Next Article in Journal
Hypervirulence and Multiresistance to Antibiotics in Klebsiella pneumoniae Strains Isolated from Patients with Hospital- and Community-Acquired Infections in a Mexican Medical Center
Next Article in Special Issue
The Discovery of Oropharyngeal Microbiota with Inhibitory Activity against Pathogenic Neisseria gonorrhoeae and Neisseria meningitidis: An In Vitro Study of Clinical Isolates
Previous Article in Journal
In Vitro Antiparasitic Activity of Propyl-Propane-Thiosulfinate (PTS) and Propyl-Propane-Thiosulfonate (PTSO) from Allium cepa against Eimeria acervulina Sporozoites
Previous Article in Special Issue
Effect of Polydextrose on the Growth of Pediococcus pentosaceus as Well as Lactic Acid and Bacteriocin-like Inhibitory Substances (BLIS) Production
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Streptococcus salivarius 24SMBc Genome Analysis Reveals New Biosynthetic Gene Clusters Involved in Antimicrobial Effects on Streptococcus pneumoniae and Streptococcus pyogenes

Medical Molecular Microbiology and Antibiotic Resistance Laboratory (MMARLab), Department of Biomedical and Biotechnological Sciences (BIOMETEC), University of Catania, 95123 Catania, Italy
*
Author to whom correspondence should be addressed.
These authors contributed equally to this work.
Microorganisms 2022, 10(10), 2042; https://doi.org/10.3390/microorganisms10102042
Submission received: 5 September 2022 / Revised: 29 September 2022 / Accepted: 14 October 2022 / Published: 16 October 2022
(This article belongs to the Special Issue Bacteriocins: Academic Advances and Immediate Applications)

Abstract

Streptococcus salivarius 24SMBc is an oral probiotic with antimicrobial activity against the otopathogens Streptococcus pyogenes and Streptococcus pneumoniae. Clinical studies have reinforced its role in reducing the recurrence of upper respiratory tract infections (URTIs) and rebalancing the nasal microbiota. In this study, for the first time, we characterized 24SMBc by whole genome sequencing and annotation; likewise, its antagonistic activity vs. Streptococcus pneumoniae and Streptococcus pyogenes was evaluated by in vitro co-aggregation and competitive adherence tests. The genome of 24SMBc comprises 2,131,204 bps with 1933 coding sequences (CDS), 44 tRNA, and six rRNA genes and it is categorized in 319 metabolic subsystems. Genome mining by BAGEL and antiSMASH tools predicted three novel biosynthetic gene clusters (BGCs): (i) a Blp class-IIc bacteriocin biosynthetic cluster, identifying two bacteriocins blpU and blpK; (ii) an ABC-type bacteriocin transporter; and (iii) a Type 3PKS (Polyketide synthase) involved in the mevalonate pathway for the isoprenoid biosynthetic process. Further analyses detected two additional genes for class-IIb bacteriocins and 24 putative adhesins and aggregation factors. Finally, in vitro assays of 24SMBc showed significant anti-adhesion and co-aggregation effects against Streptococcus pneumoniae strains, whereas it did not act as strongly against Streptococcus pyogenes. In conclusion, we identified a novel blpU-K bacteriocin-encoding BGC and two class-IIb bacteriocins involved in the activity against Streptococcus pneumoniae and Streptococcus pyogenes; likewise the type 3PKS pathway could have beneficial effects for the host including antimicrobial activity. Furthermore, the presence of adhesins and aggregation factors might be involved in the marked in vitro activity of co-aggregation with pathogens and competitive adherence, showing an additional antibacterial activity not solely related to metabolite production. These findings corroborate the antimicrobial activity of 24SMBc, especially against Streptococcus pneumoniae belonging to different serotypes, and further consolidate the use of this strain in URTIs in clinical settings.

1. Introduction

Over the last few years, increasing data on the microbiome and its theater of activity (structural elements, metabolites, environmental conditions) has highlighted the essential role of commensal bacteria in the development of the human body and its physiology [1], establishing the idea that human health also depends on the symbiotic relationship with a “healthy” microbiome and its crucial role in preventing infection due to its bacterial competition ability for the same niche, nutrients, and adhesion surfaces [2]. Although antibiotic therapy is the standard treatment for bacterial infections, the indiscriminate use of antibiotics in many human endeavors is one of the principal reasons why microbial resistance is increasing at an alarming rate worldwide [3]. Moreover, another critical implication of antibiotic use is how it affects not only pathogens but also commensal bacteria. This might alter the dynamic equilibrium between the human body and its microbiome, leading to a diversity loss described as “dysbiosis”, which can give an advantage for the emergence and outbreak of pathogens [4].
In particular, the upper respiratory tract (URT) offers several niches that are normally colonized by different microbial communities, acting as gatekeepers to respiratory health [2]. Infections of the upper respiratory tract (URTIs) are very common in both children and adults and include the common cold, laryngitis, pharyngitis/tonsillitis, acute rhinitis, acute rhinosinusitis, and acute otitis media. URTIs are usually one of the main reasons for seeking medical care and for inappropriate antibiotic prescriptions, with potential consequences in the prevalence of antibiotic resistance [5,6]. Although the majority of URTIs are usually caused by viruses, bacteria can also be the causative agent, often leading to clinical challenges related to a higher morbidity and a chronic progression of the disease [7]. Furthermore, studies of the nasopharyngeal microbiome demonstrated the important role of the microbiota in URTIs because microbial imbalance, often caused by antibiotic therapy in recurring infection, can determine the reduction or loss of beneficial commensal bacteria that exert a protective role, averting the host colonization and the development of bacterial infections [2]. Thus, it is important to focus on alternative strategies to prevent and treat infection in order to reduce antibiotic use and the incidence of drug resistance [8]. Local bacteriotherapy has been proposed as a potential strategy, based on the administration of oral probiotics that can exert beneficial effects to maintain and/or restore healthy microbial communities within the URT and reduce the severity, duration, and incidence of re-infection, interfering with the adhesion and colonization of potential pathogens by the production of antimicrobial peptides (bacteriocins) and immunomodulatory mediators; likewise, competitive adherence and co-aggregation between pathogens and probiotic strains can enhance the antagonistic activity of probiotics [9].
Evidence shows the important role played by α-streptococci, notably those with antagonistic activity against pathogens, in the protection from URTIs. Numerous studies have reported how a significant reduction in α-streptococci in the URT is correlated with a higher incidence of re-infections in patients with streptococcal pharyngotonsillitis, but also with a higher probability of otitis media in children [10].
The first oral streptococcal probiotic used in clinical setting was S. salivarius K12, the producer of plasmid-carried salA/B bacteriocins, in the treatment of halitosis and S. pyogenes infections. S. salivarius K12 and M18, already commercially available, also reduced recurrent streptococcal pharyngitis, whereas M18 reduced dental plaque scores and S. mutans count [11]. Additionally, Streptococcus salivarius 24SMBc is an oral probiotic that, when administered intranasally, reduced the risk of new episodes of acute otitis media in otitis-prone children [12]. Further studies have reported the potential synergic benefits of using an oral probiotic formulation, already commercially available, of S. salivarius 24SMBc and S. oralis 89a (98:2 ratio) for its ability to rebalance the nasal microbiota improving the health status as well as to inhibit the biofilm formation of URT pathogens and prevent recurring URTIs in infant and adult populations [13,14,15,16,17].
In particular, the antimicrobial activity of S. salivarius 24SMBc has been well-characterized for its ability to adhere to epithelial cells and for blpU bacteriocin-production, mainly targeting other pathogenic streptococcal strains, namely Streptococcus pyogenes and Streptococcus pneumoniae [18,19]. In fact, oral streptococci are among the major producers of bacteriocins (i.e., ribosomal synthesized and post-translationally modified peptides (RiPP) [20]) that, like non-ribosomal peptides (NRP) and polyketides (PK), belong to natural bioactive products (NPs). These compounds often have antimicrobial activity, although they are highly diverse in their structure [21].
The production of natural bioactive products (NPs) is usually controlled by genes for biosynthetic regulation, transport, and immunity, which are physically clustered together on the genome to form biosynthetic gene clusters (BGCs). Thus, genome mining to identify potential BGCs using whole genome sequencing has become a pivotal element to discover novel NP biosynthesis pathways of interest, since many NPs could have potential therapeutic applications [22].
In light of these considerations, in this study, we report, for the first time, the genomic characterization of S. salivarius 24SMBc combined with genome mining tools to obtain new insights into its antimicrobial effects; furthermore, its antimicrobial activity was evaluated by in vitro co-aggregation and competitive adherence tests against different S. pneumoniae and S. pyogenes serotypes.

2. Materials and Methods

2.1. Bacterial Strains and Growth Conditions

S.salivarius 24SMBc isolated from the nasopharyngeal swab of healthy children [18] and the indicator strains used in this study were grown in Tryptic Soy Broth (TSB) and Tryptic Soy Agar (TSA) (Oxoid, Basingstoke, UK) with 5% horse blood (Thermo Scientific, Basingstoke, UK). Cultures were incubated overnight at 37 °C in 5% CO2. Stock cultures of all strains were stored in TSB with 20% glycerol at −80 °C. The indicator strains were selected from our microbial bank at the MMARLab and comprised four S. pneumoniae belonging to serotype 19A (S. pneumoniae BT), serotype 15C (S. pneumoniae C2), serotype 9V (S. pneumoniae A3), and one non-typeable (S. pneumoniae M4); three S. pyogenes, two belonging to serotype M1, S. pyogenes MGAS 5005 (ATCC BAA-947) and S. pyogenes Spy3537 [23], and one to serotype M18 (S. pyogenes 2812A) [24].

2.2. Whole-Genome Sequencing, De Novo Genome Assembly

Genomic DNA isolated from S. salivarius 24SMBc was extracted using a PureLink™ Genomic DNA Mini Kit (Thermo Fisher Scientific, Waltham, MA, USA) according to the manufacturer’s instructions. Genomic DNA was quantified by a Qubit 2.0 fluorometer (dsDNA HS assay, Invitrogen, Waltham, MA, USA) and its purity grade was assessed by a Nanodrop2000 Spectrophotometer (Thermo Fisher Scientific, Waltham, MA, USA), evaluating the DNA absorbance ratios at 260 nm/280 nm and 260 nm/230 nm and obtaining a total DNA concentration of 1.4 µg/µL with the absorbance ratio 260/280 of 1.9 and 260/230 of 2.15. DNA integrity was also confirmed by the agarose gel electrophoretic assay. Samples were loaded into a 0.8% agarose gel and ran for 3 h at 70 V in 0.5 × Tris-Borate-EDTA buffer (Figure S1). Genomic DNA (60 ng total) was used to prepare libraries using the Nextera XT DNA Library Prep Kit (Illumina, San Diego, CA, USA) and sequenced by the Illumina MiSeq platform [25] following the manufacturer’s protocol. The raw data were provided in paired end reads (2 × 250 Read Length), resulting in a 258 × coverage. Sequence reads were quality controlled using Trimmomatic [26] and genome assembled by SPAdes v3.14.0 through the MEGA annotator pipeline [27].

2.3. Genomic Data Accession Number

The S. salivarius 24SMBc genomic reads were deposited in the National Center for Biotechnology Information (NCBI) SRA database under SRR20769826, the BioProject accession number PRJNA865118.

2.4. Genome Annotation

The genome was annotated with Prokka v. 1.13 [28], ribosomal RNA gene predictions were performed with RNAmmer v1.2 [29], while transfer RNA gene predictions were achieved with tRNAscan-SE v1.21 [30]. Rapid annotation using subsystem technology (RAST) was applied for microbial genome annotation to divide the genome into different subsystems, which are defined as “a set of functional roles” connected to specific genes of the available annotated genome [31].
Prokka output (Table S1) was also used as the input for SPAAN [32], a software for the prediction of adhesins and adhesin-like proteins; protein domains were further analyzed using the NCBI’s Conserved Domain Database (CDD) with the BatchCD tool (https://www.ncbi.nlm.nih.gov/Structure/bwrpsb/bwrpsb.cgi accessed on 1 April 2022) to confirm the detection of bacterial adhesins. PathogenFinder of the CGE server and MP3 (Prediction of Pathogenic Proteins) were used to predict the potential pathogenicity [33,34].

2.5. In Silico Prediction and Characterization of Bacteriocin Biosynthetic Gene Clusters

Microbial genome mining was performed using the antiSMASH 6.0 pipeline (antibiotic and Secondary Metabolites Shell) to predict classic and novel biosynthetic gene clusters (BGCs) coding for secondary metabolites such as polyketide synthetases (PKS) and post-translationally modified peptides (RiPPs) [35]. The BAGEL4 tool (BActeriocin GEnome minimal tooL) was used to identify ribosomal synthesized and post-translationally modified peptides (RiPPs) and cluster genes related to bacteriocin synthesis [36]. The amino acid sequences of the core-peptides identified within the BGCs were further analyzed by the CD-search tool.

2.6. Adhesion Assay

For adhesion assays, the HEp-2 cell line (ATCC CCL-23™) was used. The cells were maintained in Dulbecco’s modified Eagle medium (D-MEM) (Sigma-Aldrich, Saint Louis, MO, USA), supplemented with 2 mM L-glutamine, antibiotics (penicillin 100 U/mL; streptomycin 100 U/mL; amphotericin B 0.25 µg/mL) and 6% (v/v) fetal bovine serum (FBS) (Thermo Fisher Scientific, Waltham, MA, USA). Confluent monolayers were dissociated by incubation with 0.25% trypsin/EDTA (0.25% (w/v) trypsin, 0.1 mM EDTA) (Life Technologies, Carlsbad, CA, USA) for 10 min at 37 °C in 5% CO2, then seeded into 24-well plates at a concentration of 1.5 × 105 cells/well in D-MEM supplemented with 2% FBS for adhesion assays. Before the tests, cells were washed at least twice with 500 µL of saline phosphate buffer (PBS) (Sigma-Aldrich, Saint Louis, MO, USA), then 500 μL of DMEM was added without antibiotics and with 2% FBS. To determine the adherence degree of each strain, 10 µL of bacterial culture containing 1.5 × 108 CFU/mL was added to the HEp-2 cells. PBS was used as a negative control and 100 U/mL heparin was used as a positive control to block pneumococcal adhesion. After 1 h incubation, unbound bacteria were washed twice with PBS 1X (Gibco™, Thermo Fisher Scientific, Waltham, MA, USA), and the cells and adhering bacteria were removed by trypsin/EDTA (0.25%). The viable bacterial counts (CFU/mL) were carried out on TSA with 5% horse blood after overnight incubation [37].

2.7. Anti-Adhesion Activity of 24SMBc against S. pneumoniae and S. pyogenes on HEp-2 Cells

All strains were inoculated in 20 mL of Todd Hewitt broth (THB) (Oxoid, Basingstoke, UK), supplemented with 0.5% (w/v) yeast extract (THY) (Oxoid, Basingstoke, UK) and incubated at 37 °C in 5% CO2 for 16 h. The competitive exclusion assays were performed as described by Dunne et al. with some modifications [38]. A total of 100 µL of overnight bacterial culture was inoculated in 20 mL of THY to reach mid-log phase (approximately 3 h for S. salivarius 24SMBc and S. pyogenes and 4 h for S. pneumoniae). After centrifugation, the pellet was resuspended in 0.85% (w/v) NaCl (Merck, Darmstadt, Germany) to obtain the concentration of 1.5 × 109 CFU/mL for S. salivarius 24SMBc (optical density OD600 ≈ 0.30) and 1.5 × 108 CFU/mL for the S. pyogenes (OD600 ≈ 0.30) and S. pneumoniae strains (OD600 ≈ 0.35). To assess the anti-adhesion activity by exclusion test, 10 µL per well of 24SMBc (109 CFU/mL) was administered to cells 1 h prior to the addition of S. pneumoniae or S. pyogenes strains on the 24-well plate. After incubation, cells were washed with PBS 1X twice and adherent bacteria were quantified as aforementioned. The viable bacterial count, and consequently the detection of streptococcal strains, was obtained by different phenotypical features and morphology on TSA with 5% horse blood. The interference of probiotic S. salivarius 24SMBc versus streptococcal pathogens was expressed as the percentage of adhering bacteria normalized to S. pneumoniae and S. pyogenes adhesion when alone.
The statistical analysis was performed by GraphPad Prism 6 software (GraphPad software Inc., San Diego, CA, USA). These experiments were performed in triplicate and the statistical analysis of adherence interference was performed by the multiple t-test, p value: * p < 0.05, ** p < 0.01, and *** p < 0.001.

2.8. LDH Assay for Cytotoxicity

To evaluate the cytotoxic effect of S. salivarius 24SMBc on HEp-2, lactate dehydrogenase (LDH) release was measured. After 3 h of incubation with S. salivarius 24SMBc, the supernatants from HEp-2 monolayers grown in 24-well plates were collected. The levels of LDH in the supernatants were assayed in triplicate using a colorimetric Cytotoxicity Detection Kit (Roche, Mannheim, Germany) according to the manufacturer’s instructions. LDH is a stable cytosolic enzyme of eukaryotic cells, an indicator of necrotic cell death when released [39]. HEp-2 cells exposed to Triton X-100 (0.9%) were used as a control of the total release (100% LDH release). The background level (0% LDH release) was determined with a bacteria-free culture medium. One-way ANOVA was used for the analysis of the LDH assay, p value: * p < 0.05, ** p < 0.01, and *** p < 0.001.

2.9. Auto- and Co-Aggregation Assay

The auto- and co-aggregation tests were conducted following the protocol of Chaffanel et al. with a few modifications [40]. Each strain was grown in THY to reach log phase, as described previously. Pellets were centrifuged at 3000× g for 15 min at 4 °C and resuspended in a peptone water solution (casein peptone 0.1% (p/v) (Sigma-Aldrich, Saint Louis, MO, USA) to obtain bacterial suspensions with an optical density of OD600 ≈ 0.8. To test for the co-aggregation levels, suspensions of S. salivarius 24SMBc were mixed with an equal volume of indicator strain suspensions, then incubated at room temperature for 1 h. Both the bacterial suspensions alone for the auto-aggregation measurements, and together in co-aggregation were placed in triplicate in a 96-well plate (100 μL per well) for a T0 reading with the microplate reader SYNERGY. After 1 h of incubation at room temperature, centrifugation at 650× g for 2 min was performed to precipitate non-aggregated bacteria, then a second reading at T1 was taken by placing 100 μL of the supernatant of the bacterial suspensions in the microtiter.
The auto-aggregation percentage is expressed as 1 − (AT1/AT0) × 100, and the percentage of co-aggregation (CoA%) was calculated as (AT0 − AT1/AT1) × 100. The co-aggregation values of S. salivarius 24SMBc with the indicator strains were considered significant when the co-aggregation percentage was higher than the auto-aggregation percentage of each pathogenic strain. Co-aggregation assays were analyzed using ANOVA with Fisher’s significant difference (LSD) test, p value: * p < 0.05, ** p < 0.01, and *** p < 0.001. All experiments were performed in triplicate.

3. Results

3.1. Genome Annotation

The total 2,131,204 bp size of the 24SMBc genome was assembled in one chromosome with 39.85% GC content composited in 32 contigs with an N50 value of 171,173. The genome carried 1933 coding genes (CDSs), 44 tRNA, and six rRNA (Table 1). Genome analysis using PathogenFinder and MP3 tools confirmed that 24SMBc is a non-pathogenic strain as non-pathogenic protein families were identified.
The RAST annotation server detected 217 subsystems distributed in twenty-five categories and subcategories including, mainly, 226 predicted genes related to “amino acids and derivates”, 164 to “carbohydrates”, 193 to “protein metabolisms”, 114 to “cell wall and capsule”, and 111 to “RNA metabolisms”. Interesting subcategories comprised the mevalonate branch of isoprenoid biosynthesis and isoprenoids for quinones in the “fatty acids, lipid and isoprenoids” category; and cobalt-zinc-cadmium resistance, copper homeostasis, mercuric reductase, and the mercury resistance operon in the “resistance to antibiotics and toxic compounds” section. Moreover, no putative genes were identified either as determinants of virulence or as genes associated with mobile elements (Figure 1).
Prokka annotation (File S1) also detected four genes involved in bacteriocin production: two bacteriocin class IIc, blpU of 59 amino acids (genome locus tag LFGOLEEL_01643) and blpK of 64 amino acids (genome locus tag LFGOLEEL_01651), and two additional class IIb bacteriocins of the bact_IIb_cerein family consisting of 52 and 55 amino acids (genome locus tag LFGOLEEL_01810 and LFGOLEEL_01811) (Table 2).
Through a combination of software-assisted (SPAAN), CD-search tool, and manual annotation, a total of 24 putative adhesins and/or aggregation substances were identified in sixteen loci on the 24SMBc genome (Table 3) and class A and B sortase (srtA, locus tag LFGOLEEL_00109 and srtB locus tag LFGOLEEL_ 01150). Fifteen of them displayed a typical cell-wall signature with LPxTG motif, which is recognized by the sortase enzyme known to be involved in the surface anchorage, while six showed an YSIRK_motif in their signal peptide and three a KxYKxGKxW motif.

3.2. Microbial Genome Mining for Biosynthetic Gene Clusters

Genome mining for bacteriocin biosynthetic gene clusters by BAGEL4 identified one bacteriocin biosynthetic gene cluster (BBCG) in contig 24 (24.23.AOI_01; 77377-106176) with two core peptides: BlpU (pfam 10439), associated with the blp-cassette (accession number KY347796) as previously described [17], and BlpK (pfam10439) downstream of the cassette; moreover, this BBGC contained an additional protein, BmbF, a putative dual-specificity RNA methyltransferase RlmN (PF04055) (Figure 2).
Through antiSMASH v.6.0, a total of three putative biosynthetic gene clusters (BGCs) were detected, namely, two bacteriocin clusters (BBCG1 and BBCG3) and another cluster BCG2, labeled as a type III polyketide synthase cluster (T3PKS) (Figure S2). In particular, the bacteriocin cluster BBGC1 (contig_6 RiPP-like) contained the peptidase_C39 (PF03412) as a core peptide, an ABC-type bacteriocin transporter that is a signature for the salivaricin biosynthetic gene cluster of Lactobacillus salivarius (accession number EF592482.1; MIBiG accession number BGC0000624) (File S2).
The Blp bacteriocin cluster previously described by BAGEL was identified in BBCG3 (Contig_24_ RiPP-like) by antiSMASH, showing identical genetic organization including two bacteriocin_IIc, processing/transport and self-immunity proteins (File S3). Interestingly, the antiSMASH cluster blast that showed ten genetic clusters among those most similar to BBCG3 highlighted a different gene organization of this cluster, typical with each S. salivarius strains while maintaining the main functional genes, thus BBCG3 appeared to be a specific strain locus (Figure S3). BCG2 was detected to encode the multidomain enzyme type III polyketides synthase (PKs) (Contig_11 T3PKS) that, through the mevalonate pathway, is involved in the isoprenoid biosynthetic process. BCG2 presented a signature for viguiepinol biosynthetic gene cluster from Streptomyces sp. KO-3988 (accession number AB183750.1, MIBiG accession number BGC0000286) and showed a core biosynthetic gene encoding for hydroxymethylglutaryl-CoA synthase (HMG_CoA_synt_N, PF01154; HMG_CoA_synt_C, PF08540), which catalyzes the condensation of acetyl-CoA with acetoacetyl-CoA to produce HMG-CoA and CoA, and four additional biosynthetic genes encoding for (i) nucleotidyl transferase (NTP_transferase (PF00483); (ii) two glycosyl transferase group 1 (Glycos_transf_1, PF00534); and (iii) an alpha/beta hydrolase (Abhydrolase_1, pfam00561) (File S4, Figure S2).

3.3. Antagonistic Activity of S. salivarius 24SMBc against S. pneumoniae and S. pyogenes Adherence to HEp2 Cells

The antibacterial effect of S. salivarius 24SMBc vs. both S. pneumoniae group serotypes 19A, 15C, 9V, and NT and S. pyogenes group serotypes M1 and M18 was evaluated by the competitive exclusion test on HEp-2 cell lines. Before performing the interference tests, the adherence properties of each streptococcus on HEp-2 cells were evaluated as they could vary considerably between different streptococcal strains. After 1 h of incubation, S. salivarius 24SMBc achieved a viable count of 7.10 × 108 CFU/mL as HEp-2 adherent bacteria, whereas for S. pneumoniae strains, the adherence rates were approximately 2.24 × 105 CFU/mL except for S. pneumoniae A3, showing 4.77 × 104 CFU/mL, and the S. pyogenes group reached a viable count of 3.57 × 106 CFU/mL. The results shown in Figure 3A are expressed as the percentage of adherence normalized to the number of adherent streptococci alone. 24SMBc inhibited the adhesion of the S. pneumoniae group with statistically significant differences, in particular, the S. pneumoniae serotype 19A and 15C (S. pneumoniae BT and S. pneumoniae C2), showing a reduction in the adhesion of 90% and 67%, respectively, as reported in Figure 3A (Table S1). Otherwise, S. pyogenes strains showed a different behavior, maintaining a level of adhesion of approximately 106 CFU/mL when incubated with 24SMBc. As a result, the reduction in the percentage of adherence was not statistically significant (Figure 3B).

3.4. Cytotoxic Effect of S. salivarius 24SMBc on HEp-2

S. salivarius 24SMBc had no cytotoxic effects on HEp-2 cells by measuring the LDH release from cells incubated with the bacteria for up to 3 h. The results showed that the amount of LDH release in the supernatant of HEp-2 cultured in the absence or presence of the bacteria was unchanged, indicating that S. salivarius 24SMBc at 109 CFU/mL did not cause cell lysis (Figure 4).

3.5. Auto-Aggregation and Co-Aggregation Ability

Aggregation properties were assayed with the auto-aggregation and co-aggregation tests measuring two different characteristics of the strains. The auto-aggregation rate of S. salivarius 24SMBc measured after 1 h of incubation exhibited the following value of 81.8 ± 0.013%. S. pyogenes strains (S. pyogenes 2812A, S. pyogenes 35370, and S. pyogenes 5005), despite having a strong selective interaction value with S. salivarius 24SMBc, possessed strong self-aggregation properties (83.6%, 73.7%, and 73.1%, respectively), however, this was not statistically significant. On the other hand, S. salivarius 24SMBc exhibited a significant co-aggregation rate with S. pneumoniae strains belonging to different serotypes, with values ranging between 67 ± 0.003% and 52.5 ± 0.015%, as illustrated in Figure 5.

4. Discussion

In prior studies, S. salivarius 24SMBc was phenotypically characterized as an oral probiotic because of its antagonist activity against pathogenic streptococci. In this study, our aim was to determine the full characterization of S. salivarius 24SMBc by whole-genome sequencing (WGS) to gain insights into its antimicrobial activity, considering that genomic information is an excellent source to identify potential natural bioactive products and their biosynthetic pathways. Together with the genome analysis, in vitro assays were carried out to assess the mechanisms of competitive adhesion and co-aggregation of 24SMBc against S. pneumoniae and S. pyogenes as the main streptococcal pathogens in URTIs. First of all, the 24SMBc genome analysis further confirmed that it is free of streptococcal virulence determinants and, for the first time, we found four different bacteriocin genes: two of them belonging to the IIc class including two, blpK and blpU, related to BBCG3 characterized by high specific genetic variability for each strain. The blp locus that is closely related to peptides produced by S. pneumoniae is known to be important for intraspecies competition in S. pneumoniae [41], therefore, the peptide homology shared by both microorganisms may explain the strong inhibitory activity of S. salivarius 24SMBc against this pathogen and thus its crucial role in interspecies competition within the nasopharynx [12,13,14,15,16,17]. Interestingly, blpU and blpK were both found in one cluster (BBGC3) that has never been characterized before in the S. salivarius species, which usually carries clusters for the biosynthesis of salivaricin 9, salivaricin D, and salivaricin A/B, the most common bacteriocins in this species [20]. On the other hand, the bacteriocin biosynthetic gene clusters (BBGCs) for cerein class IIb bacteriocins, based on our silico analysis, were not found. One possible explanation could be that the current BGC identification tools including those used in this study are largely based on the structure of the BGC database, consequently, BGCs that encode metabolites with previously unrecognized functions may not be available. The output from antiSMASH identified a BGC for type III polyketide synthetase, which was found to be similar to the viguiepinol biosynthetic gene cluster from Streptomyces sp. KO-3988 and further characterized in a natural polyketide-isoprenoid hybrid compound [42]. Type III PKSs are self-contained multifunctional enzymes localized at the core of each pathway that convert metabolically-available acyl-CoA precursors into polyketide backbone complexes through a step-by-step chain building mechanism, producing a wide array of natural polyketide compounds, which are widely used in clinical medicines mainly as antibiotics, anti-cancer, and anti-cholesterol compounds [43]. Several studies have reported a convergence between the mevalonate pathway for isoprene biosynthesis from primary metabolism and polyketide biosynthesis from the secondary metabolism also because they share simple precursors such as acetyl-CoA and malonyl-CoA units [44]. This link between primary and secondary metabolism could generate such chimeric assembly lines that highlight biochemical flexibility. As we can understand from what has been said thus far, we could also hypothesize a relationship between primary and secondary metabolisms for S. salivarius, considering that it possesses both the Type III PKS cluster and one involved in the biosynthesis of FASII fatty acids, isoprenoid branch mevalonate and a branch of the mevalonate biosynthesis of isoprenoid biosynthesis, and the biosynthesis of polypropylene diphosphate as described by the RAST server. However, further studies focused on the isolation and characterization of the polyketide-isoprenoid compound are planned. The bioinformatic analysis of the genome of 24SMBc also identified 24 different putative adhesins and/or aggregation factors. Streptococci possess an array of surface-associated proteins that interact with eukaryotic cells and the extracellular matrix (ECM), among which there are adhesins essential for the colonization of the human host [45]. Several streptococcal species can effectively colonize the oral cavity and the nasopharynx, but substantial phenotypic heterogeneity exists between different strains, affecting their adhesion, colonization, and biofilm-formation abilities [46]. S. salivarius is one of the first colonizers of the oral cavity and URT, is one of the streptococcal species that displays the largest number of both extracellular components and glycosyltransferases, is able to bind epithelial cells, host-derived extracellular molecules, and a number of early, middle and late colonizers, emphasizing its role for microbial community establishment and development [47]. Within the genome of S. salivarius 24SMBc, we found several genes involved in adhesion and aggregation including two sequences encoding the antigen I/II family domain and another antigen I/II C2 terminal domain, which are normally expressed by streptococci found in the oral cavity and are important in both processes as they interact with the host and other bacteria [46]. Other adhesion-related sequences where we found encoded adhesin domains belong to the MSCRAMM family (microbial surface components recognizing adhesive matrix molecules), usually linked to the peptidoglycan surface with a sortase-dependent mechanism [48] such as FctA and collagen binding domains that could partially explain the potential adherence competition to human cells. Furthermore, other MSCRAMM domains were found; interestingly, one domain belonged to adhesin SdrC, which is involved in both adhesion and aggregation, and two SdrD adhesin domains that are involved in the adherence to nasal epithelium, along with domains belonging to ClfA and ClfB adhesin families that are shared by other Gram-positive cocci with similar tropism [48]. Other domains of interest include mucin-binding ones such as MucBP_2 and Mub B2 for strong adhesion on the mucus, as recently demonstrated in S. salivarius F6-1 in which their gene knock out reduced adherence on the HT29-MTX cells; whereas for aggregation, glucan-binding GbpC domain played a role in dextran-dependent aggregation in other streptococci [40,49], as shown in S. gordonii, which is able to co-aggregate with Actinomyces naueslundii and Porphyromonas gingivalis, and the surface adhesin CshA is also essential for auto-aggregation in S. salivarius as previously described [50]. These data matched our results obtained from 24SMBc antagonistic activity against the S. pneumoniae and S. pyogenes strains of different serotypes. First, 24SMBc showed no cytotoxic effect on the HEp-2 cell line, an extraordinary ability to adhere to the host epithelium, and has a very high value of auto-aggregation (81.8%), which justifies its permanence and predominance in the respiratory microbiota in clinical studies. Since nasopharynx colonization is the critical step for these streptococcal strains and colonization can lead to infection, competitive adhesion and exclusion are essential preventive features that a probiotic strain can perform in lieu of the host microbiota [51]. 24SMBc significantly reduces pneumococcal adhesion on Hep-2 cells, whereas it does not show the same effects on S. pyogenes. It significantly co-aggregates with pneumococci and S. pyogenes, even if the co-aggregation with the latter is not significative. In the adhesion interference assay, S. salivarius 24SMBc caused a significative reduction of adhering pneumococci strains. The mechanism behind this phenomenon is not yet well known, but this reduction could be due to the competition of binding sites and to the mutual exclusion by co-aggregation. In fact, S. salivarius 24SMBc not only determined a reduction in the pneumococci strains but also showed a good and significative co-aggregation with them. Conversely, the results obtained for S. pyogenes showed no significant reduction in adhesion in the presence of S. salivarius 24SMBc and no significative co-aggregation. It is likely that the previously described S. salivarius 24SMBc inhibitory activity could be linked to the production of bacteriocins and not used for the competition of binding sites. Although adhesion is the pivotal step for colonization, aggregation factors are essential for auto-aggregation and co-aggregation to incorporate other microorganisms and create complex communities on the mucosa [46], a goal that can be essential when using probiotics during or after antibiotic treatment to replenish the local microbiota. Moreover, the aggregation of commensal strains appeared to be necessary for the adhesion to epithelial cells and to enable the formation of a barrier that protects the host’s epithelium from colonization by pathogens, and the ability to co-aggregate with a pathogen allows probiotics to entrap it. These two features are considered as desirable properties for probiotic strains, in fact, the auto-aggregation ability test, together with co-aggregation, could be used as a preliminary screening, identifying potentially adherent bacteria with properties suitable for commercial purposes. In conclusion, our analysis demonstrated, for the first time, three different biosynthetic gene clusters related to the synthesis of bacteriocins and polyketides by genome mining. Likewise, several putative adhesion and aggregation factors were identified on streptococci that could support 24SMBc anti-adhesion and co-aggregation effects, however, further studies and experimental validations will be needed. Our findings further validate the value of the genomic approach to explore the full potentiality of streptococci to produce bioactive natural products for developing new applications for health promotion. This is particularly true in this era, in which the alarming and global impact of the antimicrobial resistance in medicine, in agriculture and animal husbandry has been observed [3]. The use of commensal microorganisms producing natural “competitors” can be used as an alternative strategy that might mitigate this current medical crisis, coupling antibiotic therapy with adjuvant strategies to treat infections.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/microorganisms10102042/s1, Figure S1: Agarose gel electrophoretic analysis of S. salivarius 24SMBc genomic DNA, Figure S2: Biosynthetic gene clusters (BGCs) identified in S. salivarius 24SMBc genome by antiSMASH, Figure S3: Cluster blast of BBCG3 by antiSMASH database, File S1: Annotation of S. salivarius 24SMBc by Prokka software, File S2: Annotation of BBGC1 by antiSMASH, File S3: Annotation of BBGC2 by antiSMASH, File S4: Annotation of BGC3 by antiSMASH, Table S1: S. pneumoniae and S. pyogenes adherence to HEp-2 cells determined by viable count.

Author Contributions

Conceptualization, M.S.; Methodology, G.V.A., A.S. (Ambra Spitale) and L.B.; Software, M.S. and G.F.P.; Validation, G.V.A. and A.S. (Ambra Spitale); Formal analysis, G.V.A., A.S. (Aldo Stivala) and L.B.; Data curation, M.S. and S.S.; Writing—original draft preparation, M.S., G.V.A. and A.S. (Ambra Spitale); Writing—review and editing, M.S., S.S. and G.V.A.; Supervision, M.S. and S.S.; Funding acquisition, M.S. and S.S. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Data Availability Statement

The S. salivarius 24SMBc genomic reads were deposited in the National Center for Biotechnology Information (NCBI) SRA database under SRR20769826, the BioProject accession number PRJNA865118.

Acknowledgments

This work was partially supported by “linea intervento 3 Open Access Piano PIACERI 2020–2022” from the University of Catania, Italy. We wish to thank the Scientific Bureau of the University of Catania for language support.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Dominguez-Bello, M.G.; Godoy-Vitorino, F.; Knight, R.; Blaser, M.J. Role of the microbiome in human development. Gut 2019, 68, 1108–1114. [Google Scholar] [CrossRef] [PubMed]
  2. Man, W.H.; de Steenhuijsen Piters, W.A.; Bogaert, D. The microbiota of the respiratory tract: Gatekeeper to respiratory health. Nat. Rev. Microbiol. 2017, 15, 259–270. [Google Scholar] [CrossRef] [PubMed]
  3. Zaman, S.B.; Hussain, M.A.; Nye, R.; Mehta, V.; Mamun, K.T.; Hossain, N. A Review on Antibiotic Resistance: Alarm Bells are Ringing. Cureus 2017, 9, e1403. [Google Scholar] [CrossRef] [PubMed]
  4. Berg, G.; Rybakova, D.; Fischer, D.; Cernava, T.; Vergès, M.C.; Charles, T.; Chen, X.; Cocolin, L.; Eversole, K.; Corral, G.H.; et al. Microbiome definition re-visited: Old concepts and new challenges. Microbiome 2020, 8, 103. [Google Scholar] [CrossRef]
  5. Respiratory Tract Infections—Antibiotic Prescribing: Prescribing of Antibiotics for Self-Limiting Respiratory Tract Infections in Adults and Children in Primary Care; National Institute for Health and Clinical Excellence (NICE): London, UK, July 2008.
  6. Barbieri, E.; Donà, D.; Cantarutti, A.; Lundin, R.; Scamarcia, A.; Corrao, G.; Cantarutti, L.; Giaquinto, C. Antibiotic prescriptions in acute otitis media and pharyngitis in Italian pediatric outpatients. Ital. J. Pediatr. 2019, 45, 103. [Google Scholar] [CrossRef] [PubMed]
  7. Morris, P.S. Upper respiratory tract infections (including otitis media). Pediatr. Clin. N. Am. 2009, 56, 101–117. [Google Scholar] [CrossRef] [PubMed]
  8. Ghosh, C.; Sarkar, P.; Issa, R.; Haldar, J. Alternatives to Conventional Antibiotics in the Era of Antimicrobial Resistance. Trends Microbiol. 2019, 27, 323–338. [Google Scholar] [CrossRef]
  9. Ciprandi, G.; La Mantia, I.; Damiani, V.; Passali, D. Local Bacteriotherapy—A promising preventive tool in recurrent respiratory infections. Expert. Rev. Clin. Immunol. 2020, 16, 1047–1052. [Google Scholar] [CrossRef] [PubMed]
  10. Marchisio, P.; Claut, L.; Rognoni, A.; Esposito, S.; Passali, D.; Bellussi, L.; Drago, L.; Pozzi, G.; Mannelli, S.; Schito, G.; et al. Differences in nasopharyngeal bacterial flora in children with nonsevere recurrent acute otitis media and chronic otitis media with effusion: Implications for management. Pediatr. Infect. Dis. J. 2003, 22, 262–268. [Google Scholar] [CrossRef] [PubMed]
  11. Wescombe, P.A.; Burton, J.P.; Cadieux, P.A.; Klesse, N.A.; Hyink, O.; Heng, N.C.; Chilcott, C.N.; Reid, G.; Tagg, J.R. Megaplasmids encode differing combinations of lantibiotics in Streptococcus salivarius. Antonie Van Leeuwenhoek 2006, 90, 269–280. [Google Scholar] [CrossRef] [PubMed]
  12. Marchisio, P.; Santagati, M.; Scillato, M.; Baggi, E.; Fattizzo, M.; Rosazza, C.; Stefani, S.; Esposito, S.; Principi, N. Streptococcus salivarius 24SMB administered by nasal spray for the prevention of acute otitis media in otitis-prone children. Eur. J. Clin. Microbiol. Infect. Dis. Off. Publ. Eur. Soc. Clin. Microbiol. 2015, 34, 2377–2383. [Google Scholar] [CrossRef]
  13. Cantarutti, A.; Rea, F.; Donà, D.; Cantarutti, L.; Passarella, A.; Scamarcia, A.; Lundin, R.; Damiani, V.; Giaquinto, C.; Corrao, G.; et al. Preventing recurrent acute otitis media with Streptococcus salivarius 24SMB and Streptococcus oralis 89a five months intermittent treatment: An observational prospective cohort study. Int. J. Pediatr. Otorhinolaryngol. 2020, 132, 109921. [Google Scholar] [CrossRef] [PubMed]
  14. Andaloro, C.; Santagati, M.; Stefani, S.; La Mantia, I. Bacteriotherapy with Streptococcus salivarius 24SMB and Streptococcus oralis 89a oral spray for children with recurrent streptococcal pharyngotonsillitis: A randomized placebo-controlled clinical study. Eur. Arch. Otorhinolaryngol. 2019, 276, 879–887. [Google Scholar] [CrossRef]
  15. Passali, D.; Passali, G.C.; Vesperini, E.; Cocca, S.; Visconti, I.C.; Ralli, M.; Bellussi, L.M. The efficacy and tolerability of Streptococcus salivarius 24SMB and Streptococcus oralis 89a administered as nasal spray in the treatment of recurrent upper respiratory tract infections in children. Eur. Rev. Med. Pharmacol. Sci. 2019, 23 (Suppl. S1), 67–72. [Google Scholar] [CrossRef]
  16. Manti, S.; Parisi, G.F.; Papale, M.; Licari, A.; Salpietro, C.; Miraglia Del Giudice, M.; Marseglia, G.L.; Leonardi, S. Bacteriotherapy with Streptococcus salivarius 24SMB and Streptococcus oralis 89a nasal spray for treatment of upper respiratory tract infections in children: A pilot study on short-term efficacy. Ital. J. Pediatr. 2020, 46, 42. [Google Scholar] [CrossRef] [PubMed]
  17. Bidossi, A.; De Grandi, R.; Toscano, M.; Bottagisio, M.; De Vecchi, E.; Gelardi, M.; Drago, L. Probiotics Streptococcus salivarius 24SMB and Streptococcus oralis 89a interfere with biofilm formation of pathogens of the upper respiratory tract. BMC Infect Dis. 2018, 18, 653. [Google Scholar] [CrossRef] [PubMed]
  18. Santagati, M.; Scillato, M.; Patanè, F.; Aiello, C.; Stefani, S. Bacteriocin-producing oral streptococci and inhibition of respiratory pathogens. FEMS Immunol. Med. Microbiol. 2012, 65, 23–31. [Google Scholar] [CrossRef]
  19. Santagati, M.; Scillato, M.; Stefani, S. Genetic organization of Streptococcus salivarius 24SMBc blp-like bacteriocin locus. Front. Biosci. (Schol. Ed.) 2018, 10, 238–247. [Google Scholar] [CrossRef] [PubMed][Green Version]
  20. Stubbendieck, R.M.; Zelasko, S.E.; Safdar, N.; Currie, C.R. Biogeography of Bacterial Communities and Specialized Metabolism in Human Aerodigestive Tract Microbiomes. Microbiol. Spectr. 2021, 9, e0166921. [Google Scholar] [CrossRef] [PubMed]
  21. Medema, M.H.; Kottmann, R.; Yilmaz, P.; Cummings, M.; Biggins, J.B.; Blin, K.; de Bruijn, I.; Chooi, Y.H.; Claesen, J.; Coates, R.C.; et al. Minimum Information about a Biosynthetic Gene cluster. Nat. Chem. Biol. 2015, 11, 625–631. [Google Scholar] [CrossRef]
  22. Tracanna, V.; de Jong, A.; Medema, M.H.; Kuipers, O.P. Mining prokaryotes for antimicrobial compounds: From diversity to function. FEMS Microbiol. Rev. 2017, 41, 417–429. [Google Scholar] [CrossRef] [PubMed]
  23. Santagati, M.; Spanu, T.; Scillato, M.; Santangelo, R.; Cavallaro, F.; Arena, V.; Castiglione, G.; Falcone, M.; Venditti, M.; Stefani, S. Rapidly fatal hemorrhagic pneumonia and group A Streptococcus serotype M1. Emerg. Infect. Dis. 2014, 20, 98–101. [Google Scholar] [CrossRef]
  24. Iannelli, F.; Santagati, M.; Santoro, F.; Oggioni, M.R.; Stefani, S.; Pozzi, G. Nucleotide sequence of conjugative prophage Φ1207.3 (formerly Tn1207.3) carrying the mef(A)/msr(D) genes for efflux resistance to macrolides in Streptococcus pyogenes. Front. Microbiol. 2014, 5, 687. [Google Scholar] [CrossRef]
  25. Ravi, R.K.; Walton, K.; Khosroheidari, M. MiSeq: A Next Generation Sequencing Platform for Genomic Analysis. Methods Mol. Biol. 2018, 1706, 223–232. [Google Scholar] [CrossRef] [PubMed]
  26. Bolger, A.M.; Lohse, M.; Usadel, B. Trimmomatic: A flexible trimmer for Illumina sequence data. Bioinformatics 2014, 30, 2114–2120. [Google Scholar] [CrossRef] [PubMed]
  27. Bankevich, A.; Nurk, S.; Antipov, D.; Gurevich, A.A.; Dvorkin, M.; Kulikov, A.S.; Lesin, V.M.; Nikolenko, S.I.; Pham, S.; Prjibelski, A.D.; et al. SPAdes: A new genome assembly algorithm and its applications to single-cell sequencing. J. Comput. Biol. 2012, 19, 455–477. [Google Scholar] [CrossRef]
  28. Seemann, T. Prokka: Rapid prokaryotic genome annotation. Bioinformatics 2014, 30, 2068–2069. [Google Scholar] [CrossRef]
  29. Lagesen, K.; Hallin, P.; Rødland, E.A.; Staerfeldt, H.H.; Rognes, T.; Ussery, D.W. RNAmmer: Consistent and rapid annotation of ribosomal RNA genes. Nucleic Acids Res. 2007, 35, 3100–3108. [Google Scholar] [CrossRef] [PubMed]
  30. Lowe, T.M.; Eddy, S.R. tRNAscan-SE: A program for improved detection of transfer RNA genes in genomic sequence. Nucleic Acids Res. 1997, 25, 955–964. [Google Scholar] [CrossRef] [PubMed]
  31. Aziz, R.K.; Bartels, D.; Best, A.A.; DeJongh, M.; Disz, T.; Edwards, R.A.; Formsma, K.; Gerdes, S.; Glass, E.M.; Kubal, M.; et al. The RAST Server: Rapid annotations using subsystems technology. BMC Genom. 2008, 9, 75. [Google Scholar] [CrossRef]
  32. Sachdeva, G.; Kumar, K.; Jain, P.; Ramachandran, S. SPAAN: A software program for prediction of adhesins and adhesin-like proteins using neural networks. Bioinformatics 2005, 21, 483–491. [Google Scholar] [CrossRef] [PubMed]
  33. Cosentino, S.; Voldby Larsen, M.; Møller Aarestrup, F.; Lund, O. PathogenFinder—Distinguishing friend from foe using bacterial whole genome sequence data. PLoS ONE 2013, 8, e77302. [Google Scholar] [CrossRef]
  34. Gupta, A.; Kapil, R.; Dhakan, D.B.; Sharma, V.K. MP3: A software tool for the prediction of pathogenic proteins in genomic and metagenomic data. PLoS ONE 2014, 9, e93907. [Google Scholar] [CrossRef]
  35. Blin, K.; Shaw, S.; Kloosterman, A.M.; Charlop-Powers, Z.; van Wezel, G.P.; Medema, M.H.; Weber, T. antiSMASH 6.0: Improving cluster detection and comparison capabilities. Nucleic Acids Res. 2021, 49, W29–W35. [Google Scholar] [CrossRef]
  36. van Heel, A.J.; de Jong, A.; Song, C.; Viel, J.H.; Kok, J.; Kuipers, O.P. BAGEL4: A user-friendly web server to thoroughly mine RiPPs and bacteriocins. Nucleic Acids Res. 2018, 46, W278–W281. [Google Scholar] [CrossRef]
  37. Scillato, M.; Spitale, A.; Mongelli, G.; Privitera, G.F.; Mangano, K.; Cianci, A.; Stefani, S.; Santagati, M. Antimicrobial properties of Lactobacillus cell-free supernatants against multidrug-resistant urogenital pathogens. Microbiologyopen 2021, 10, e1173. [Google Scholar] [CrossRef]
  38. Dunne, E.M.; Toh, Z.Q.; John, M.; Manning, J.; Satzke, C.; Licciardi, P. Investigating the effects of probiotics on pneumococcal colonization using an in vitro adherence assay. J. Vis. Exp. 2014, 28, 51069. [Google Scholar] [CrossRef]
  39. Kumar, P.; Nagarajan, A.; Uchil, P.D. Analysis of Cell Viability by the Lactate Dehydrogenase Assay. Cold Spring Harb. Protoc. 2018, 2018, pdb-prot095497. [Google Scholar] [CrossRef]
  40. Chaffanel, F.; Charron-Bourgoin, F.; Soligot, C.; Kebouchi, M.; Bertin, S.; Payot, S.; Le Roux, Y.; Leblond-Bourget, N. Surface proteins involved in the adhesion of Streptococcus salivarius to human intestinal epithelial cells. Appl. Microbiol. Biotechnol. 2018, 102, 2851–2865. [Google Scholar] [CrossRef]
  41. Dawid, S.; Roche, A.M.; Weiser, J.N. The blp bacteriocins of Streptococcus pneumoniae mediate intraspecies competition both in vitro and in vivo. Infect Immun. 2007, 75, 443–451. [Google Scholar] [CrossRef]
  42. Kawasaki, T.; Hayashi, Y.; Kuzuyama, T.; Furihata, K.; Itoh, N.; Seto, H.; Dairi, T. Biosynthesis of a natural polyketide-isoprenoid hybrid compound, furaquinocin A: Identification and heterologous expression of the gene cluster. J. Bacteriol. 2006, 188, 1236–1244. [Google Scholar] [CrossRef] [PubMed]
  43. Shimizu, Y.; Ogata, H.; Goto, S. Type III Polyketide Synthases: Functional Classification and Phylogenomics. Chembiochem 2017, 18, 50–65. [Google Scholar] [CrossRef] [PubMed]
  44. Calderone, C.T. Isoprenoid-like alkylations in polyketide biosynthesis. Nat. Prod. Rep. 2008, 25, 845–853. [Google Scholar] [CrossRef]
  45. Löfling, J.; Vimberg, V.; Battig, P.; Henriques-Normark, B. Cellular interactions by LPxTG-anchored pneumococcal adhesins and their streptococcal homologues. Cell Microbiol. 2011, 13, 186–197. [Google Scholar] [CrossRef] [PubMed]
  46. Nobbs, A.H.; Lamont, R.J.; Jenkinson, H.F. Streptococcus adherence and colonization. Microbiol. Mol. Biol. Rev. 2009, 73, 407–450. [Google Scholar] [CrossRef]
  47. Couvigny, B.; Lapaque, N.; Rigottier-Gois, L.; Guillot, A.; Chat, S.; Meylheuc, T.; Kulakauskas, S.; Rohde, M.; Mistou, M.Y.; Renault, P.; et al. Three glycosylated serine-rich repeat proteins play a pivotal role in adhesion and colonization of the pioneer commensal bacterium, Streptococcus salivarius. Environ. Microbiol. 2017, 19, 3579–3594. [Google Scholar] [CrossRef] [PubMed]
  48. Foster, T.J. The MSCRAMM Family of Cell-Wall-Anchored Surface Proteins of Gram-Positive Cocci. Trends Microbiol. 2019, 27, 927–941. [Google Scholar] [CrossRef]
  49. Zhu, M.; Ajdić, D.; Liu, Y.; Lynch, D.; Merritt, J.; Banas, J.A. Role of the Streptococcus mutans irvA gene in GbpC-independent, dextran-dependent aggregation and biofilm formation. Appl. Environ. Microbiol. 2009, 75, 7037–7043. [Google Scholar] [CrossRef]
  50. Couvigny, B.; Kulakauskas, S.; Pons, N.; Quinquis, B.; Abraham, A.L.; Meylheuc, T.; Delorme, C.; Renault, P.; Briandet, R.; Lapaque, N.; et al. Identification of New Factors Modulating Adhesion Abilities of the Pioneer Commensal Bacterium Streptococcus salivarius. Front. Microbiol. 2018, 9, 273. [Google Scholar] [CrossRef]
  51. Monteagudo-Mera, A.; Rastall, R.A.; Gibson, G.R.; Charalampopoulos, D.; Chatzifragkou, A. Adhesion mechanisms mediated by probiotics and prebiotics and their potential impact on human health. Appl. Microbiol. Biotechnol. 2019, 103, 6463–6472. [Google Scholar] [CrossRef]
Figure 1. Subsystem category distribution of Streptococcus salivarius 24SMBc revealed by genome annotations based on the RAST server. Each color represents a subsystem category with the feature counts listed on the right.
Figure 1. Subsystem category distribution of Streptococcus salivarius 24SMBc revealed by genome annotations based on the RAST server. Each color represents a subsystem category with the feature counts listed on the right.
Microorganisms 10 02042 g001
Figure 2. Genetic arrangement of the blp locus in S. salivarius 24SMBc produced with the BAGEL4 tool. Interestingly, the presence of the other blpK bacteriocin is to the right of the blp cassette carrying blpU.
Figure 2. Genetic arrangement of the blp locus in S. salivarius 24SMBc produced with the BAGEL4 tool. Interestingly, the presence of the other blpK bacteriocin is to the right of the blp cassette carrying blpU.
Microorganisms 10 02042 g002
Figure 3. Antagonistic effect of S. salivarius 24SMBc against streptococcal pathogens. (A) Adherence percentage of S. pneumoniae BT (S. pn BT), S. pneumoniae C2 (S. pn C2), S. pneumoniae A3 (S. pn A3), and S. pneumoniae M4 (S. pn M4) normalized to S. pneumoniae alone (S. pn). (B) Adherence percentage of S. pyogenes Spy3537 (S. py 35370), S. pyogenes 2812A (S. py 2812A), and S. pyogenes MGAS 5005 (S. py 5005), normalized to S. pyogenes alone (S. py). Statistically significant p value: * p < 0.05, ** p < 0.01, and *** p < 0.001.
Figure 3. Antagonistic effect of S. salivarius 24SMBc against streptococcal pathogens. (A) Adherence percentage of S. pneumoniae BT (S. pn BT), S. pneumoniae C2 (S. pn C2), S. pneumoniae A3 (S. pn A3), and S. pneumoniae M4 (S. pn M4) normalized to S. pneumoniae alone (S. pn). (B) Adherence percentage of S. pyogenes Spy3537 (S. py 35370), S. pyogenes 2812A (S. py 2812A), and S. pyogenes MGAS 5005 (S. py 5005), normalized to S. pyogenes alone (S. py). Statistically significant p value: * p < 0.05, ** p < 0.01, and *** p < 0.001.
Microorganisms 10 02042 g003
Figure 4. Levels of LDH release to evaluate the cytotoxic effect with S. salivarius 24SMBc. HEp-2 alone as 0% LDH release, HEp-2 plus S. salivarius 24SMBc, and HEp-2 cells plus Triton X-100 as a control of total release (100% LDH release). Statistically significant p value: *** p < 0.001.
Figure 4. Levels of LDH release to evaluate the cytotoxic effect with S. salivarius 24SMBc. HEp-2 alone as 0% LDH release, HEp-2 plus S. salivarius 24SMBc, and HEp-2 cells plus Triton X-100 as a control of total release (100% LDH release). Statistically significant p value: *** p < 0.001.
Microorganisms 10 02042 g004
Figure 5. Auto-aggregation and co-aggregation tests. Values of auto-aggregation in blue and co-aggregation in red showed the behavior of each strain when in the presence of S. salivarius 24SMBc. Statistically significant p value: *** p < 0.001.
Figure 5. Auto-aggregation and co-aggregation tests. Values of auto-aggregation in blue and co-aggregation in red showed the behavior of each strain when in the presence of S. salivarius 24SMBc. Statistically significant p value: *** p < 0.001.
Microorganisms 10 02042 g005
Table 1. Main features of the Streptococcus salivarius 24SMBc genome. N50 (value to assess the contiguity of assembly, by the length of the shortest contig at 50% of the total size of the assembly); L50 (the number of contigs at 50% of the total size of the assembly); CDS (coding sequence).
Table 1. Main features of the Streptococcus salivarius 24SMBc genome. N50 (value to assess the contiguity of assembly, by the length of the shortest contig at 50% of the total size of the assembly); L50 (the number of contigs at 50% of the total size of the assembly); CDS (coding sequence).
Genomic Features
Size (bp)2,131,204
G + C content (%)39.85
N50 length (bp)171,173
L505
No. of contigs32
Number of Subsystems217
CDS1.933
rRNA6
tRNA44
Table 2. Bacteriocins detected in the S. salivarius 24SMBc genome: property, amino acid sequence, and their localization in the genome.
Table 2. Bacteriocins detected in the S. salivarius 24SMBc genome: property, amino acid sequence, and their localization in the genome.
BacteriocinPropertyAmino Acid SequencesCDSGenome
Locus Tag
blpU-likeClass IIc bacteriocin with double-glycine leader peptide (PF10439)MTTQTMNNFETLDLEALANVEGGGWVKCYAGTIGSALVGSAGGPVGYWGGALVGYATFCContig_24_87554_87375LFGOLEEL_01643
blpK-likeClass IIc bacteriocin with double-glycine leader peptide (PF10439)MTTQIINNFNSLNSEDLSIIEGGGVIGCVAGTAGSAGLGFLTGTSVGTVTFPIVGTVSGGAFGAContig_24_96179_95985LFGOLEEL_01651
bact_IIb_cerein familyClass IIb bacteriocin,
lactobin A/cerein 7B family (TIGR03949)
MTNKERNTSDLASVTGGGWKTNLAVGGLCLASGPIGTMICLGAYNGYMDSARContig_26_37678_37836LFGOLEEL_01810
bact_IIb_cerein familyClass IIb bacteriocin,
lactobin A/cerein 7B family (TIGR03949)
MTKTINNRKHMTTQELEAVSGGVVPWAAISVGMAAAKLTYDLSYAAGKSFYNLTHContig_26_37857_38024LFGOLEEL_01811
Table 3. Putative proteins involved in the aggregation and adhesion of S. salivarius 24SMBc.
Table 3. Putative proteins involved in the aggregation and adhesion of S. salivarius 24SMBc.
Genome
Locus Tag
Protein/
Domain
PropertyPutative Function
LFGOLEEL_00404GbpC superfamilyStreptococcus glucan-binding protein C (PF08363)Adhesion, dextran-induced aggregation
Streccoc_I_IIAntigen I/II family LPXTG-anchored adhesin (NF033804)Adhesion, aggregation
LFGOLEEL_00415GBS Bsp-likeGBS Bsp-like repeat (PF08481)Adhesion
SH3_5SH3 domain-containing protein (PF08460)Adhesion, aggregation
LFGOLEEL_00538Collagen_binding domainCollagen_bind (PF05737)Adhesion, colonization
FctAFctA family (PF12892)Adhesion, colonization
LFGOLEEL_00802Agg_substance superfamilyLPXTG-anchored aggregation substance (NF033875)Aggregation
LFGOLEEL_00836CshA_NR2Surface adhesin CshA non-repetitive domain 2 (PF18651)Adhesion, aggregation
CshA_repeatSurface adhesin CshA repetitive domain (PF19076)Adhesion
CshA_fibril_rptCshA-type fibril repeat (TIGR04225)Adhesion
SSSPR-51SSSPR-51 domain (PF18877)Adhesion
LFGOLEEL_00906Streccoc_I_IIAntigen I/II family LPXTG-anchored adhesion (NF033804)Adhesion, aggregation
LPXTG anchorLPXTG-motif cell wall anchor domain (TIGR01167)Adhesion
LFGOLEEL_00907GbpC superfamilyStreptococcus glucan-binding protein C (PF08363)Adhesion, dextran-induced aggregation
ProTailRpt superfamilyProline-rich tail region repeat (TIGR04307)Adhesion
LFGOLEEL_01308MucBP_2Mucin binding domain (PF17965)Mucin adhesion
Mub_B2Mub B2-like domain (PF17966)Mucin adhesion
LFGOLEEL_01314MucBP_2Mucin binding domain (PF17965)Mucin adhesion
Mub_B2Mub B2-like domain (PF17966)Mucin adhesion
LFGOLEEL_01317MSCRAMM_ClfAMSCRAMM family adhesin clumping factor ClfA (NF033609)Adhesion
LFGOLEEL_01318MSCRAMM_SdrDMSCRAMM family adhesin SdrD (NF012181)Adhesion
aRibAtypical Rib domain (PF18938)Adhesion
LFGOLEEL_01320MSCRAMM_SdrCMSCRAMM family adhesin SdrC (NF000535)Adhesion, aggregation
MSCRAMM_SdrDMSCRAMM family adhesin SdrD (NF012181)Adhesion
MSCRAMM_ClfBMSCRAMM family adhesin clumping factor ClfB (NF033845)Adhesion, colonization
LFGOLEEL_01321Agg_substance super familyLPXTG-anchored aggregation substance (NF033875)Aggregation
LFGOLEEL_01338MucBP_2Mucin binding domain (PF17965)Mucin adhesion
Adhesin_LEA super familyLEA family epithelial adhesin N-terminal domain (NF033647)Adhesion
LFGOLEEL_01344AgI_II_C2Cell surface antigen I/II C2 terminal domain (PF17998)Adhesion, aggregation
Agg_substance super familyLPXTG-anchored aggregation substance (NF033875))Aggregation
FctASpy0128-like isopeptide containing domain (PF12892)Adhesion
LFGOLEEL_01933DUF4097 superfamilyPutative adhesin (cl23960)Adhesion
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Vertillo Aluisio, G.; Spitale, A.; Bonifacio, L.; Privitera, G.F.; Stivala, A.; Stefani, S.; Santagati, M. Streptococcus salivarius 24SMBc Genome Analysis Reveals New Biosynthetic Gene Clusters Involved in Antimicrobial Effects on Streptococcus pneumoniae and Streptococcus pyogenes. Microorganisms 2022, 10, 2042. https://doi.org/10.3390/microorganisms10102042

AMA Style

Vertillo Aluisio G, Spitale A, Bonifacio L, Privitera GF, Stivala A, Stefani S, Santagati M. Streptococcus salivarius 24SMBc Genome Analysis Reveals New Biosynthetic Gene Clusters Involved in Antimicrobial Effects on Streptococcus pneumoniae and Streptococcus pyogenes. Microorganisms. 2022; 10(10):2042. https://doi.org/10.3390/microorganisms10102042

Chicago/Turabian Style

Vertillo Aluisio, Gaia, Ambra Spitale, Luca Bonifacio, Grete Francesca Privitera, Aldo Stivala, Stefania Stefani, and Maria Santagati. 2022. "Streptococcus salivarius 24SMBc Genome Analysis Reveals New Biosynthetic Gene Clusters Involved in Antimicrobial Effects on Streptococcus pneumoniae and Streptococcus pyogenes" Microorganisms 10, no. 10: 2042. https://doi.org/10.3390/microorganisms10102042

APA Style

Vertillo Aluisio, G., Spitale, A., Bonifacio, L., Privitera, G. F., Stivala, A., Stefani, S., & Santagati, M. (2022). Streptococcus salivarius 24SMBc Genome Analysis Reveals New Biosynthetic Gene Clusters Involved in Antimicrobial Effects on Streptococcus pneumoniae and Streptococcus pyogenes. Microorganisms, 10(10), 2042. https://doi.org/10.3390/microorganisms10102042

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop