8172). (h) QNLM (PSNR = 30.18 dB, SSIM = 0.8965). (i) QNLTV (PSNR = 30.52 dB, SSIM = 0.8668). (j) Simple-LSS (PSNR = 28.96 dB, SSIM = 0.8740). (k) Simple-FSS (PSNR = 28.91 dB, SSIM = 0.8725). (l) Updated-LSS (PSNR = 29.64 dB, SSIM = 0.8812). (m) Updated-FSS (PSNR = 29.62 dB, SSIM = 0.8857). The image patches inside red box are zoomed up.
Figure 2. Enhancement performance comparison for the ‘storagetanks_91’ image at the noise level σ = 15 : (a) The original image. (b) The noisy image. (c) HPF (PSNR = 24.45 dB, SSIM = 0.7672). (d) WT (PSNR = 29.83 dB, SSIM = 0.7987). (e) NLM (PSNR = 24.16 dB, SSIM = 0.7357). (f) NLTV (PSNR = 24.54 dB, SSIM = 0.7679). (g) NLMC (PSNR = 29.74 dB, SSIM = 0.8172). (h) QNLM (PSNR = 30.18 dB, SSIM = 0.8965). (i) QNLTV (PSNR = 30.52 dB, SSIM = 0.8668). (j) Simple-LSS (PSNR = 28.96 dB, SSIM = 0.8740). (k) Simple-FSS (PSNR = 28.91 dB, SSIM = 0.8725). (l) Updated-LSS (PSNR = 29.64 dB, SSIM = 0.8812). (m) Updated-FSS (PSNR = 29.62 dB, SSIM = 0.8857). The image patches inside red box are zoomed up.
Electronics 12 04685 g002aElectronics 12 04685 g002b
Figure 3. Enhancement performance comparison for the ‘overpass_51’ image at the noise level σ = 35 . (a) The original image. (b) The noisy image. (c) HPF (PSNR = 25.11 dB, SSIM = 0.6733). (d) WT (PSNR = 24.22 dB, SSIM = 0.4733). (e) NLM (PSNR = 24.00 dB, SSIM = 0.4712). (f) NLTV (PSNR = 27.98 dB, SSIM = 0.5677). (g) NLMC (PSNR = 25.90 dB, SSIM = 0.6884). (h) QNLM (PSNR = 25.55 dB, SSIM = 0.6890). (i) QNLTV (PSNR = 27.11 dB, SSIM = 0.6899). (j) Simple-LSS (PSNR = 27.69 dB, SSIM = 0.6941). (k) Simple-FSS (PSNR = 27.32 dB, SSIM = 0.6859). (l) Updated-LSS (PSNR = 28.32 dB, SSIM = 0.6950). (m) Updated-FSS (PSNR = 27.57 dB, SSIM = 0.7001). The image patches inside red box are zoomed up.
Figure 3. Enhancement performance comparison for the ‘overpass_51’ image at the noise level σ = 35 . (a) The original image. (b) The noisy image. (c) HPF (PSNR = 25.11 dB, SSIM = 0.6733). (d) WT (PSNR = 24.22 dB, SSIM = 0.4733). (e) NLM (PSNR = 24.00 dB, SSIM = 0.4712). (f) NLTV (PSNR = 27.98 dB, SSIM = 0.5677). (g) NLMC (PSNR = 25.90 dB, SSIM = 0.6884). (h) QNLM (PSNR = 25.55 dB, SSIM = 0.6890). (i) QNLTV (PSNR = 27.11 dB, SSIM = 0.6899). (j) Simple-LSS (PSNR = 27.69 dB, SSIM = 0.6941). (k) Simple-FSS (PSNR = 27.32 dB, SSIM = 0.6859). (l) Updated-LSS (PSNR = 28.32 dB, SSIM = 0.6950). (m) Updated-FSS (PSNR = 27.57 dB, SSIM = 0.7001). The image patches inside red box are zoomed up.
Electronics 12 04685 g003
Figure 4. Enhancement performance comparison for the ‘airplane_16’ image at the noise level σ = 55 . (a) The original image. (b) The noisy image. (c) HPF (PSNR = 26.52 dB, SSIM = 0.7359). (d) WT (PSNR = 24.23 dB, SSIM = 0.5704). (e) NLM (PSNR = 23.84 dB, SSIM = 0.5329). (f) NLTV (PSNR = 25.34 dB, SSIM = 0.5971). (g) NLMC (PSNR = 24.33 dB, SSIM = 0.5751). (h) QNLM (PSNR = 27.56 dB, SSIM = 0. 7376). (i) QNLTV (PSNR = 27.72 dB, SSIM = 0.7084). (j) Simple-LSS (PSNR = 27.70 dB, SSIM = 0.7730). (k) Simple-FSS (PSNR = 27.91 dB, SSIM = 0.7574). (l) Updated-LSS (PSNR = 28.10 dB, SSIM = 0.7799). (m) Updated-FSS (PSNR = 28.18 dB, SSIM = 0.7721). The image patches inside red box are zoomed up.
Figure 4. Enhancement performance comparison for the ‘airplane_16’ image at the noise level σ = 55 . (a) The original image. (b) The noisy image. (c) HPF (PSNR = 26.52 dB, SSIM = 0.7359). (d) WT (PSNR = 24.23 dB, SSIM = 0.5704). (e) NLM (PSNR = 23.84 dB, SSIM = 0.5329). (f) NLTV (PSNR = 25.34 dB, SSIM = 0.5971). (g) NLMC (PSNR = 24.33 dB, SSIM = 0.5751). (h) QNLM (PSNR = 27.56 dB, SSIM = 0. 7376). (i) QNLTV (PSNR = 27.72 dB, SSIM = 0.7084). (j) Simple-LSS (PSNR = 27.70 dB, SSIM = 0.7730). (k) Simple-FSS (PSNR = 27.91 dB, SSIM = 0.7574). (l) Updated-LSS (PSNR = 28.10 dB, SSIM = 0.7799). (m) Updated-FSS (PSNR = 28.18 dB, SSIM = 0.7721). The image patches inside red box are zoomed up.
Electronics 12 04685 g004aElectronics 12 04685 g004b
Figure 5. Enhancement performance comparison for the ‘golfcourse_69’ image at the noise level σ = 75 . (a) The original image. (b) The noisy image. (c) HPF (PSNR = 29.01 dB, SSIM = 0.6627). (d) WT (PSNR = 23.42 dB, SSIM = 0.5826). (e) NLM (PSNR = 22.39 dB, SSIM =0.5842). (f) NLTV (PSNR = 23.68 dB, SSIM = 0.5339). (g) NLMC (PSNR = 24.37 dB, SSIM = 0.6254). (h) QNLM (PSNR = 28.84 dB, SSIM = 0. 6313). (i) QNLTV (PSNR = 26.80 dB, SSIM = 0.5158). (j) Simple-LSS (PSNR = 29.52 dB, SSIM = 0.7135). (k) Simple-FSS (PSNR = 28.43 dB, SSIM = 0.6380). (l) Updated-LSS (PSNR = 30.09 dB, SSIM = 0.7472). (m) Updated-FSS (PSNR = 29.34 dB, SSIM = 0.6956). The image patches inside red box are zoomed up.
Figure 5. Enhancement performance comparison for the ‘golfcourse_69’ image at the noise level σ = 75 . (a) The original image. (b) The noisy image. (c) HPF (PSNR = 29.01 dB, SSIM = 0.6627). (d) WT (PSNR = 23.42 dB, SSIM = 0.5826). (e) NLM (PSNR = 22.39 dB, SSIM =0.5842). (f) NLTV (PSNR = 23.68 dB, SSIM = 0.5339). (g) NLMC (PSNR = 24.37 dB, SSIM = 0.6254). (h) QNLM (PSNR = 28.84 dB, SSIM = 0. 6313). (i) QNLTV (PSNR = 26.80 dB, SSIM = 0.5158). (j) Simple-LSS (PSNR = 29.52 dB, SSIM = 0.7135). (k) Simple-FSS (PSNR = 28.43 dB, SSIM = 0.6380). (l) Updated-LSS (PSNR = 30.09 dB, SSIM = 0.7472). (m) Updated-FSS (PSNR = 29.34 dB, SSIM = 0.6956). The image patches inside red box are zoomed up.
Electronics 12 04685 g005
Figure 6. The 30 test remote sensing images used in the enhancement experiments.
Figure 6. The 30 test remote sensing images used in the enhancement experiments.
Electronics 12 04685 g006
Figure 7. Average AG values for color image enhancement.
Figure 7. Average AG values for color image enhancement.
Electronics 12 04685 g007
Figure 8. Average IE values for color image enhancement.
Figure 8. Average IE values for color image enhancement.
Electronics 12 04685 g008
Table 1. PSNR (dB) comparison among eleven algorithms at the σ = 15 noise level.
Table 1. PSNR (dB) comparison among eleven algorithms at the σ = 15 noise level.
ImageMainstream AlgorithmsSimple VersionsUpdated Versions
HPFWTNLMNLTVNLMCQNLMQNLTVLSSFSSLSSFSS
130.0529.9028.9130.4430.5730.4431.5231.9731.7432.2132.12
231.1630.0829.8030.5931.8030.7431.9933.0032.7533.0432.97
328.3530.4227.7628.7031.5130.6831.8231.3231.1231.7531.78
427.2331.7226.6331.0538.7631.7231.5132.7532.5132.7632.60
535.8129.8130.8930.1031.4335.9933.8735.7035.9937.4438.02
626.7429.5525.8127.4123.9230.4531.3331.5831.3931.8431.69
725.5329.7525.1327.8831.8831.0831.8031.6131.5331.9632.00
826.2030.2126.0927.8531.6830.7532.0230.8530.7231.2031.20
931.1830.5430.2830.5631.6630.7426.9432.5232.3232.7932.79
1027.7831.0527.7430.7835.6331.6133.4234.0333.8134.0334.10
1128.7329.8227.9430.0829.6730.1931.1130.4730.2631.0030.93
1224.4529.8324.1624.5429.7430.1830.5228.9628.9129.6429.62
1328.9730.2628.1828.6632.4430.9332.1532.5532.4032.8332.79
1431.0330.5830.2830.9033.7031.3132.6834.0233.7933.9533.89
1532.6531.9333.4231.1339.8631.8834.0236.4336.4336.0736.48
1628.0829.4127.0030.1530.4630.1930.9231.4731.3131.8131.76
Ave.28.9930.3028.1329.4232.1631.1831.7332.4632.3232.7832.80
The bold indicates the best average result, and the underlining indicates the second-best average result.
Table 2. SSIM comparison among eleven algorithms at the σ = 15 noise level.
Table 2. SSIM comparison among eleven algorithms at the σ = 15 noise level.
ImageMainstream AlgorithmsSimple VersionsUpdated Versions
HPFWTNLMNLTVNLMCQNLMQNLTVLSSFSSLSSFSS
10.75630.78020.67800.76840.81530.81420.85140.86130.85430.87010.8677
20.81000.77140.73810.82550.80800.80060.85390.88040.87460.88240.8821
30.75880.75280.70870.80290.77890.75990.83080.83530.82680.84370.8456
40.64020.67620.81100.67270.85130.89110.87590.90130.90310.90430.9309
50.82030.83380.67800.80570.75630.85860.78170.85430.87010.86770.8731
60.81840.82190.75840.82900.85370.87190.89150.90820.90490.91070.9098
70.79980.83120.77190.79810.80490.91130.88000.90040.90260.90800.9225
80.75060.76050.71910.84490.78460.76130.84030.84380.83840.85320.8539
90.78730.72860.74030.80280.74320.72860.74150.83880.83360.84390.8487
100.86230.69010.84740.92040.70400.67040.79600.86570.86530.85920.8712
110.68330.76730.61590.70270.79600.79600.82960.79360.78330.81830.8142
120.76720.79870.73570.76790.81720.89650.86680.87400.87250.88120.8857
130.83010.75940.78770.75870.79050.89280.85160.88630.88420.88750.8912
140.88440.76830.84940.77780.79540.88950.85540.89710.89400.89390.8976
150.92090.65180.60980.65110.92670.84190.76300.85780.84420.86040.9392
160.81580.83930.76370.88920.86570.85990.89460.91000.90740.91470.9162
Ave.0.79410.76450.73830.78860.80570.82780.83780.86930.86620.87500.8843
The bold indicates the best average result, and the underlining indicates the second-best average result.
Table 3. PSNR (dB) comparison among the eleven algorithms at a σ = 35 noise level.
Table 3. PSNR (dB) comparison among the eleven algorithms at a σ = 35 noise level.
ImageMainstream AlgorithmsSimple VersionsUpdated Versions
HPFWTNLMNLTVNLMCQNLMQNLTV LSSFSSLSSFSS
128.5624.5523.8027.9225.5927.4427.4828.0327.9628.1628.09
229.3224.7023.9428.2425.7927.8327.8328.4128.4628.6928.42
327.0424.5423.9028.1925.8328.2127.7627.9527.8828.0928.11
425.2125.5324.0729.6925.9630.1928.7928.1628.0928.4227.99
533.8124.1224.3127.6734.0827.6327.6626.9330.1927.2630.14
625.2823.7723.8627.4125.5127.0927.3227.6427.4627.7427.57
724.2223.7424.1327.5925.9327.6727.6527.8027.6227.8027.84
825.1124.2224.0027.9825.9025.5527.1127.6927.3227.5928.32
929.6124.8923.8928.3825.8728.2327.8528.5228.5728.7028.67
1026.2624.7524.1629.1026.4029.5329.4129.2129.3429.5229.35
1127.5624.3823.7827.6125.5027.2527.5127.5327.2927.5027.57
1223.3123.8224.1926.9525.7427.2027.2626.5826.1426.3526.56
1327.4824.4423.9328.1525.8928.1227.8628.3728.2828.4928.40
1428.7224.9024.1828.6626.2028.6228.2028.8628.9229.1728.90
1533.5525.9324.5530.0026.9030.6229.1530.2130.5830.6830.52
1626.7523.9623.6827.2325.3826.7727.1627.5627.3727.6327.58
Ave.27.6124.5124.0228.1726.4027.9927.8828.0928.2228.2428.38
The bold indicates the best average. result, and the underlining indicates the second-best average result.
Table 4. SSIM comparison among the eleven algorithms at a σ = 35 noise level.
Table 4. SSIM comparison among the eleven algorithms at a σ = 35 noise level.
ImageMainstream AlgorithmsSimple VersionsUpdated Versions
HPFWTNLMNLTVNLMCQNLMQNLTVLSSFSSLSSFSS
10.68130.49470.48980.58210.64910.69940.70070.71650.71370.72080.7248
20.63230.48350.47550.57620.65990.70630.70010.72500.72930.73780.7305
30.68310.44750.43870.54050.65390.67120.66510.67080.67520.68350.6882
40.78080.35160.28160.66300.61690.60610.56780.77980.78630.79110.7834
50.63240.58760.58740.84070.74530.76500.77010.74840.65240.76430.6503
60.74320.57240.58960.67150.74750.77340.78190.78700.78760.79460.7927
70.73220.54880.56450.65190.74860.75260.76380.76260.76890.77280.7768
80.67330.47330.47120.56770.68840.68900.68990.69410.68590.69500.7001
90.70890.41870.39060.49310.61590.63640.62420.65340.66130.66620.6713
100.77570.38610.35230.46560.64530.63380.61460.65340.67910.68000.6764
110.61290.46520.47540.56030.61930.66170.65970.66410.64390.65560.6684
120.69720.55160.56270.64530.73860.74040.75380.73960.73750.74290.7524
130.65320.47900.47120.57280.69200.70260.69870.72310.73110.73460.7370
140.71500.51640.48580.58820.70590.72400.71430.73760.75080.75470.7523
150.55140.33240.26630.39530.60330.58590.54690.60490.63770.63880.6365
160.75480.60420.61110.69670.75720.77970.80160.80030.79800.80440.8075
Ave.0.68920.48200.46960.59440.68040.69540.69080.71630.71490.72740.7218
The bold indicates the best average. result, and the underlining indicates the second-best average result.
Table 5. PSNR (dB) comparison among the eleven algorithms at a σ = 55 noise level.
Table 5. PSNR (dB) comparison among the eleven algorithms at a σ = 55 noise level.
ImageMainstream AlgorithmsSimple VersionsUpdated Versions
HPFWTNLMNLTVNLMCQNLMQNLTVLSSFSSLSSFSS
127.1224.7924.1925.0024.7127.1326.7927.5327.4827.7327.65
227.3824.4724.0425.2924.5627.7627.1427.6927.6727.9127.79
325.8424.4223.8724.9024.4225.8826.9826.9227.2127.3227.45
423.2325.6424.6826.3125.4824.4226.5925.2526.2625.8426.26
531.1322.5922.7524.2923.0531.1328.9331.6329.8731.1830.78
623.9023.6123.5224.1623.9124.1726.1125.4926.5126.0526.55
722.8922.8222.9124.0823.3023.2826.2725.0526.1225.5226.32
824.0923.6623.3424.3723.8424.2226.7225.8526.2626.0226.57
928.1125.0324.2425.3724.8628.0627.3428.5728.0228.5328.42
1024.8724.1123.9025.3424.4825.1127.0127.5128.3328.0628.77
1126.4024.4923.8924.7824.3826.4226.4827.0326.8227.0727.14
1222.0621.8821.9723.5822.2222.7125.6023.4524.2223.7124.37
1326.0324.3923.9624.9024.4826.2327.0227.3227.6227.6227.89
1426.5224.2323.8425.3424.3327.5627.7227.7027.9128.1028.18
1529.2024.2723.8126.7924.3531.4529.3029.4628.6429.2329.16
1625.4824.2823.8224.2124.2525.5226.0426.1526.8226.7126.93
Ave.25.8924.0423.6724.9124.1626.3127.0027.0427.2327.2927.52
The bold indicates the best average. result, and the underlining indicates the second-best average result.
Table 6. SSIM comparison among the eleven algorithms at a σ = 55 noise level.
Table 6. SSIM comparison among the eleven algorithms at a σ = 55 noise level.
ImageMainstream AlgorithmsSimple VersionsUpdated Versions
HPFWTNLMNLTVNLMCQNLMQNLTVLSSFSSLSSFSS
10.60060.54100.51080.54230.54160.60000.63380.63650.67140.66000.6675
20.64710.54710.51740.55510.55670.64820.65300.67740.70100.69780.6988
30.59980.47390.44090.51060.47800.59740.62550.64650.65180.66370.6624
40.70620.40740.34940.46760.40490.71260.61790.76970.78090.77950.7877
50.74460.62990.61140.64970.64740.73660.73780.76950.67850.75120.7235
60.66060.61830.60520.63570.63560.66170.72970.73460.76620.75460.7701
70.65210.58030.56560.61780.60440.64810.72570.74750.75970.75660.7765
80.58940.48680.45890.52990.49760.58660.65330.67370.66250.67190.6872
90.61950.44850.40650.48050.44350.61610.59500.65810.63850.66010.6584
100.68320.45510.41030.49230.46640.66300.63080.75230.70930.74650.7441
110.53890.48570.45900.50120.48160.53870.59030.58680.60110.59560.6105
120.62450.57270.55010.59860.59290.61240.70640.70890.72920.71600.7463
130.66830.53180.50080.55840.53990.66400.67420.72960.72450.73590.7429
140.73590.57040.53290.59710.57510.73760.70840.77300.75740.77990.7721
150.76220.43450.36350.45870.43500.72510.60210.78950.71150.77050.7569
160.68430.63400.61240.64160.63840.68630.73880.73290.77420.76190.7774
Ave.0.65730.52610.49340.55230.53360.65210.66390.71160.70730.71890.7239
The bold indicates the best average. result, and the underlining indicates the second-best average result.
Table 7. PSNR (dB) comparison among the eleven algorithms at the noise level σ = 75 .
Table 7. PSNR (dB) comparison among the eleven algorithms at the noise level σ = 75 .
ImageMainstream AlgorithmsSimple VersionUpdated Version
HPFWTNLMNLTVNLMCQNLMQNLTVLSSFSSLSSFSS
125.8923.7622.3723.5824.2926.0825.2826.3526.1526.2926.32
225.5023.9422.5823.7724.5826.5725.5725.8425.6725.7825.81
325.0923.4222.0923.3024.0725.0925.2826.0325.9525.8226.15
421.7523.8622.5623.6524.6123.9024.8822.9723.3822.6023.41
529.0123.4222.3923.6824.3728.8426.8029.5228.4330.0929.34
623.0023.4421.9023.4624.2023.6324.4724.1324.5323.7424.55
721.9723.2022.0123.4224.1922.8624.4723.3723.7523.0323.85
823.4223.2822.0123.3024.0623.6824.8624.5324.6624.4424.88
927.0023.6022.3223.4124.1626.7825.6927.4927.0027.6727.42
1023.8423.8122.2923.8024.7524.4625.8825.5025.6425.1725.95
1125.5423.4622.1823.3224.0025.5325.0326.1325.8726.1326.15
1221.0522.9321.7623.0723.6622.3623.9721.7322.2321.7322.28
1324.8723.6822.2423.5324.3725.3725.2825.6325.8325.6326.04
1424.7723.8022.5323.7424.5526.4625.8825.3825.6325.3825.84
1525.8624.2223.0224.0525.0429.1227.2426.3025.7126.3026.07
1624.6423.3822.0723.2823.9124.7824.5224.9325.5524.9325.59
Ave.24.5823.5722.2723.5224.3025.3425.3225.3625.3725.3025.61
The bold indicates the best average. result, and the underlining indicates the second-best average result.
Table 8. SSIM comparison among the eleven algorithms at the noise level σ = 75 .
Table 8. SSIM comparison among the eleven algorithms at the noise level σ = 75 .
ImageMainstream AlgorithmsSimple VersionUpdated Version
HPFWTNLMNLTVNLMCQNLMQNLTVLSSFSSLSSFSS
10.55710.48030.47750.42060.51370.55350.55890.60610.61400.58800.6104
20.59620.47400.47170.41380.51760.59340.57430.64060.64190.62760.6432
30.54900.41040.40900.36250.45010.53850.54010.61390.60010.60460.6130
40.65880.28360.27600.23750.32850.66870.67360.72370.72790.71610.7392
50.66270.58260.58420.53390.62540.63130.51580.71350.63800.74720.6956
60.61710.57270.57760.51920.61710.61890.65590.69230.70570.67540.7106
70.60700.54050.54600.49590.59200.59980.64610.69910.69970.69340.7180
80.53890.43790.43920.39600.48240.52820.56280.61700.60490.62360.6299
90.55990.37260.36650.32360.40290.54480.50710.61500.58880.62230.6133
100.61670.35570.35100.30150.40480.57280.53340.70170.66050.71760.7045
110.49910.44680.44490.39860.47460.49510.51600.54440.55270.54440.5591
120.58160.54740.54300.48590.59280.56550.62570.65820.66880.65820.6856
130.61460.45970.45740.40850.50180.60140.58920.68460.67120.68460.6925
140.67930.48590.48210.43250.53000.67520.63170.73240.71220.73240.7326
150.68390.49950.47960.42510.55210.61590.50250.76150.77240.77150.7303
160.64070.59060.59090.54220.62410.64810.66580.67300.71640.67300.7165
Ave.0.60390.47120.46850.41850.51310.59060.58120.66730.66090.66750.6747
The bold indicates the best average. result, and the underlining indicates the second-best average result.
Table 9. Average values of different indicators for remote sensing image enhancement.
Table 9. Average values of different indicators for remote sensing image enhancement.
Noise LevelMainstream AlgorithmsSimple VersionsUpdated Versions
HPFWTNLMNLTVNLMCQNLMQNLTVLSSFSSLSSFSS
PSNR (dB) σ = 15 28.6230.0028.1330.9430.4728.0230.8631.9131.7932.1932.22
σ = 35 26.8624.1823.9027.6427.6525.7726.6327.8227.9327.9828.01
σ = 55 25.3623.6623.3724.4424.0425.7325.9926.8026.8526.5627.12
σ = 75 24.1923.3723.3321.8623.8121.8524.8924.9925.0624.9325.27
SSIM σ = 15 0.80230.76570.75470.84080.78870.76210.83260.86900.86630.87240.8767
σ = 35 0.71420.47930.48220.69280.68250.70420.64920.71080.71580.71260.7241
σ = 55 0.64220.51370.48720.54050.52320.63870.64470.71190.70370.71400.7206
σ = 75 0.58950.46210.46120.41070.50230.38940.56960.65910.64780.65740.6677
AG σ = 15 6.5766.5406.5096.8826.3747.5658.9589.31010.12110.43010.230
σ = 35 5.8396.4596.0715.7816.1286.2657.0938.3928.3266.4888.321
σ = 55 5.7005.6215.9075.5265.3265.1585.9877.5616.2437.8397.085
σ = 75 4.6515.1925.5925.0285.2814.1935.5666.9195.6566.3746.345
IE σ = 15 6.9777.0677.1067.1117.0367.1747.1127.2287.3507.3617.223
σ = 35 6.8876.8556.9456.9356.8797.0757.0697.1107.1087.1177.107
σ = 55 6.9686.9997.0846.8386.8336.8596.8627.0857.0006.9527.032
σ = 75 6.9696.8236.8596.6646.8386.9756.8157.0126.9216.8816.955
The bold blue indicates the best results, and the underlining indicates the second-best results.
Table 10. PSNR (dB) and SSIM values of different restoration models for MB (20,60)/ σ = 25 .
Table 10. PSNR (dB) and SSIM values of different restoration models for MB (20,60)/ σ = 25 .
ImageQuaternion AlgorithmsSimple VersionUpdated Versions
QNLMQNLTVQWNNMLSSFSSLSSFSS
agricultural0323.19/0.672523.82/0.700323.82/0.700323.85/0.701723.86/0.702823.87/0.701823.88/0.7030
forest2924.69/0.782424.84/0.815424.86/0.816724.88/0.818224.91/0.818324.91/0.817424.89/0.8176
forest5324.74/0.785224.70/0.824624.73/0.826424.71/0.828324.74/0.828024.75/0.827524.72/0.8276
freeway2623.81/0.782223.77/0.820923.89/0.823123.87/0.825823.83/0.824923.84/0.826923.86/0.8267
golfcourse5727.93/0.880227.23/0.897527.22/0.952929.37/0.958429.32/0.957729.38/0.959029.41/0.9591
chaparral2723.59/0.673024.21/0.700024.23/0.701224.28/0.702124.25/0.702224.26/0.702924.28/0.7030
river5126.04/0.826127.10/0.882327.14/0.884027.17/0.886127.19/0.886027.20/0.885527.19/0.8860
residential3824.37/0.772624.60/0.813624.61/0.814424.60/0.815224.61/0.815324.61/0.815524.62/0.8157
tenniscourt8724.46/0.783824.58/0.829224.66/0.830824.65/0.833524.61/0.833324.63/0.833524.64/0.8338
beach4728.07/0.884030.33/0.972830.97/0.975830.80/0.979530.27/0.978830.66/0.980130.40/0.9802
Avg.25.10/0.784225.52/0.825725.61/0.832625.82/0.834925.76/0.834725.81/0.835025.79/0.8353
The Bold indicates the best results.
Table 11. PSNR (dB) and SSIM values of different restoration models for AB (9,9)/ σ = 35 .
Table 11. PSNR (dB) and SSIM values of different restoration models for AB (9,9)/ σ = 35 .
ImageQuaternion AlgorithmsSimple VersionUpdated Versions
QNLMQNLTVQWNNMLSSFSSLSSFSS
agricultural0323.73/0.661823.75/0.663823.65/0.688423.78/0.693223.79/0.694223.79/0.694423.80/0.6947
forest2925.84/0.811025.87/0.813125.90/0.825625.96/0.831225.90/0.830625.81/0.830425.84/0.8319
forest5326.26/0.830026.31/0.832726.25/0.839126.30/0.849526.32/0.848426.23/0.848226.25/0.8483
freeway2624.73/0.828724.77/0.831425.24/0.840824.77/0.845524.79/0.846824.76/0.846524.77/0.8467
golfcourse5732.02/0.960831.15/0.963731.01/0.939432.34/0.969432.33/0.970132.30/0.970532.50/0.9713
chaparral2724.15/0.662724.21/0.666624.53/0.727824.19/0.694224.24/0.697124.23/0.695624.23/0.6957
river5127.67/0.870527.73/0.873227.30/0.865727.76/0.886527.79/0.887027.73/0.887027.74/0.8875
residential3825.43/0.803225.46/0.805325.49/0.812025.49/0.823625.54/0.824325.43/0.823625.48/0.8241
tenniscourt8725.29/0.820325.40/0.823325.37/0.832125.31/0.838325.36/0.839625.37/0.839625.66/0.8398
beach4730.84/0.970630.69/0.974031.08/0.943030.69/0.979031.34/0.979930.92/0.980431.66/0.9805
Avg.26.60/0.822026.53/0.824726.58/0.831426.66/0.841026.74/0.841826.66/0.841626.79/0.8420
The bold indicates the best results.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Xu, X.; Zhang, Z.; Crabbe, M.J.C. Color Remote Sensing Image Restoration through Singular-Spectra-Derived Self-Similarity Metrics. Electronics 2023, 12, 4685. https://doi.org/10.3390/electronics12224685

AMA Style

Xu X, Zhang Z, Crabbe MJC. Color Remote Sensing Image Restoration through Singular-Spectra-Derived Self-Similarity Metrics. Electronics. 2023; 12(22):4685. https://doi.org/10.3390/electronics12224685

Chicago/Turabian Style

Xu, Xudong, Zhihua Zhang, and M. James C. Crabbe. 2023. "Color Remote Sensing Image Restoration through Singular-Spectra-Derived Self-Similarity Metrics" Electronics 12, no. 22: 4685. https://doi.org/10.3390/electronics12224685

APA Style

Xu, X., Zhang, Z., & Crabbe, M. J. C. (2023). Color Remote Sensing Image Restoration through Singular-Spectra-Derived Self-Similarity Metrics. Electronics, 12(22), 4685. https://doi.org/10.3390/electronics12224685

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop