Targeting Plasmodium Life Cycle with Novel Parasite Ligands as Vaccine Antigens
Abstract
1. Introduction
2. Pre-Erythrocytic Plasmodium Ligands
2.1. Sporozoite Exit from the Circulation
2.2. Hepatocyte Infection
3. Plasmodium Ligands in the Mosquito
3.1. Fertilization
3.2. Traversal of the Midgut Epithelium
4. Conclusions and Perspectives
Author Contributions
Funding
Conflicts of Interest
References
- Kebaier, C.; Voza, T.; Vanderberg, J. Kinetics of Mosquito-Injected Plasmodium Sporozoites in Mice: Fewer Sporozoites Are Injected into Sporozoite-Immunized Mice. PLoS Pathog. 2009, 5, e1000399. [Google Scholar] [CrossRef] [PubMed][Green Version]
- White, N.J.; Pukrittayakamee, S.; Hien, T.T.; Faiz, M.A.; Mokuolu, O.A.; Dondorp, A.M. Malaria. Lancet 2014, 383, 723–735. [Google Scholar] [CrossRef] [PubMed]
- Pradel, G.; Garapaty, S.; Frevert, U. Kupffer and Stellate Cell Proteoglycans Mediate Malaria Sporozoite Targeting to the Liver. Comp. Hepatol. 2004, 3 (Suppl. S1), S47. [Google Scholar] [CrossRef]
- Frevert, U.; Engelmann, S.; Zougbede, S.; Stange, J.; Ng, B.; Matuschewski, K.; Liebes, L.; Yee, H. Intravital Observation of Plasmodium Berghei Sporozoite Infection of the Liver. PLoS Biol. 2005, 3, e192. [Google Scholar] [CrossRef]
- Tavares, J.; Formaglio, P.; Thiberge, S.; Mordelet, E.; Van Rooijen, N.; Medvinsky, A.; Menard, R.; Amino, R. Role of Host Cell Traversal by the Malaria Sporozoite during Liver Infection. J. Exp. Med. 2013, 210, 905–915. [Google Scholar] [CrossRef]
- Sturm, A.; Amino, R.; van de Sand, C.; Regen, T.; Retzlaff, S.; Rennenberg, A.; Krueger, A.; Pollok, J.M.; Menard, R.; Heussler, V.T. Manipulation of Host Hepatocytes by the Malaria Parasite for Delivery into Liver Sinusoids. Science 2006, 313, 1287–1290. [Google Scholar] [CrossRef]
- Duffy, P.E.; Gorres, J.P. Malaria Vaccines since 2000: Progress, Priorities, Products. NPJ Vaccines 2020, 5, 48. [Google Scholar] [CrossRef] [PubMed]
- Tsoumani, M.E.; Voyiatzaki, C.; Efstathiou, A. Malaria Vaccines: From the Past Towards the mRNA Vaccine Era. Vaccines 2023, 11, 1452. [Google Scholar] [CrossRef]
- Weiss, G.E.; Gilson, P.R.; Taechalertpaisarn, T.; Tham, W.H.; de Jong, N.W.; Harvey, K.L.; Fowkes, F.J.; Barlow, P.N.; Rayner, J.C.; Wright, G.J.; et al. Revealing the Sequence and Resulting Cellular Morphology of Receptor-Ligand Interactions during Plasmodium falciparum Invasion of Erythrocytes. PLoS Pathog. 2015, 11, e1004670. [Google Scholar] [CrossRef]
- Duffy, P.E. Transmission-Blocking Vaccines: Harnessing Herd Immunity for Malaria Elimination. Expert Rev. Vaccines 2021, 20, 185–198. [Google Scholar] [CrossRef]
- Smith, R.C.; Vega-Rodríguez, J.; Jacobs-Lorena, M. The Plasmodium Bottleneck: Malaria Parasite Losses in the Mosquito Vector. Mem. Inst. Oswaldo Cruz 2014, 109, 644–661. [Google Scholar] [CrossRef]
- Tadesse, F.G.; Meerstein-Kessel, L.; Goncalves, B.P.; Drakeley, C.; Ranford-Cartwright, L.; Bousema, T. Gametocyte Sex Ratio: The Key to Understanding Plasmodium falciparum Transmission? Trends Parasitol. 2019, 35, 226–238. [Google Scholar] [CrossRef] [PubMed]
- Ghosh, A.K.; Coppens, I.; Gardsvoll, H.; Ploug, M.; Jacobs-Lorena, M. Plasmodium Ookinetes Coopt Mammalian Plasminogen to Invade the Mosquito Midgut. Proc. Natl. Acad. Sci. USA 2011, 108, 17153–17158. [Google Scholar] [CrossRef] [PubMed]
- Cha, S.J.; Kim, M.S.; Na, C.H.; Jacobs-Lorena, M. Plasmodium Sporozoite Phospholipid Scramblase Interacts with Mammalian Carbamoyl-Phosphate Synthetase 1 to Infect Hepatocytes. Nat. Commun. 2021, 12, 6773. [Google Scholar] [CrossRef] [PubMed]
- Cha, S.J.; Kim, M.S.; Pandey, A.; Jacobs-Lorena, M. Identification of GAPDH on the Surface of Plasmodium Sporozoites as a New Candidate for Targeting Malaria Liver Invasion. J. Exp. Med. 2016, 213, 2099–2112. [Google Scholar] [CrossRef] [PubMed]
- Cha, S.J.; Vega-Rodriguez, J.; Tao, D.; Kudyba, H.M.; Hanner, K.; Jacobs-Lorena, M. Plasmodium Female Gamete Surface Hsp90 Is a Key Determinant for Fertilization. mBio 2023, 15, e0314223. [Google Scholar] [CrossRef]
- Bonnycastle, L.L.; Mehroke, J.S.; Rashed, M.; Gong, X.; Scott, J.K. Probing the Basis of Antibody Reactivity with a Panel of Constrained Peptide Libraries Displayed by Filamentous Phage. J. Mol. Biol. 1996, 258, 747–762. [Google Scholar] [CrossRef] [PubMed]
- Cha, S.J.; Park, K.; Srinivasan, P.; Schindler, C.W.; van Rooijen, N.; Stins, M.; Jacobs-Lorena, M. CD68 Acts as a Major Gateway for Malaria Sporozoite Liver Infection. J. Exp. Med. 2015, 212, 1391–1403. [Google Scholar] [CrossRef] [PubMed]
- Cha, S.J.; McLean, K.J.; Jacobs-Lorena, M. Identification of Plasmodium GAPDH Epitopes for Generation of Antibodies That Inhibit Malaria Infection. Life Sci. Alliance 2018, 1, e201800111. [Google Scholar] [CrossRef]
- Perez-Casal, J.; Potter, A.A. Glyceradehyde-3-Phosphate Dehydrogenase as a Suitable Vaccine Candidate for Protection against Bacterial and Parasitic Diseases. Vaccine 2016, 34, 1012–1017. [Google Scholar] [CrossRef]
- Kopeckova, M.; Pavkova, I.; Stulik, J. Diverse Localization and Protein Binding Abilities of Glyceraldehyde-3-Phosphate Dehydrogenase in Pathogenic Bacteria: The Key to Its Multifunctionality? Front. Cell Infect. Microbiol. 2020, 10, 89. [Google Scholar] [CrossRef] [PubMed]
- Wang, J.; Li, S.; Chen, J.; Gan, L.; Wang, J.; Xiong, Q.; Feng, Z.; Li, Q.; Deng, Z.; Yuan, X.; et al. Hijacking of Host Plasminogen by Mesomycoplasma (Mycoplasma) hyopneumoniae via GAPDH: An Important Virulence Mechanism to Promote Adhesion and Extracellular Matrix Degradation. Microbiol. Spectr. 2023, 11, e0021823. [Google Scholar] [CrossRef] [PubMed]
- Zhu, W.; Wu, C.; Kang, C.; Cai, C.; Wang, Y.; Li, J.; Zhang, Q.; Sun, X.; Jin, M. Evaluation of the Protective Efficacy of Four Newly Identified Surface Proteins of Erysipelothrix rhusiopathiae. Vaccine 2018, 36, 8079–8083. [Google Scholar] [CrossRef] [PubMed]
- An, R.; Guo, Y.; Gao, M.; Wang, J. Subcutaneous Streptococcus dysgalactiae Gapdh Vaccine in Mice Induces a Proficient Innate Immune Response. J. Vet. Sci. 2023, 24, e72. [Google Scholar] [CrossRef] [PubMed]
- Alvarez-Dominguez, C.; Salcines-Cuevas, D.; Teran-Navarro, H.; Calderon-Gonzalez, R.; Tobes, R.; Garcia, I.; Grijalvo, S.; Paradela, A.; Seoane, A.; Sangari, F.J.; et al. Epitopes for Multivalent Vaccines against Listeria, Mycobacterium and Streptococcus spp: A Novel Role for Glyceraldehyde-3-Phosphate Dehydrogenase. Front. Cell Infect. Microbiol. 2020, 10, 573348. [Google Scholar] [CrossRef] [PubMed]
- Salcines-Cuevas, D.; Teran-Navarro, H.; Calderon-Gonzalez, R.; Torres-Rodriguez, P.; Tobes, R.; Fresno, M.; Calvo-Montes, J.; Molino-Bernal, I.; Yanez-Diaz, S.; Alvarez-Dominguez, C. Glyceraldehyde-3-Phosphate Dehydrogenase Common Peptides of Listeria monocytogenes, Mycobacterium marinum and Streptococcus pneumoniae as Universal Vaccines. Vaccines 2021, 9, 269. [Google Scholar] [CrossRef] [PubMed]
- Sheng, X.; Zhang, H.; Liu, M.; Tang, X.; Xing, J.; Chi, H.; Zhan, W. Development and Evaluation of Recombinant B-Cell Multi-Epitopes of PDHA1 and GAPDH as Subunit Vaccines against Streptococcus iniae Infection in Flounder (Paralichthys olivaceus). Vaccines 2023, 11, 624. [Google Scholar] [CrossRef] [PubMed]
- Argiro, L.; Henri, S.; Dessein, H.; Kouriba, B.; Dessein, A.J.; Bourgois, A. Induction of a Protection against S. mansoni with a Map Containing Epitopes of Sm37-GAPDH and Sm10-DLC. Effect of Coadsorption with GM-CSF on Alum. Vaccine 2000, 18, 2033–2038. [Google Scholar] [CrossRef]
- Gomez-Diaz, E.; Yerbanga, R.S.; Lefevre, T.; Cohuet, A.; Rowley, M.J.; Ouedraogo, J.B.; Corces, V.G. Epigenetic Regulation of Plasmodium falciparum Clonally Variant Gene Expression During Development in Anopheles Gambiae. Sci. Rep. 2017, 7, 40655. [Google Scholar] [CrossRef]
- Kodigepalli, K.M.; Bowers, K.; Sharp, A.; Nanjundan, M. Roles and Regulation of Phospholipid Scramblases. FEBS Lett. 2015, 589, 3–14. [Google Scholar] [CrossRef]
- Rayala, S.; Francis, V.G.; Sivagnanam, U.; Gummadi, S.N. N-Terminal Proline-Rich Domain Is Required for Scrambling Activity of Human Phospholipid Scramblases. J. Biol. Chem. 2014, 289, 13206–13218. [Google Scholar] [CrossRef] [PubMed]
- Bateman, A.; Finn, R.D.; Sims, P.J.; Wiedmer, T.; Biegert, A.; Soding, J. Phospholipid Scramblases and Tubby-Like Proteins Belong to a New Superfamily of Membrane Tethered Transcription Factors. Bioinformatics 2009, 25, 159–162. [Google Scholar] [CrossRef] [PubMed]
- Haase, S.; Condron, M.; Miller, D.; Cherkaoui, D.; Jordan, S.; Gulbis, J.M.; Baum, J. Identification and Characterisation of a Phospholipid Scramblase in the Malaria Parasite Plasmodium falciparum. Mol. Biochem. Parasitol. 2021, 243, 111374. [Google Scholar] [CrossRef] [PubMed]
- Dal Col, J.; Lamberti, M.J.; Nigro, A.; Casolaro, V.; Fratta, E.; Steffan, A.; Montico, B. Phospholipid Scramblase 1: A Protein with Multiple Functions via Multiple Molecular Interactors. Cell Commun. Signal 2022, 20, 78. [Google Scholar] [CrossRef] [PubMed]
- Xu, D.; Jiang, W.; Wu, L.; Gaudet, R.G.; Park, E.S.; Su, M.; Cheppali, S.K.; Cheemarla, N.R.; Kumar, P.; Uchil, P.D.; et al. PLSCR1 Is a Cell-Autonomous Defence Factor against SARS-CoV-2 Infection. Nature 2023, 619, 819–827. [Google Scholar] [CrossRef] [PubMed]
- Zanghi, G.; Vembar, S.S.; Baumgarten, S.; Ding, S.; Guizetti, J.; Bryant, J.M.; Mattei, D.; Jensen, A.T.R.; Renia, L.; Goh, Y.S.; et al. A Specific PfEMP1 Is Expressed in P. falciparum Sporozoites and Plays a Role in Hepatocyte Infection. Cell Rep. 2018, 22, 2951–2963. [Google Scholar] [CrossRef] [PubMed]
- Lindner, S.E.; Swearingen, K.E.; Harupa, A.; Vaughan, A.M.; Sinnis, P.; Moritz, R.L.; Kappe, S.H. Total and Putative Surface Proteomics of Malaria Parasite Salivary Gland Sporozoites. Mol. Cell Proteom. 2013, 12, 1127–1143. [Google Scholar] [CrossRef]
- Schopf, F.H.; Biebl, M.M.; Buchner, J. The HSP90 Chaperone Machinery. Nat. Rev. Mol. Cell Biol. 2017, 18, 345–360. [Google Scholar]
- Corigliano, M.G.; Sander, V.A.; Lopez, E.F.S.; Duarte, V.A.R.; Morales, L.F.M.; Angel, S.O.; Clemente, M. Heat Shock Proteins 90 KDa: Immunomodulators and Adjuvants in Vaccine Design against Infectious Diseases. Front. Bioeng. Biotechnol. 2020, 8, 622186. [Google Scholar] [CrossRef]
- Calvert, M.E.; Digilio, L.C.; Herr, J.C.; Coonrod, S.A. Oolemmal Proteomics—Identification of Highly Abundant Heat Shock Proteins and Molecular Chaperones in the Mature Mouse Egg and Their Localization on the Plasma Membrane. Reprod. Biol. Endocrinol. 2003, 1, 27. [Google Scholar] [CrossRef]
- Pires, E.S.; Khole, V.V. A Block in the Road to Fertility: Autoantibodies to Heat-Shock Protein 90-Beta in Human Ovarian Autoimmunity. Fertil. Steril. 2009, 92, 1395–1409. [Google Scholar] [CrossRef]
- Burnie, J.P.; Brooks, W.; Donohoe, M.; Hodgetts, S.; Al-Ghamdi, A.; Matthews, R.C. Defining Antibody Targets in Streptococcus oralis Infection. Infect. Immun. 1996, 64, 1600–1608. [Google Scholar] [CrossRef] [PubMed]
- Chung, E.J.; Jeong, Y.I.; Lee, M.R.; Kim, Y.J.; Lee, S.E.; Cho, S.H.; Lee, W.J.; Park, M.Y.; Ju, J.W. Heat Shock Proteins 70 and 90 from Clonorchis sinensis Induce Th1 Response and Stimulate Antibody Production. Parasit. Vectors 2017, 10, 118. [Google Scholar] [CrossRef]
- Denikus, N.; Orfaniotou, F.; Wulf, G.; Lehmann, P.F.; Monod, M.; Reichard, U. Fungal Antigens Expressed during Invasive Aspergillosis. Infect. Immun. 2005, 73, 4704–4713. [Google Scholar] [CrossRef]
- Nowalk, A.J.; Gilmore, R.D., Jr.; Carroll, J.A. Serologic Proteome Analysis of Borrelia burgdorferi Membrane-Associated Proteins. Infect. Immun. 2006, 74, 3864–3873. [Google Scholar] [CrossRef] [PubMed]
- Wang, G.; Sun, M.; Fang, J.; Yang, Q.; Tong, H.; Wang, L. Protective Immune Responses against Systemic Candidiasis Mediated by Phage-Displayed Specific Epitope of Candida albicans Heat Shock Protein 90 in C57BL/6J Mice. Vaccine 2006, 24, 6065–6073. [Google Scholar] [CrossRef]
- Li, X.; Yang, Y.; Yang, F.; Wang, F.; Li, H.; Tian, H.; Wang, G. Chitosan Hydrogel Loaded with Recombinant Protein Containing Epitope C from HSP90 of Candida albicans Induces Protective Immune Responses against Systemic Candidiasis. Int. J. Biol. Macromol. 2021, 173, 327–340. [Google Scholar] [CrossRef]
- Florens, L.; Liu, X.; Wang, Y.; Yang, S.; Schwartz, O.; Peglar, M.; Carucci, D.J.; Yates, J.R., 3rd; Wu, Y. Proteomics Approach Reveals Novel Proteins on the Surface of Malaria-Infected Erythrocytes. Mol. Biochem. Parasitol. 2004, 135, 1–11. [Google Scholar] [CrossRef]
- Florens, L.; Washburn, M.P.; Raine, J.D.; Anthony, R.M.; Grainger, M.; Haynes, J.D.; Moch, J.K.; Muster, N.; Sacci, J.B.; Tabb, D.L.; et al. A Proteomic View of the Plasmodium falciparum Life Cycle. Nature 2002, 419, 520–526. [Google Scholar] [CrossRef]
- Swearingen, K.E.; Lindner, S.E.; Shi, L.; Shears, M.J.; Harupa, A.; Hopp, C.S.; Vaughan, A.M.; Springer, T.A.; Moritz, R.L.; Kappe, S.H.; et al. Interrogating the Plasmodium Sporozoite Surface: Identification of Surface-Exposed Proteins and Demonstration of Glycosylation on CSP and TRAP by Mass Spectrometry-Based Proteomics. PLoS Pathog. 2016, 12, e1005606. [Google Scholar] [CrossRef]
- Bayih, A.G.; Folefoc, A.; Mohon, A.N.; Eagon, S.; Anderson, M.; Pillai, D.R. In Vitro and in Vivo Anti-Malarial Activity of Novel Harmine-Analog Heat Shock Protein 90 Inhibitors: A Possible Partner for Artemisinin. Malar. J. 2016, 15, 579. [Google Scholar] [CrossRef] [PubMed]
- Shahinas, D.; Macmullin, G.; Benedict, C.; Crandall, I.; Pillai, D.R. Harmine Is a Potent Antimalarial Targeting HSP90 and Synergizes with Chloroquine and Artemisinin. Antimicrob. Agents Chemother. 2012, 56, 4207–4213. [Google Scholar] [CrossRef] [PubMed]
- Ghosh, A.K.; Ribolla, P.E.; Jacobs-Lorena, M. Targeting Plasmodium Ligands on Mosquito Salivary Glands and Midgut with a Phage Display Peptide Library. Proc. Natl. Acad. Sci. USA 2001, 98, 13278–13281. [Google Scholar] [CrossRef] [PubMed]
- Pancholi, V. Multifunctional Alpha-Enolase: Its Role in Diseases. Cell Mol. Life Sci. 2001, 58, 902–920. [Google Scholar] [CrossRef] [PubMed]
- Chen, S.M.; Zou, Z.; Guo, S.Y.; Hou, W.T.; Qiu, X.R.; Zhang, Y.; Song, L.J.; Hu, X.Y.; Jiang, Y.Y.; Shen, H.; et al. Preventing Candida albicans from Subverting Host Plasminogen for Invasive Infection Treatment. Emerg. Microbes Infect. 2020, 9, 2417–2432. [Google Scholar] [CrossRef] [PubMed]
- Hussain, M.; Kohler, C.; Becker, K. Enolase of Staphylococcus lugdunensis Is a Surface-Exposed Moonlighting Protein That Binds to Extracellular Matrix and the Plasminogen/Plasmin System. Front. Microbiol. 2022, 13, 837297. [Google Scholar] [CrossRef] [PubMed]
- Han, S.; Wang, Y.; Chang, W.; Wang, L.; Fang, J.; Han, J.; Hou, X.; Qi, X.; Wang, J. Evaluation of the Protective Efficacy of Six Major Immunogenic Proteins of Mycoplasma synoviae. Front. Vet. Sci. 2023, 10, 1334638. [Google Scholar] [CrossRef] [PubMed]
- Haque, M.S.; Islam, M.S.; You, M.J. Efficacy of Recombinant Enolase as a Candidate Vaccine against Haemaphysalis longicornis Tick Infestation in Mice. Parasites Hosts Dis. 2023, 61, 439–448. [Google Scholar] [CrossRef]
- Quiroz-Castaneda, R.E.; Aguilar-Diaz, H.; Amaro-Estrada, I. An Alternative Vaccine Target for Bovine Anaplasmosis Based on Enolase, a Moonlighting Protein. Front. Vet. Sci. 2023, 10, 1225873. [Google Scholar] [CrossRef]
- Diaz-Hernandez, A.; Gonzalez-Vazquez, M.C.; Arce-Fonseca, M.; Rodriguez-Morales, O.; Cedillo-Ramirez, M.L.; Carabarin-Lima, A. Consensus Enolase of Trypanosoma cruzi: Evaluation of Their Immunogenic Properties Using a Bioinformatics Approach. Life 2022, 12, 746. [Google Scholar] [CrossRef]
- Franco-Serrano, L.; Cedano, J.; Perez-Pons, J.A.; Mozo-Villarias, A.; Piñol, J.; Amela, I.; Querol, E. A Hypothesis Explaining Why So Many Pathogen Virulence Proteins Are Moonlighting Proteins. Pathog. Dis. 2018, 76, fty046. [Google Scholar] [CrossRef] [PubMed]
- Langowski, M.D.; Khan, F.A.; Bitzer, A.A.; Genito, C.J.; Schrader, A.J.; Martin, M.L.; Soto, K.; Zou, X.; Hadiwidjojo, S.; Beck, Z.; et al. Optimization of a Plasmodium falciparum Circumsporozoite Protein Repeat Vaccine Using the Tobacco Mosaic Virus Platform. Proc. Natl. Acad. Sci. USA 2020, 117, 3114–3122. [Google Scholar] [CrossRef] [PubMed]
| Ligand | P. falciparum Gene | Human Gene | ||||
|---|---|---|---|---|---|---|
| # Gene, Isoforms | Amino Acids | Genetic Variation | # Gene, Isoforms | Maximum Identity (%) | ||
| NS-SNPs (%) | Strains | |||||
| GAPDH | 1, 1 | 337 | 140Q-K (33) | 275 | 1, 2 | 64 |
| PLSCR | 1, 1 | 275 | 50S-N (1>), 52M-I (1) | 301 | 5, 10 | 21 |
| HSP90 | 1, 1 | 745 | 58A-S (2), 229G-R (4), 231R-E (3), 233G-E (1), 235E-G (6), 239K-E (25), 256N-K (1) | 301 | 2, 3 | 75 |
| Enolase | 1, 1 | 446 | 301V-I (1) | 300 | 4, 10 | 69 |
| Ligand | Position | Peptide Sequence | % Identity |
|---|---|---|---|
| GAPDH | 102–111 | FLTKELASSH | 0 |
| 189–199 | VDGPSKGGKDW | 0 | |
| 283–292 | EVVSQDFVHD | 60 | |
| PLSCR | 5–26 | NIHMQPNINYSYRNPNMYNMNY | 0 |
| 35–43 | QQQMQLFVN | 0 | |
| 72–79 | MGFKLDFN | 0 | |
| HSP90 | 156–169 | FTVTKDETNEKLGR | 0 |
| 211–340 | RQNEKEITASEEEEGEGEGEREGEEEEEKKKKTGEDKNADESKEENEDEEKKEDNEEDDNKTDHPKVEDVTEELENAEKKKKEKRKKKIHTVEHEWEELNKQKPLWMRKPEEVTNEEYASFYKSLTNDWE | 28 | |
| 562–590 | CCTKEGLDIDDSEEAKKDFETLKAEYEGL | 48 | |
| 716–742 | SIDEEENNDIDLPPLEETVDATDSKME | 33 | |
| Enolase | 83–90 | NCTEQKKI | 0 |
| 99–112 | DGSKNEWGWSKSKL | 0 | |
| 142–150 | QLAGKKSDQ | 0 | |
| 260–290 | YNSENKTYDLDFKTPNNDKSLVKTGAQLVDL | 42 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Khan, S.; Patel, M.P.; Patni, A.D.; Cha, S.-J. Targeting Plasmodium Life Cycle with Novel Parasite Ligands as Vaccine Antigens. Vaccines 2024, 12, 484. https://doi.org/10.3390/vaccines12050484
Khan S, Patel MP, Patni AD, Cha S-J. Targeting Plasmodium Life Cycle with Novel Parasite Ligands as Vaccine Antigens. Vaccines. 2024; 12(5):484. https://doi.org/10.3390/vaccines12050484
Chicago/Turabian StyleKhan, Shan, Manas Paresh Patel, Aleem Damji Patni, and Sung-Jae Cha. 2024. "Targeting Plasmodium Life Cycle with Novel Parasite Ligands as Vaccine Antigens" Vaccines 12, no. 5: 484. https://doi.org/10.3390/vaccines12050484
APA StyleKhan, S., Patel, M. P., Patni, A. D., & Cha, S.-J. (2024). Targeting Plasmodium Life Cycle with Novel Parasite Ligands as Vaccine Antigens. Vaccines, 12(5), 484. https://doi.org/10.3390/vaccines12050484
