Application of Peptides in Construction of Nonviral Vectors for Gene Delivery
Abstract
1. Introduction
2. Construction of Peptide–Nucleic Acid Complexes for Gene Delivery
3. Application of CPPs in Gene Delivery
4. Application of Targeted Peptides in Gene Delivery
5. Application of Membrane Active Peptides in Gene Delivery
6. Application of NLS Peptides in Gene Delivery
7. Application of Other Peptides in Gene Delivery
8. Concluding Remarks and Future Perspectives
Author Contributions
Funding
Conflicts of Interest
Appendix A
Full Amino Acid Names | One-Letter Codes |
---|---|
Alanine | A |
Arginine | R |
Asparagine | N |
Aspartic acid | D |
Cysteine | C |
Glutamine | Q |
Glutamic acid | E |
Glycine | G |
Histidine | H |
Isoleucine | I |
Leucine | L |
Lysine | K |
Methionine | M |
Phenylalanine | F |
Proline | P |
Serine | S |
Threonine | T |
Tryptophan | W |
Tyrosine | Y |
Valine | V |
References
- Luo, M.; Lee, L.K.C.; Peng, B.; Choi, C.H.J.; Tong, W.Y.; Voelcker, N.H. Delivering the Promise of Gene Therapy with Nanomedicines in Treating Central Nervous System Diseases. Adv. Sci. 2022, 9, 2201740. [Google Scholar] [CrossRef] [PubMed]
- Zhu, Y.; Shen, R.; Vuong, I.; Reynolds, R.A.; Shears, M.J.; Yao, Z.-C.; Hu, Y.; Cho, W.J.; Kong, J.; Reddy, S.K.; et al. Multistep screening of DNA/lipid nanoparticles and co-delivery with siRNA to enhance and prolong gene expression. Nat. Commun. 2022, 13, 4282. [Google Scholar] [CrossRef] [PubMed]
- Kuriyama, N.; Yoshioka, Y.; Kikuchi, S.; Okamura, A.; Azuma, N.; Ochiya, T. Challenges for the Development of Extracellular Vesicle-Based Nucleic Acid Medicines. Cancers 2021, 13, 6137. [Google Scholar] [CrossRef] [PubMed]
- Isgrig, K.; McDougald, D.S.; Zhu, J.; Wang, H.J.; Bennett, J.; Chien, W.W. AAV2.7m8 is a powerful viral vector for inner ear gene therapy. Nat. Commun. 2019, 10, 427. [Google Scholar] [CrossRef] [PubMed]
- Shirley, J.L.; de Jong, Y.P.; Terhorst, C.; Herzog, R.W. Immune Responses to Viral Gene Therapy Vectors. Mol. Ther. 2020, 28, 709–722. [Google Scholar] [CrossRef] [PubMed]
- Bouard, D.; Alazard-Dany, D.; Cosset, F.L. Viral vectors: From virology to transgene expression. Br. J. Pharmacol. 2009, 157, 153–165. [Google Scholar] [CrossRef] [PubMed]
- Kang, Z.; Meng, Q.; Liu, K. Peptide-based gene delivery vectors. J. Mater. Chem. B 2019, 7, 1824–1841. [Google Scholar] [CrossRef]
- Munagala, R.; Aqil, F.; Jeyabalan, J.; Kandimalla, R.; Wallen, M.; Tyagi, N.; Wilcher, S.; Yan, J.; Schultz, D.J.; Spencer, W.; et al. Exosome-mediated delivery of RNA and DNA for gene therapy. Cancer Lett. 2021, 505, 58–72. [Google Scholar] [CrossRef]
- Gao, Y.; Men, K.; Pan, C.; Li, J.; Wu, J.; Chen, X.; Lei, S.; Gao, X.; Duan, X. Functionalized DMP-039 Hybrid Nanoparticle as a Novel mRNA Vector for Efficient Cancer Suicide Gene Therapy. Int. J. Nanomed. 2021, 16, 5211–5232. [Google Scholar] [CrossRef]
- Sun, W.; Liu, X.Y.; Ma, L.L.; Lu, Z.L. Tumor Targeting Gene Vector for Visual Tracking of Bcl-2 siRNA Transfection and Anti-Tumor Therapy. ACS Appl. Mater. Interfaces 2020, 12, 10193–10201. [Google Scholar] [CrossRef]
- Peng, X.; Ma, X.; Lu, S.; Li, Z. A Versatile Plant Rhabdovirus-Based Vector for Gene Silencing, miRNA Expression and Depletion, and Antibody Production. Front. Plant Sci. 2020, 11, 627880. [Google Scholar] [CrossRef] [PubMed]
- Dirisala, A.; Uchida, S.; Tockary, T.A.; Yoshinaga, N.; Li, J.; Osawa, S.; Gorantla, L.; Fukushima, S.; Osada, K.; Kataoka, K. Precise tuning of disulphide crosslinking in mRNA polyplex micelles for optimising extracellular and intracellular nuclease tolerability. J. Drug Target. 2019, 27, 670–680. [Google Scholar] [CrossRef]
- Devoldere, J.; Dewitte, H.; De Smedt, S.C.; Remaut, K. Evading innate immunity in nonviral mRNA delivery: Don’t shoot the messenger. Drug Discov. Today 2016, 21, 11–25. [Google Scholar] [CrossRef] [PubMed]
- Shaikh, S.; Nazam, N.; Rizvi, S.M.D.; Ahmad, K.; Baig, M.H.; Lee, E.J.; Choi, I. Mechanistic Insights into the Antimicrobial Actions of Metallic Nanoparticles and Their Implications for Multidrug Resistance. Int. J. Mol. Sci. 2019, 20, 2468. [Google Scholar] [CrossRef] [PubMed]
- Vickers, T.A.; Crooke, S.T. siRNAs targeted to certain polyadenylation sites promote specific, RISC-independent degradation of messenger RNAs. Nucleic Acids Res. 2012, 40, 6223–6234. [Google Scholar] [CrossRef]
- Wang, D.; Fan, Z.; Zhang, X.; Li, H.; Sun, Y.; Cao, M.; Wei, G.; Wang, J. pH-Responsive Self-Assemblies from the Designed Folic Acid-Modified Peptide Drug for Dual-Targeting Delivery. Langmuir 2021, 37, 339–347. [Google Scholar] [CrossRef]
- Wang, H.; Feng, Z.; Xu, B. Supramolecular Assemblies of Peptides or Nucleopeptides for Gene Delivery. Theranostics 2019, 9, 3213–3222. [Google Scholar] [CrossRef]
- Balbino, T.A.; Serafin, J.M.; Malfatti-Gasperini, A.A.; de Oliveira, C.L.; Cavalcanti, L.P.; de Jesus, M.B.; de La Torre, L.G. Microfluidic Assembly of pDNA/Cationic Liposome Lipoplexes with High pDNA Loading for Gene Delivery. Langmuir 2016, 32, 1799–1807. [Google Scholar] [CrossRef]
- Wang, D.; Sun, Y.; Cao, M.; Wang, J.; Hao, J. Amphiphilic short peptide modulated wormlike micelle formation with pH and metal ion dual-responsive properties. RSC Adv. 2015, 5, 95604–95612. [Google Scholar] [CrossRef]
- Vermeulen, L.M.P.; Brans, T.; De Smedt, S.C.; Remaut, K.; Braeckmans, K. Methodologies to investigate intracellular barriers for nucleic acid delivery in nonviral gene therapy. Nano Today 2018, 21, 74–90. [Google Scholar] [CrossRef]
- Hadianamrei, R.; Zhao, X. Current state of the art in peptide-based gene delivery. J. Control. Release 2022, 343, 600–619. [Google Scholar] [CrossRef] [PubMed]
- McErlean, E.M.; Ziminska, M.; McCrudden, C.M.; McBride, J.W.; Loughran, S.P.; Cole, G.; Mulholland, E.J.; Kett, V.; Buckley, N.E.; Robson, T.; et al. Rational design and characterisation of a linear cell penetrating peptide for nonviral gene delivery. J. Control. Release 2021, 330, 1288–1299. [Google Scholar] [CrossRef] [PubMed]
- Dougherty, P.G.; Wen, J.; Pan, X.; Koley, A.; Ren, J.G.; Sahni, A.; Basu, R.; Salim, H.; Kubi, G.A.; Qian, Z.; et al. Enhancing the Cell Permeability of Stapled Peptides with a Cyclic Cell-Penetrating Peptide. J. Med. Chem. 2019, 62, 10098–10107. [Google Scholar] [CrossRef] [PubMed]
- Nam, S.H.; Jang, J.; Cheon, D.H.; Chong, S.-E.; Ahn, J.H.; Hyun, S.; Yu, J.; Lee, Y. pH-Activatable cell penetrating peptide dimers for potent delivery of anticancer drug to triple-negative breast cancer. J. Control. Release 2021, 330, 898–906. [Google Scholar] [CrossRef]
- Tuttolomondo, M.; Casella, C.; Hansen, P.L.; Polo, E.; Herda, L.M.; Dawson, K.A.; Ditzel, H.J.; Mollenhauer, J. Human DMBT1-Derived Cell-Penetrating Peptides for Intracellular siRNA Delivery. Mol. Ther. Nucleic Acids 2017, 8, 264–276. [Google Scholar] [CrossRef] [PubMed]
- Jiang, Q.-Y.; Lai, L.-H.; Shen, J.; Wang, Q.-Q.; Xu, F.-J.; Tang, G.-P. Gene delivery to tumor cells by cationic polymeric nanovectors coupled to folic acid and the cell-penetrating peptide octaarginine. Biomaterials 2011, 32, 7253–7262. [Google Scholar] [CrossRef] [PubMed]
- Khalil, I.A.; Kimura, S.; Sato, Y.; Harashima, H. Synergism between a cell penetrating peptide and a pH-sensitive cationic lipid in efficient gene delivery based on double-coated nanoparticles. J. Control. Release 2018, 275, 107–116. [Google Scholar] [CrossRef]
- Huang, Y.; Cheng, Q.; Jin, X.; Ji, J.L.; Guo, S.; Zheng, S.; Wang, X.; Cao, H.; Gao, S.; Liang, X.J.; et al. Systemic and tumor-targeted delivery of siRNA by cyclic NGR and isoDGR motif-containing peptides. Biomater. Sci. 2016, 4, 494–510. [Google Scholar] [CrossRef]
- Yang, S.; Ou, C.; Wang, L.; Liu, X.; Yang, J.; Wang, X.; Wang, M.; Shen, M.; Wu, Q.; Gong, C. Virus-esque nucleus-targeting nanoparticles deliver trojan plasmid for release of anti-tumor shuttle protein. J. Control. Release 2020, 320, 253–264. [Google Scholar] [CrossRef]
- Zhao, Y.; He, Z.; Gao, H.; Tang, H.; He, J.; Guo, Q.; Zhang, W.; Liu, J. Fine Tuning of Core-Shell Structure of Hyaluronic Acid/Cell-Penetrating Peptides/siRNA Nanoparticles for Enhanced Gene Delivery to Macrophages in Antiatherosclerotic Therapy. Biomacromolecules 2018, 19, 2944–2956. [Google Scholar] [CrossRef]
- Covarrubias-Zambrano, O.; Shrestha, T.B.; Pyle, M.; Montes-Gonzalez, M.; Troyer, D.L.; Bossmann, S.H. Development of a Gene Delivery System Composed of a Cell-Penetrating Peptide and a Nontoxic Polymer. ACS Appl. Bio Mater. 2020, 3, 7418–7427. [Google Scholar] [CrossRef] [PubMed]
- Dowaidar, M.; Abdelhamid, H.N.; Hallbrink, M.; Freimann, K.; Kurrikoff, K.; Zou, X.; Langel, U. Magnetic Nanoparticle Assisted Self-assembly of Cell Penetrating Peptides-Oligonucleotides Complexes for Gene Delivery. Sci. Rep. 2017, 7, 9159. [Google Scholar] [CrossRef] [PubMed]
- Yang, Y.; Yang, Y.; Xie, X.; Wang, Z.; Gong, W.; Zhang, H.; Li, Y.; Yu, F.; Li, Z.; Mei, X. Dual-modified liposomes with a two-photon-sensitive cell penetrating peptide and NGR ligand for siRNA targeting delivery. Biomaterials 2015, 48, 84–96. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Wu, J.J.; Huang, L. Nanoparticles targeted with NGR motif deliver c-myc siRNA and doxorubicin for anticancer therapy. Mol. Ther. 2010, 18, 828–834. [Google Scholar] [CrossRef] [PubMed]
- Kim, Y.M.; Park, S.C.; Jang, M.K. Targeted gene delivery of polyethyleneimine-grafted chitosan with RGD dendrimer peptide in αvβ3 integrin-overexpressing tumor cells. Carbohydr. Polym. 2017, 174, 1059–1068. [Google Scholar] [CrossRef]
- Luo, Q.; Song, H.; Deng, X.; Li, J.; Jian, W.; Zhao, J.; Zheng, X.; Basnet, S.; Ge, H.; Daniel, T.; et al. A Triple-Regulated Oncolytic Adenovirus Carrying MicroRNA-143 Exhibits Potent Antitumor Efficacy in Colorectal Cancer. Mol. Ther. Oncolytics 2020, 16, 219–229. [Google Scholar] [CrossRef]
- Wang, Y.; Nie, Y.; Ding, Z.; Yao, M.; Du, R.; Zhang, L.; Wang, S.; Li, D.; Wang, Y.; Cao, M. An amphiphilic peptide with cell penetrating sequence for highly efficient gene transfection. Colloids Surf. A Physicochem. Eng. Asp. 2020, 590, 124529. [Google Scholar] [CrossRef]
- Alam, M.R.; Ming, X.; Fisher, M.; Lackey, J.G.; Rajeev, K.G.; Manoharan, M.; Juliano, R.L. Multivalent Cyclic RGD Conjugates for Targeted Delivery of Small Interfering RNA. Bioconjugate Chem. 2011, 22, 1673–1681. [Google Scholar] [CrossRef]
- Liu, X.; Wang, W.; Samarsky, D.; Liu, L.; Xu, Q.; Zhang, W.; Zhu, G.; Wu, P.; Zuo, X.; Deng, H.; et al. Tumor-targeted in vivo gene silencing via systemic delivery of cRGD-conjugated siRNA. Nucleic Acids Res. 2014, 42, 11805–11817. [Google Scholar] [CrossRef]
- Khatri, N.; Baradia, D.; Vhora, I.; Rathi, M.; Misra, A. cRGD grafted liposomes containing inorganic nano-precipitate complexed siRNA for intracellular delivery in cancer cells. J. Control. Release 2014, 182, 45–57. [Google Scholar] [CrossRef]
- Xu, X.; Liu, Y.; Yang, Y.; Wu, J.; Cao, M.; Sun, L. One-pot synthesis of functional peptide-modified gold nanoparticles for gene delivery. Colloids Surf. A Physicochem. Eng. Asp. 2022, 640, 128491. [Google Scholar] [CrossRef]
- Jena, L.N.; Bennie, L.A.; McErlean, E.M.; Pentlavalli, S.; Glass, K.; Burrows, J.F.; Kett, V.L.; Buckley, N.E.; Coulter, J.A.; Dunne, N.J.; et al. Exploiting the anticancer effects of a nitrogen bisphosphonate nanomedicine for glioblastoma multiforme. J. Nanobiotechnology 2021, 19, 127. [Google Scholar] [CrossRef] [PubMed]
- Udhayakumar, V.K.; De Beuckelaer, A.; McCaffrey, J.; McCrudden, C.M.; Kirschman, J.L.; Vanover, D.; Van Hoecke, L.; Roose, K.; Deswarte, K.; De Geest, B.G.; et al. Arginine-Rich Peptide-Based mRNA Nanocomplexes Efficiently Instigate Cytotoxic T Cell Immunity Dependent on the Amphipathic Organization of the Peptide. Adv. Healthc Mater. 2017, 6, 1601412. [Google Scholar] [CrossRef]
- Mulholland, E.J.; Ali, A.; Robson, T.; Dunne, N.J.; McCarthy, H.O. Delivery of RALA/siFKBPL nanoparticles via electrospun bilayer nanofibres: An innovative angiogenic therapy for wound repair. J. Control. Release 2019, 316, 53–65. [Google Scholar] [CrossRef]
- Liu, Y.; Wan, H.-H.; Tian, D.-M.; Xu, X.-J.; Bi, C.-L.; Zhan, X.-Y.; Huang, B.-H.; Xu, Y.-S.; Yan, L.-P. Development and Characterization of High Efficacy Cell-Penetrating Peptide via Modulation of the Histidine and Arginine Ratio for Gene Therapy. Materials 2021, 14, 4674. [Google Scholar] [CrossRef]
- Yang, S.; Meng, Z.; Kang, Z.; Sun, C.; Wang, T.; Feng, S.; Meng, Q.; Liu, K. The structure and configuration changes of multifunctional peptide vectors enhance gene delivery efficiency. RSC Adv. 2018, 8, 28356–28366. [Google Scholar] [CrossRef] [PubMed]
- Ali, S.; Dussouillez, C.; Padilla, B.; Frisch, B.; Mason, A.J.; Kichler, A. Design of a new cell penetrating peptide for DNA, siRNA and mRNA delivery. J. Gene Med. 2022, 24, e3401. [Google Scholar] [CrossRef]
- Vanova, J.; Hejtmankova, A.; Zackova Suchanova, J.; Sauerova, P.; Forstova, J.; Hubalek Kalbacova, M.; Spanielova, H. Influence of cell-penetrating peptides on the activity and stability of virus-based nanoparticles. Int. J. Pharm. 2020, 576, 119008. [Google Scholar] [CrossRef]
- Ferrer-Miralles, N.; Corchero, J.L.; Kumar, P.; Cedano, J.A.; Gupta, K.C.; Villaverde, A.; Vazquez, E. Biological activities of histidine-rich peptides; merging biotechnology and nanomedicine. Microb. Cell Factories 2011, 10, 101. [Google Scholar] [CrossRef]
- Cirillo, S.; Tomeh, M.A.; Wilkinson, R.N.; Hill, C.; Brown, S.; Zhao, X. Designed Antitumor Peptide f or Targeted siRNA Delivery into Cancer Spheroids. ACS Appl. Mater. Interfaces 2021, 13, 49713–49728. [Google Scholar] [CrossRef]
- Blenke, E.O.; Sleszynska, M.; Evers, M.J.; Storm, G.; Martin, N.I.; Mastrobattista, E. Strategies for the Activation and Release of the Membranolytic Peptide Melittin from Liposomes Using Endosomal pH as a Trigger. Bioconjugate Chem. 2017, 28, 574–582. [Google Scholar] [CrossRef] [PubMed]
- Kloeckner, J.; Boeckle, S.; Persson, D.; Roedl, W.; Ogris, M.; Berg, K.; Wagner, E. DNA polyplexes based on degradable oligoethylenimine-derivatives: Combination with EGF receptor targeting and endosomal release functions. J. Control. Release 2006, 116, 115–122. [Google Scholar] [CrossRef]
- Zhang, S.K.; Song, J.W.; Li, S.B.; Gao, H.W.; Chang, H.Y.; Jia, L.L.; Gong, F.; Tan, Y.X.; Ji, S.P. Design of pH-sensitive peptides from natural antimicrobial peptides for enhancing polyethylenimine-mediated gene transfection. J. Gene Med. 2017, 19, e2955. [Google Scholar] [CrossRef] [PubMed]
- Boeckle, S.; Fahrmeir, J.; Roedl, W.; Ogris, M.; Wagner, E. Melittin analogs with high lytic activity at endosomal pH enhance transfection with purified targeted PEI polyplexes. J. Control. Release 2006, 112, 240–248. [Google Scholar] [CrossRef] [PubMed]
- Tamemoto, N.; Akishiba, M.; Sakamoto, K.; Kawano, K.; Noguchi, H.; Futaki, S. Rational Design Principles of Attenuated Cationic Lytic Peptides for Intracellular Delivery of Biomacromolecules. Mol. Pharm. 2020, 17, 2175–2185. [Google Scholar] [CrossRef]
- Yan, C.; Shi, W.; Gu, J.; Lee, R.J.; Zhang, Y. Design of a Novel Nucleus-Targeted NLS-KALA-SA Nanocarrier to Delivery Poorly Water-Soluble Anti-Tumor Drug for Lung Cancer Treatment. J. Pharm. Sci. 2021, 110, 2432–2441. [Google Scholar] [CrossRef]
- Li, Q.; Hao, X.; Wang, H.; Guo, J.; Ren, X.K.; Xia, S.; Zhang, W.; Feng, Y. Multifunctional REDV-G-TAT-G-NLS-Cys peptide sequence conjugated gene carriers to enhance gene transfection efficiency in endothelial cells. Colloids Surf. B Biointerfaces 2019, 184, 110510. [Google Scholar] [CrossRef]
- Ozcelik, S.; Pratx, G. Nuclear-targeted gold nanoparticles enhance cancer cell radiosensitization. Nanotechnology 2020, 31, 415102. [Google Scholar] [CrossRef]
- Hao, X.; Li, Q.; Guo, J.; Ren, X.; Feng, Y.; Shi, C.; Zhang, W. Multifunctional Gene Carriers with Enhanced Specific Penetration and Nucleus Accumulation to Promote Neovascularization of HUVECs in Vivo. ACS Appl. Mater. Interfaces 2017, 9, 35613–35627. [Google Scholar] [CrossRef]
- Liu, B.Y.; He, X.Y.; Xu, C.; Ren, X.H.; Zhuo, R.X.; Cheng, S.X. Peptide and Aptamer Decorated Delivery System for Targeting Delivery of Cas9/sgRNA Plasmid To Mediate Antitumor Genome Editing. ACS Appl. Mater. Interfaces 2019, 11, 23870–23879. [Google Scholar] [CrossRef]
- Lee, J.; Jung, J.; Kim, Y.J.; Lee, E.; Choi, J.S. Gene delivery of PAMAM dendrimer conjugated with the nuclear localization signal peptide originated from fibroblast growth factor 3. Int. J. Pharm. 2014, 459, 10–18. [Google Scholar] [CrossRef] [PubMed]
- Ritter, W.; Plank, C.; Lausier, J.; Rudolph, C.; Zink, D.; Reinhardt, D.; Rosenecker, J. A novel transfecting peptide comprising a tetrameric nuclear localization sequence. J. Mol. Med. (Berl.) 2003, 81, 708–717. [Google Scholar] [CrossRef] [PubMed]
- Matschke, J.; Bohla, A.; Maucksch, C.; Mittal, R.; Rudolph, C.; Rosenecker, J. Characterization of Ku70(2)-NLS as bipartite nuclear localization sequence for nonviral gene delivery. PLoS ONE 2012, 7, e24615. [Google Scholar] [CrossRef] [PubMed]
- Cao, M.; Zhang, Z.; Zhang, X.; Wang, Y.; Wu, J.; Liu, Z.; Sun, L.; Wang, D.; Yue, T.; Han, Y.; et al. Peptide Self-assembly into stable Capsid-Like nanospheres and Co-assembly with DNA to produce smart artificial viruses. J. Colloid Interface Sci. 2022, 615, 395–407. [Google Scholar] [CrossRef] [PubMed]
- Matsuura, K.; Watanabe, K.; Matsuzaki, T.; Sakurai, K.; Kimizuka, N. Self-assembled synthetic viral capsids from a 24-mer viral peptide fragment. Angew Chem. Int. Ed. Engl. 2010, 49, 9662–9665. [Google Scholar] [CrossRef] [PubMed]
- Fujita, S.; Matsuura, K. Encapsulation of CdTe Quantum Dots into Synthetic Viral Capsids. Chem. Lett. 2016, 45, 922–924. [Google Scholar] [CrossRef]
- Matsuura, K.; Ueno, G.; Fujita, S. Self-assembled artificial viral capsid decorated with gold nanoparticles. Polym. J. 2014, 47, 146–151. [Google Scholar] [CrossRef]
- Ni, R.; Chau, Y. Nanoassembly of Oligopeptides and DNA Mimics the Sequential Disassembly of a Spherical Virus. Angew. Chem. -Int. Ed. 2020, 59, 3578–3584. [Google Scholar] [CrossRef]
- Ni, R.; Liu, J.; Chau, Y. Ultrasound-facilitated assembly and disassembly of a pH-sensitive self-assembly peptide. RSC Adv. 2018, 8, 29482–29487. [Google Scholar] [CrossRef]
- Ni, R.; Chau, Y. Tuning the Inter-nanofibril Interaction To Regulate the Morphology and Function of Peptide/DNA Co-assembled Viral Mimics. Angew. Chem. Int. Ed. Engl. 2017, 56, 9356–9360. [Google Scholar] [CrossRef]
- Ruff, Y.; Moyer, T.; Newcomb, C.J.; Demeler, B.; Stupp, S.I. Precision templating with DNA of a virus-like particle with peptide nanostructures. J. Am. Chem. Soc. 2013, 135, 6211–6219. [Google Scholar] [CrossRef] [PubMed]
- Cao, M.; Wang, Y.; Zhao, W.; Qi, R.; Han, Y.; Wu, R.; Wang, Y.; Xu, H. Peptide-Induced DNA Condensation into Virus-Mimicking Nanostructures. ACS Appl. Mater. Interfaces 2018, 10, 24349–24360. [Google Scholar] [CrossRef] [PubMed]
- Järver, P.; Coursindel, T.; Andaloussi, S.E.; Godfrey, C.; Wood, M.J.; Gait, M.J. Peptide-mediated Cell and In Vivo Delivery of Antisense Oligonucleotides and siRNA. Mol. Ther. -Nucleic Acids 2012, 1, e27. [Google Scholar] [CrossRef] [PubMed]
- Vázquez, O.; Seitz, O. Cytotoxic peptide–PNA conjugates obtained by RNA-programmed peptidyl transfer with turnover. Chem. Sci. 2014, 5, 2850–2854. [Google Scholar] [CrossRef]
- Shabanpoor, F.; Gait, M.J. Development of a general methodology for labelling peptide-morpholino oligonucleotide conjugates using alkyne-azide click chemistry. Chem. Commun. 2013, 49, 10260–10262. [Google Scholar] [CrossRef] [PubMed]
- López-Vidal, E.M.; Schissel, C.K.; Mohapatra, S.; Bellovoda, K.; Wu, C.-L.; Wood, J.A.; Malmberg, A.B.; Loas, A.; Gómez-Bombarelli, R.; Pentelute, B.L. Deep Learning Enables Discovery of a Short Nuclear Targeting Peptide for Efficient Delivery of Antisense Oligomers. JACS Au 2021, 1, 2009–2020. [Google Scholar] [CrossRef]
- Eilers, W.; Gadd, A.; Foster, H.; Foster, K. Dmd Treatment: Animal Models. Neuromuscul. Disord. 2018, 28, S92–S93. [Google Scholar] [CrossRef]
- Urello, M.; Hsu, W.-H.; Christie, R.J. Peptides as a Material Platform for Gene Delivery: Emerging Concepts and Converging Technologies. Acta Biomater. 2020, 117, 40–59. [Google Scholar] [CrossRef]
- Samec, T.; Boulos, J.; Gilmore, S.; Hazelton, A.; Alexander-Bryant, A. Peptide-based delivery of therapeutics in cancer treatment. Mater. Today Bio 2022, 14, 100248. [Google Scholar] [CrossRef]
- Khan, M.M.; Filipczak, N.; Torchilin, V.P. Cell penetrating peptides: A versatile vector for co-delivery of drug and genes in cancer. J. Control. Release 2021, 330, 1220–1228. [Google Scholar] [CrossRef]
- Liu, Y.; An, S.; Li, J.; Kuang, Y.; He, X.; Guo, Y.; Ma, H.; Zhang, Y.; Ji, B.; Jiang, C. Brain-targeted co-delivery of therapeutic gene and peptide by multifunctional nanoparticles in Alzheimer’s disease mice. Biomaterials 2016, 80, 33–45. [Google Scholar] [CrossRef] [PubMed]
- Lehto, T.; Simonson, O.E.; Mäger, I.; Ezzat, K.; Sork, H.; Copolovici, D.-M.; Viola, J.R.; Zaghloul, E.M.; Lundin, P.; Moreno, P.M.D.; et al. A peptide-based vector for efficient gene transfer in vitro and in vivo. Mol. Ther. 2011, 19, 1457–1467. [Google Scholar] [CrossRef] [PubMed]
- Shajari, N.; Mansoori, B.; Davudian, S.; Mohammadi, A.; Baradaran, B. Overcoming the Challenges of siRNA Delivery: Nanoparticle Strategies. Curr. Drug Deliv. 2017, 14, 36–46. [Google Scholar] [CrossRef] [PubMed]
- Dissanayake, S.; Denny, W.A.; Gamage, S.; Sarojini, V. Recent developments in anticancer drug delivery using cell penetrating and tumor targeting peptides. J. Control. Release 2017, 250, 62–76. [Google Scholar] [CrossRef]
- Wang, H.; Lin, S.; Wang, S.; Jiang, Z.; Ding, T.; Wei, X.; Lu, Y.; Yang, F.; Zhan, C. Folic Acid Enables Targeting Delivery of Lipodiscs by Circumventing IgM-Mediated Opsonization. Nano Lett. 2022, 22, 6516–6522. [Google Scholar] [CrossRef]
- Shin, J.M.; Oh, S.J.; Kwon, S.; Deepagan, V.G.; Lee, M.; Song, S.H.; Lee, H.-J.; Kim, S.; Song, K.-H.; Kim, T.W.; et al. A PEGylated hyaluronic acid conjugate for targeted cancer immunotherapy. J. Control. Release 2017, 267, 181–190. [Google Scholar] [CrossRef]
- Cao, M.; Lu, S.; Wang, N.; Xu, H.; Cox, H.; Li, R.; Waigh, T.; Han, Y.; Wang, Y.; Lu, J.R. Enzyme-Triggered Morphological Transition of Peptide Nanostructures for Tumor-Targeted Drug Delivery and Enhanced Cancer Therapy. ACS Appl. Mater. Interfaces 2019, 11, 16357–16366. [Google Scholar] [CrossRef]
- Kapoor, P.; Singh, H.; Gautam, A.; Chaudhary, K.; Kumar, R.; Raghava, G.P. TumorHoPe: A database of tumor homing peptides. PLoS ONE 2012, 7, e35187. [Google Scholar] [CrossRef]
- Ahmad, K.; Lee, E.J.; Shaikh, S.; Kumar, A.; Rao, K.M.; Park, S.Y.; Jin, J.O.; Han, S.S.; Choi, I. Targeting integrins for cancer management using nanotherapeutic approaches: Recent advances and challenges. Semin. Cancer Biol. 2021, 69, 325–336. [Google Scholar] [CrossRef]
- Liu, F.; Yan, J.R.; Chen, S.; Yan, G.P.; Pan, B.Q.; Zhang, Q.; Wang, Y.F.; Gu, Y.T. Polypeptide-rhodamine B probes containing laminin/fibronectin receptor-targeting sequence (YIGSR/RGD) for fluorescent imaging in cancers. Talanta 2020, 212, 120718. [Google Scholar] [CrossRef]
- Koch, J.; Schober, S.J.; Hindupur, S.V.; Schoning, C.; Klein, F.G.; Mantwill, K.; Ehrenfeld, M.; Schillinger, U.; Hohnecker, T.; Qi, P.; et al. Targeting the Retinoblastoma/E2F repressive complex by CDK4/6 inhibitors amplifies oncolytic potency of an oncolytic adenovirus. Nat. Commun. 2022, 13, 4689. [Google Scholar] [CrossRef] [PubMed]
- Kasala, D.; Lee, S.H.; Hong, J.W.; Choi, J.W.; Nam, K.; Chung, Y.H.; Kim, S.W.; Yun, C.O. Synergistic antitumor effect mediated by a paclitaxel-conjugated polymeric micelle-coated oncolytic adenovirus. Biomaterials 2017, 145, 207–222. [Google Scholar] [CrossRef] [PubMed]
- Yamamoto, Y.; Hiraoka, N.; Goto, N.; Rin, Y.; Miura, K.; Narumi, K.; Uchida, H.; Tagawa, M.; Aoki, K. A targeting ligand enhances infectivity and cytotoxicity of an oncolytic adenovirus in human pancreatic cancer tissues. J. Control. Release 2014, 192, 284–293. [Google Scholar] [CrossRef] [PubMed]
- Yu, J.; Xie, X.; Xu, X.; Zhang, L.; Zhou, X.; Yu, H.; Wu, P.; Wang, T.; Che, X.; Hu, Z. Development of dual ligand-targeted polymeric micelles as drug carriers for cancer therapy in vitro and in vivo. J. Mater. Chem. B 2014, 2, 2114–2126. [Google Scholar] [CrossRef] [PubMed]
- Zhou, L.Y.; Zhu, Y.H.; Wang, X.Y.; Shen, C.; Wei, X.W.; Xu, T.; He, Z.Y. Novel zwitterionic vectors: Multi-functional delivery systems for therapeutic genes and drugs. Comput. Struct. Biotechnol. J. 2020, 18, 1980–1999. [Google Scholar] [CrossRef]
- Vachutinsky, Y.; Oba, M.; Miyata, K.; Hiki, S.; Kano, M.R.; Nishiyama, N.; Koyama, H.; Miyazono, K.; Kataoka, K. Antiangiogenic gene therapy of experimental pancreatic tumor by sFlt-1 plasmid DNA carried by RGD-modified crosslinked polyplex micelles. J. Control. Release 2011, 149, 51–57. [Google Scholar] [CrossRef]
- Dirisala, A.; Osada, K.; Chen, Q.; Tockary, T.A.; Machitani, K.; Osawa, S.; Liu, X.; Ishii, T.; Miyata, K.; Oba, M.; et al. Optimized rod length of polyplex micelles for maximizing transfection efficiency and their performance in systemic gene therapy against stroma-rich pancreatic tumors. Biomaterials 2014, 35, 5359–5368. [Google Scholar] [CrossRef]
- Ghosh, P.; Han, G.; De, M.; Kim, C.K.; Rotello, V.M. Gold nanoparticles in delivery applications. Adv. Drug Deliv. Rev. 2008, 60, 1307–1315. [Google Scholar] [CrossRef]
- Nativo, P.; Prior, I.A.; Brust, M. Uptake and Intracellular Fate of Surface-Modified Gold Nanoparticles. ACS Nano 2008, 2, 1639–1644. [Google Scholar] [CrossRef]
- Liu, T.; Lin, M.; Wu, F.; Lin, A.; Luo, D.; Zhang, Z. Development of a nontoxic and efficient gene delivery vector based on histidine grafted chitosan. Int. J. Polym. Mater. Polym. Biomater. 2022, 71, 717–727. [Google Scholar] [CrossRef]
- Kichler, A.; Leborgne, C.; Danos, O.; Bechinger, B. Characterization of the gene transfer process mediated by histidine-rich peptides. J. Mol. Med. (Berl) 2007, 85, 191–201. [Google Scholar] [CrossRef] [PubMed]
- Lointier, M.; Aisenbrey, C.; Marquette, A.; Tan, J.H.; Kichler, A.; Bechinger, B. Membrane pore-formation correlates with the hydrophilic angle of histidine-rich amphipathic peptides with multiple biological activities. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183212. [Google Scholar] [CrossRef] [PubMed]
- Kichler, A.; Leborgne, C.; März, J.; Danos, O.; Bechinger, B. Histidine-rich amphipathic peptide antibiotics promote efficient delivery of DNA into mammalian cells. Proc. Natl. Acad. Sci. USA 2003, 100, 1564–1568. [Google Scholar] [CrossRef] [PubMed]
- Vanova, J.; Ciharova, B.; Hejtmankova, A.; Epperla, C.P.; Skvara, P.; Forstova, J.; Hubalek Kalbacova, M.; Spanielova, H. VirPorters: Insights into the action of cationic and histidine-rich cell-penetrating peptides. Int. J. Pharm. 2022, 611, 121308. [Google Scholar] [CrossRef]
- Zhang, S.K.; Gong, L.; Zhang, X.; Yun, Z.M.; Li, S.B.; Gao, H.W.; Dai, C.J.; Yuan, J.J.; Chen, J.M.; Gong, F.; et al. Antimicrobial peptide AR-23 derivatives with high endosomal disrupting ability enhance poly(l-lysine)-mediated gene transfer. J. Gene Med. 2020, 22, e3259. [Google Scholar] [CrossRef]
- Peeler, D.J.; Thai, S.N.; Cheng, Y.; Horner, P.J.; Sellers, D.L.; Pun, S.H. pH-sensitive polymer micelles provide selective and potentiated lytic capacity to venom peptides for effective intracellular delivery. Biomaterials 2019, 192, 235–244. [Google Scholar] [CrossRef]
- Cao, X.; Shang, X.; Guo, Y.; Zheng, X.; Li, W.; Wu, D.; Sun, L.; Mu, S.; Guo, C. Lysosomal escaped protein nanocarriers for nuclear-targeted siRNA delivery. Anal. Bioanal. Chem. 2021, 413, 3493–3499. [Google Scholar] [CrossRef]
- Huang, G.; Zhang, Y.; Zhu, X.; Zeng, C.; Wang, Q.; Zhou, Q.; Tao, Q.; Liu, M.; Lei, J.; Yan, C.; et al. Structure of the cytoplasmic ring of the Xenopus laevis nuclear pore complex by cryo-electron microscopy single particle analysis. Cell Res. 2020, 30, 520–531. [Google Scholar] [CrossRef]
- Mangipudi, S.S.; Canine, B.F.; Wang, Y.; Hatefi, A. Development of a Genetically Engineered Biomimetic Vector for Targeted Gene Transfer to Breast Cancer Cells. Mol. Pharm. 2009, 6, 1100–1109. [Google Scholar] [CrossRef]
- Lu, J.; Wu, T.; Zhang, B.; Liu, S.; Song, W.; Qiao, J.; Ruan, H. Types of nuclear localization signals and mechanisms of protein import into the nucleus. Cell Commun. Signal. 2021, 19, 60. [Google Scholar] [CrossRef]
- Noble, J.E.; De Santis, E.; Ravi, J.; Lamarre, B.; Castelletto, V.; Mantell, J.; Ray, S.; Ryadnov, M.G. A De Novo Virus-Like Topology for Synthetic Virions. J. Am. Chem. Soc. 2016, 138, 12202–12210. [Google Scholar] [CrossRef] [PubMed]
- Cao, M.; Wang, N.; Zhou, P.; Sun, Y.; Wang, J.; Wang, S.; Xu, H. Virus-like supramolecular assemblies formed by cooperation of base pairing interaction and peptidic association. Sci. China Chem. 2015, 59, 310–315. [Google Scholar] [CrossRef]
- van der Aa, M.A.; Mastrobattista, E.; Oosting, R.S.; Hennink, W.E.; Koning, G.A.; Crommelin, D.J. The nuclear pore complex: The gateway to successful nonviral gene delivery. Pharm. Res. 2006, 23, 447–459. [Google Scholar] [CrossRef] [PubMed]
- Matsuura, K.; Ota, J.; Fujita, S.; Shiomi, Y.; Inaba, H. Construction of Ribonuclease-Decorated Artificial Virus-like Capsid by Peptide Self-assembly. J. Org. Chem. 2020, 85, 1668–1673. [Google Scholar] [CrossRef] [PubMed]
- Kong, J.; Wang, Y.; Zhang, J.; Qi, W.; Su, R.; He, Z. Rationally Designed Peptidyl Virus-Like Particles Enable Targeted Delivery of Genetic Cargo. Angew. Chem. Int. Ed. Engl. 2018, 57, 14032–14036. [Google Scholar] [CrossRef]
- Nakamura, Y.; Inaba, H.; Matsuura, K. Construction of Artificial Viral Capsids Encapsulating Short DNAs via Disulfide Bonds and Controlled Release of DNAs by Reduction. Chem. Lett. 2019, 48, 544–546. [Google Scholar] [CrossRef]
- Wen, A.M.; Steinmetz, N.F. Design of virus-based nanomaterials for medicine, biotechnology, and energy. Chem. Soc. Rev. 2016, 45, 4074–4126. [Google Scholar] [CrossRef]
- Cao, M.; Shen, Y.; Wang, Y.; Wang, X.; Li, D. Self-Assembly of Short Elastin-like Amphiphilic Peptides: Effects of Temperature, Molecular Hydrophobicity and Charge Distribution. Molecules 2019, 24, 202. [Google Scholar] [CrossRef]
- Marchetti, M.; Kamsma, D.; Vargas, E.C.; Garcia, A.H.; van der Schoot, P.; de Vries, R.; Wuite, G.J.L.; Roos, W.H. Real-Time Assembly of Viruslike Nucleocapsids Elucidated at the Single-Particle Level. Nano Lett. 2019, 19, 5746–5753. [Google Scholar] [CrossRef]
- Walter, E.; Merkle, H.P. Microparticle-mediated transfection of non-phagocytic cells in vitro. J. Drug Target. 2002, 10, 11–21. [Google Scholar] [CrossRef]
- Kim, Y.; Uthaman, S.; Nurunnabi, M.; Mallick, S.; Oh, K.S.; Kang, S.W.; Cho, S.; Kang, H.C.; Lee, Y.K.; Huh, K.M. Synthesis and characterization of bioreducible cationic biarm polymer for efficient gene delivery. Int. J. Biol. Macromol. 2018, 110, 366–374. [Google Scholar] [CrossRef]
- Dirisala, A.; Uchida, S.; Li, J.; Van Guyse, J.F.R.; Hayashi, K.; Vummaleti, S.V.C.; Kaur, S.; Mochida, Y.; Fukushima, S.; Kataoka, K. Effective mRNA Protection by Poly(l-ornithine) Synergizes with Endosomal Escape Functionality of a Charge-Conversion Polymer toward Maximizing mRNA Introduction Efficiency. Macromol. Rapid Commun. 2022, 43, e2100754. [Google Scholar] [CrossRef] [PubMed]
- Collard, W.T.; Yang, Y.; Kwok, K.Y.; Park, Y.; Rice, K.G. Biodistribution, metabolism, and in vivo gene expression of low molecular weight glycopeptide polyethylene glycol peptide DNA co-condensates. J. Pharm. Sci. 2000, 89, 499–512. [Google Scholar] [CrossRef]
- Dirisala, A.; Uchida, S.; Toh, K.; Li, J.; Osawa, S.; Tockary, T.A.; Liu, X.; Abbasi, S.; Hayashi, K.; Mochida, Y.; et al. Transient stealth coating of liver sinusoidal wall by anchoring two-armed PEG for retargeting nanomedicines. Sci. Adv. 2020, 6, eabb8133. [Google Scholar] [CrossRef] [PubMed]
- Cao, M.; Wang, Y.; Hu, X.; Gong, H.; Li, R.; Cox, H.; Zhang, J.; Waigh, T.A.; Xu, H.; Lu, J.R. Reversible Thermoresponsive Peptide-PNIPAM Hydrogels for Controlled Drug Delivery. Biomacromolecules 2019, 20, 3601–3610. [Google Scholar] [CrossRef]
- Cao, M.; Lu, S.; Zhao, W.; Deng, L.; Wang, M.; Wang, J.; Zhou, P.; Wang, D.; Xu, H.; Lu, J.R. Peptide Self-Assembled Nanostructures with Distinct Morphologies and Properties Fabricated by Molecular Design. ACS Appl. Mater. Interfaces 2017, 9, 39174–39184. [Google Scholar] [CrossRef]
- Cao, M.; Zhao, W.; Zhou, P.; Xie, Z.; Sun, Y.; Xu, H. Peptide nucleic acid-ionic self-complementary peptide conjugates: Highly efficient DNA condensers with specific condensing mechanism. RSC Adv. 2017, 7, 3796–3803. [Google Scholar] [CrossRef]
Peptide Type | Name | Sequence a | Reference |
---|---|---|---|
CPPs | CHAT | CHHHRRRWRRRHHHC | [22] |
LH2 | Ac, T, C-LHHLCHLLHHLCHLAG Ac-GALHCLHHLLHCLHHL Ac -LHHLCHLLHHLCHLGA Ac -LHHLCHLLHHLCHLGA | [23,24] | |
SRCRP2-11 SRCRP2-11-R | GRVEVLYRGSW GRVRVLYRGSW | [25] | |
R8 | RRRRRRRR | [26,27,28,29] | |
Penetratin | RQIKIWFQNRRMKWKK | [30] | |
WTAS | PLKTPGKKKKGKPGKRKEQEKKKRRTR | [31] | |
PF14 | Stearyl-AGYLLGKLLOOLAAAALOOLL-NH2 | [32] | |
CPP | CGRRMKWKK | [33] | |
Targeted peptides | circular NGR | CNGRCG | [28] |
NGR | NGR | [33,34] | |
RGD | RGD | [29,35,36,37] | |
Trivalent cRGD | HCACAE[cyclo(RGD-d-FK)]E[cyclo(RGD-d-FK)]2 | [38] | |
cRGD | cyclo(RGD-d-FK) | [39,40] | |
cyclic iRGD | cyclo (CRGDKGPDC) | [41] | |
Membrane active peptides | RALA | WEARLARALARALARHLARALAHALHACEA | [42,43,44] |
HALA2 | WEARLARALARALARHLARALAHALHACEA | [45] | |
(LLHH)3 | CLLHHLLHHLLHH | [46] | |
(LLKK)3-H6 | LLKKLLKKLLKKCHHHHHH | [46] | |
LAH4 | KKALLALALHHLAHLALHLALALKKA | [47] | |
KH27K | KHHHHHHHHHHHHHHHHHHHHHHHHHHHK | [48,49] | |
G3 | GIIKKIIKKIIKKI | [50] | |
Melittin | GIGAVLEVLTTGLPALISWIEEEEQQ | [51] | |
CMA-1 | EEGIGAVLKVLTTGLPALISWIKRKRQQC | [52] | |
CMA-2 | GIGAVLKVLTTGLPALISWIHHHHEEC | [53,54] | |
CMA-3 | GIGAVLKVLTTG LPALISWIKRKREEC | [54] | |
CMA-4 | EEGIGAVLKVLTTG LPALISWIHHHHQQC | [52] | |
NMA-3 | CGIGAVLKVLTTGLPALISWI KRKREE | [52,53] | |
acid-Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | [51] | |
Mel-L6A10 | GIGAIEKVLETGLPTLISWIKNKRKQ | [55] | |
RV-23 | RIGVLLARLPKLFSLFKLMGKKV | [53] | |
NLS peptides | SV40 T antigen | PKKKRKV | [56,57,58,59,60] |
Mouse FGF3 | RLRRDAGGRGGVYEHLGGAPRRRK | [61] | |
NLSV404 | PKKKRKVGPKKKRKVGPKKKVGPKKKRKVGC | [62] | |
Ku7O2 | CKVTKRKHGAAGAASKRPKGKVTKRKHGAAGAASKRPK | [63] | |
Other peptides | Smart peptide | Nap-FFGPLGLAG(CKm)nC | [64] |
24-mer β-annulus peptide | INHVGGTGGAIMAPVAVTRQLVGS | [65,66] | |
β-annulus-GGGCG peptide | INHVGGTGGAIMAPVAVTRQLVGSGGGCG | [67] | |
H4K5HCBZlCBZlH | HHHHKKKKKC12LLHCBZlCBZlHLLGSPD | [68] | |
K3C6SPD | KKKC6WLVFFAQQGSPD | [69,70] | |
CC | REGVAKALRAVANALHYNASALEEVADALQKVKM | [71] | |
Surfactant-like peptide | IIIVVVAAAGGGKKK | [72] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Yang, Y.; Liu, Z.; Ma, H.; Cao, M. Application of Peptides in Construction of Nonviral Vectors for Gene Delivery. Nanomaterials 2022, 12, 4076. https://doi.org/10.3390/nano12224076
Yang Y, Liu Z, Ma H, Cao M. Application of Peptides in Construction of Nonviral Vectors for Gene Delivery. Nanomaterials. 2022; 12(22):4076. https://doi.org/10.3390/nano12224076
Chicago/Turabian StyleYang, Yujie, Zhen Liu, Hongchao Ma, and Meiwen Cao. 2022. "Application of Peptides in Construction of Nonviral Vectors for Gene Delivery" Nanomaterials 12, no. 22: 4076. https://doi.org/10.3390/nano12224076
APA StyleYang, Y., Liu, Z., Ma, H., & Cao, M. (2022). Application of Peptides in Construction of Nonviral Vectors for Gene Delivery. Nanomaterials, 12(22), 4076. https://doi.org/10.3390/nano12224076