Crotoxin B: Heterologous Expression, Protein Folding, Immunogenic Properties, and Irregular Presence in Crotalid Venoms
Abstract
:1. Introduction
2. Results and Discussion
2.1. cDNA Isolation, Sequence Determination, and Cloning of Crotoxin B from Crotalus Tzabcan
2.2. Expression, Purification, and Protein Folding of HisrCrotoxin B
2.3. Evidence of Similar Structure between Native Crotoxin B and HisrCrotoxin B
2.4. Rabbit Immunization, Antibody Recognition, Antibody Titers, and Inhibition of Phospholipase Activity
2.5. Neutralization Activity
2.6. Irregular Presence of Crotoxin B in Crotalid Venoms
3. Conclusions
4. Materials and Methods
4.1. Venom and Venom Gland
4.2. Bacterial Strains, Enzymes, and Plasmids
4.3. RNA Extraction and Gene Assembly
4.4. Plasmid Construction for Expression
4.5. Expression and Purification of HisrCrotoxin B
4.6. Molecular Mass Determination of HisrCrotoxin B, Native Crotoxin B, and Peptides from the Enzymatic Digestions
4.7. Enzymatic Digestions of HisrCrotoxin B and Native Crotoxin B
4.8. Circular Dichroism
4.9. Electrophoretic Analysis and Western Blotting
4.10. Animal Immunizations
4.11. Enzyme-Linked Immunosorbent Assay (ELISA)
4.12. Phospholipase Activity
4.13. Neutralization Activity
4.14. Statistics
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Acknowledgments
Conflicts of Interest
References
- Doley, R.; Kini, R.M. Protein complexes in snake venom. Cell Mol. Life Sci. 2009, 66, 2851–2871. [Google Scholar]
- Fernandes, C.A.; Pazin, W.M.; Dreyer, T.R.; Bicev, R.N.; Cavalcante, W.L.; Fortes-Dias, C.L.; Ito, A.S.; Oliveira, C.L.; Fernandez, R.M.; Fontes, M.R. Biophysical studies suggest a new structural arrangement of crotoxin and provide insights into its toxic mechanism. Sci. Rep. 2017, 7, 43885. [Google Scholar] [CrossRef] [Green Version]
- Faure, G.; Porowinska, D.; Saul, F. Crotoxin from Crotalus durissus terrificus and Crotoxin-Related Proteins: Structure and Function Relationship. In Toxins and Drug Discovery; Cruz, L.J., Luo, S., Gopalakrishnakone, P., Eds.; Springer: Dordrecht, The Netherlands, 2017; pp. 3–20. [Google Scholar] [CrossRef]
- Rangel-Santos, A.; Dos-Santos, E.C.; Lopes-Ferreira, M.; Lima, C.; Cardoso, D.F.; Mota, I. A comparative study of biological activities of crotoxin and CB fraction of venoms from Crotalus durissus terrificus, Crotalus durissus cascavella and Crotalus durissus collilineatus. Toxicon 2004, 43, 801–810. [Google Scholar] [CrossRef]
- Boda, F.-A.; Pál, S.; Orbán, C.; Berta, L.; Curticăpean, A.; Gâz, Ș.-A.; Dogaru, M. Heterologous Expression and Purification of Recombinant Crotoxin B, the Phospholipase A2 Subunit of Crotoxin. Studia UBB Chem. 2018, 1, 7–20. [Google Scholar] [CrossRef]
- De Paula, R.C.; Castro, H.C.; Rodrigues, C.R.; Melo, P.A.; Fuly, A.L. Structural and pharmacological features of phospholipases A2 from snake venoms. Protein Pept. Lett. 2009, 16, 899–907. [Google Scholar] [CrossRef]
- Faure, G.; Choumet, V.; Bouchier, C.; Camoin, L.; Guillaume, J.L.; Monegier, B.; Vuilhorgne, M.; Bon, C. The origin of the diversity of crotoxin isoforms in the venom of Crotalus durissus terrificus. Eur. J. Biochem 1994, 223, 161–164. [Google Scholar] [CrossRef]
- Neri-Castro, E.; Lomonte, B.; Valdés, M.; Ponce-López, R.; Bénard-Valle, M.; Borja, M.; Strickland, J.L.; Jones, J.M.; Grünwald, C.; Zamudio, F.; et al. Venom characterization of the three species of Ophryacus and proteomic profiling of O. sphenophrys unveils Sphenotoxin, a novel Crotoxin-like heterodimeric β-neurotoxin. J. Proteom. 2019, 192, 196–207. [Google Scholar] [CrossRef]
- Segura, Á.; Herrera, M.; Reta Mares, F.; Jaime, C.; Sánchez, A.; Vargas, M.; Villalta, M.; Gómez, A.; Gutiérrez, J.M.; León, G. Proteomic, toxicological and immunogenic characterization of Mexican west-coast rattlesnake (Crotalus basiliscus) venom and its immunological relatedness with the venom of Central American rattlesnake (Crotalus simus). J. Proteom. 2017, 158, 62–72. [Google Scholar] [CrossRef]
- Molina Molina, D.A.; Guerra-Duarte, C.; Costal-Oliveira, F.; Almeida Rocha, E.; Rego Rodrigues, C.; Machado-de-Ávila, R.A.; Soccol, V.T.; Chávez-Olórtegui, C. Engineered protein containing crotoxin epitopes induces neutralizing antibodies in immunized rabbits. Mol. Immunol. 2020, 119, 144–153. [Google Scholar] [CrossRef]
- Kaiser, I.I.; Middlebrook, J.L.; Crumrine, M.H.; Stevenson, W.W. Cross-reactivity and neutralization by rabbit antisera raised against crotoxin, its subunits and two related toxins. Toxicon 1986, 24, 669–678. [Google Scholar] [CrossRef]
- Beghini, D.G.; da Cruz-Höfling, M.A.; Randazzo-Moura, P.; Rodrigues-Simioni, L.; Novello, J.C.; Hyslop, S.; Marangoni, S. Cross-neutralization of the neurotoxicity of Crotalus durissus terrificus and Bothrops jararacussu venoms by antisera against crotoxin and phospholipase A2 from Crotalus durissus cascavella venom. Toxicon 2005, 46, 604–611. [Google Scholar] [CrossRef]
- Oshima-Franco, Y.; Hyslop, S.; Prado-Franceschi, J.; Cruz-Höfling, M.A.; Rodrigues-Simioni, L. Neutralizing capacity of antisera raised in horses and rabbits against Crotalus durissus terrificus (South American rattlesnake) venom and its main toxin, crotoxin. Toxicon 1999, 37, 1341–1357. [Google Scholar] [CrossRef]
- Fusco, L.S.; Rodriguez, J.P.; Teibler, P.; Marunak, S.; Acosta, O.; Leiva, L. New immunization protocol to produce crotalic antivenom combining Crotalus durissus terrificus venom and its PLA2. Biologicals 2015, 43, 62–70. [Google Scholar] [CrossRef]
- Clement, H.; Corrales-Garcia, L.L.; Bolanos, D.; Corzo, G.; Villegas, E. Immunogenic Properties of Recombinant Enzymes from Bothrops ammodytoides Towards the Generation of Neutralizing Antibodies against Its Own Venom. Toxins 2019, 11, 702. [Google Scholar] [CrossRef] [Green Version]
- de la Rosa, G.; Olvera, F.; Archundia, I.G.; Lomonte, B.; Alagon, A.; Corzo, G. Horse immunization with short-chain consensus alpha-neurotoxin generates antibodies against broad spectrum of elapid venomous species. Nat. Commun. 2019, 10, 3642. [Google Scholar] [CrossRef] [Green Version]
- Carbajal-Márquez, R.A.; Cedeño-Vázquez, J.R.; Martins, M.; Köhler, G. Life history, activity pattern and morphology of Crotalus tzabcan (Serpentes: Viperidae). Herpetol. Conserv. Biol. 2020, 15, 228–237. [Google Scholar]
- de Roodt, A.R.; Dolab, J.A.; Hajos, S.E.; Gould, E.; Dinapoli, H.; Troiano, J.C.; Gould, J.; Dokmetjian, J.C.; Carfagnini, J.C.; Fernandez, T.; et al. Some toxic and enzymatic activities of Bothrops ammodytoides (yarara nata) venom. Toxicon 2000, 38, 49–61. [Google Scholar] [CrossRef]
- Gutierrez, J.M.; Lomonte, B. Phospholipases A2: Unveiling the secrets of a functionally versatile group of snake venom toxins. Toxicon 2013, 62, 27–39. [Google Scholar] [CrossRef]
- Fonseca, R.G.; Ferreira, T.L.; Ward, R.J. Refolding and purification of the human secreted group IID phospholipase A2 expressed as inclusion bodies in Escherichia coli. Protein Expr. Purif. 2009, 67, 82–87. [Google Scholar] [CrossRef]
- Scanu, A.M.; van Deenen, L.L.; de Haas, G.H. Optical rotatory dispersion and circular dichroism of phospholipase A2 and its zymogen from porcine pancreas. Biochim. Biophys. Acta 1969, 181, 471–473. [Google Scholar] [CrossRef] [Green Version]
- Aird, S.D.; Steadman, B.L.; Middaugh, C.R.; Kaiser, I.I. Comparative spectroscopic studies of four crotoxin homologs and their subunits. Biochim. Biophys. Acta 1989, 997, 211–218. [Google Scholar] [CrossRef]
- Nemecz, D.; Ostrowski, M.; Ravatin, M.; Saul, F.; Faure, G. Crystal Structure of Isoform CBd of the Basic Phospholipase A2 Subunit of Crotoxin: Description of the Structural Framework of CB for Interaction with Protein Targets. Molecules 2020, 25, 5290. [Google Scholar] [CrossRef]
- Marchi-Salvador, D.P.; Correa, L.C.; Salvador, G.H.; Magro, A.J.; Oliveira, C.Z.; Iulek, J.; Soares, A.M.; Fontes, M.R. Preliminary X-ray crystallographic studies of a tetrameric phospholipase A2 formed by two isoforms of crotoxin B from Crotalus durissus terrificus venom. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2007, 63, 1067–1069. [Google Scholar] [CrossRef] [Green Version]
- Salvador, G.H.; Fernandes, C.A.; Correa, L.C.; Santos-Filho, N.A.; Soares, A.M.; Fontes, M.R. Crystallization and preliminary X-ray diffraction analysis of crotoxin B from Crotalus durissus collilineatus venom. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2009, 65, 1011–1013. [Google Scholar] [CrossRef] [Green Version]
- Grabner, A.N.; Alfonso, J.; Kayano, A.M.; Moreira-Dill, L.S.; Dos Santos, A.P.A.; Caldeira, C.A.S.; Sobrinho, J.C.; Gomez, A.; Grabner, F.P.; Cardoso, F.F.; et al. BmajPLA2-II, a basic Lys49-phospholipase A2 homologue from Bothrops marajoensis snake venom with parasiticidal potential. Int. J. Biol. Macromol. 2017, 102, 571–581. [Google Scholar] [CrossRef] [Green Version]
- Estrada, G.; Garcia, B.I.; Schiavon, E.; Ortiz, E.; Cestele, S.; Wanke, E.; Possani, L.D.; Corzo, G. Four disulfide-bridged scorpion beta neurotoxin CssII: Heterologous expression and proper folding in vitro. Biochim. Biophys. Acta 2007, 1770, 1161–1168. [Google Scholar] [CrossRef] [Green Version]
- Neri-Castro, E.; Hernandez-Davila, A.; Olvera-Rodriguez, A.; Cardoso-Torres, H.; Benard-Valle, M.; Bastiaans, E.; Lopez-Gutierrez, O.; Alagon, A. Detection and quantification of a beta-neurotoxin (crotoxin homologs) in the venom of the rattlesnakes Crotalus simus, C. culminatus and C. tzabcan from Mexico. Toxicon X 2019, 2, 100007. [Google Scholar] [CrossRef]
- Borja, M.; Neri-Castro, E.; Castaneda-Gaytan, G.; Strickland, J.L.; Parkinson, C.L.; Castaneda-Gaytan, J.; Ponce-Lopez, R.; Lomonte, B.; Olvera-Rodriguez, A.; Alagon, A.; et al. Biological and Proteolytic Variation in the Venom of Crotalus scutulatus scutulatus from Mexico. Toxins 2018, 10, 35. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Borja, M.; Neri-Castro, E.; Perez-Morales, R.; Strickland, J.L.; Ponce-Lopez, R.; Parkinson, C.L.; Espinosa-Fematt, J.; Saenz-Mata, J.; Flores-Martinez, E.; Alagon, A.; et al. Ontogenetic Change in the Venom of Mexican Black-Tailed Rattlesnakes (Crotalus molossus nigrescens). Toxins 2018, 10, 501. [Google Scholar] [CrossRef] [Green Version]
- Colis-Torres, A.; Neri-Castro, E.; Strickland, J.L.; Olvera-Rodriguez, A.; Borja, M.; Calvete, J.; Jones, J.; Parkinson, C.L.; Banuelos, J.; Lopez de Leon, J.; et al. Intraspecific venom variation of Mexican West Coast Rattlesnakes (Crotalus basiliscus) and its implications for antivenom production. Biochimie 2022, 192, 111–124. [Google Scholar] [CrossRef]
- Gutiérrez, J.M.; Solano, G.; Pla, D.; Herrera, M.; Segura, Á.; Vargas, M.; Villalta, M.; Sánchez, A.; Sanz, L.; Lomonte, B.; et al. Preclinical Evaluation of the Efficacy of Antivenoms for Snakebite Envenoming: State-of-the-Art and Challenges Ahead. Toxins 2017, 9, 163. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Espino-Solis, G.P.; Riano-Umbarila, L.; Becerril, B.; Possani, L.D. Antidotes against venomous animals: State of the art and prospectives. J. Proteom. 2009, 72, 183–199. [Google Scholar] [CrossRef] [PubMed]
- Alvarenga, L.M.; Zahid, M.; di Tommaso, A.; Juste, M.O.; Aubrey, N.; Billiald, P.; Muzard, J. Engineering venom’s toxin-neutralizing antibody fragments and its therapeutic potential. Toxins 2014, 6, 2541–2567. [Google Scholar] [CrossRef] [PubMed]
- Clement, H.; Costa de Oliveira, V.; Zamudio, F.Z.; Lago, N.R.; Valdez-Cruz, N.A.; Bernard Valle, M.; Hajos, S.E.; Alagon, A.; Possani, L.D.; de Roodt, A.R. Isolation, amino acid sequence and biological characterization of an “aspartic-49” phospholipase A(2) from Bothrops (Rhinocerophis) ammodytoides venom. Toxicon 2012, 60, 1314–1323. [Google Scholar] [CrossRef] [PubMed]
- Bernheimer, A.W.; Linder, R.; Weinstein, S.A.; Kim, K.S. Isolation and characterization of a phospholipase B from venom of Collett’s snake, Pseudechis colletti. Toxicon 1987, 25, 547–554. [Google Scholar] [CrossRef]
- Sales, T.A.; Marcussi, S.; da Cunha, E.F.F.; Kuca, K.; Ramalho, T.C. Can Inhibitors of Snake Venom Phospholipases A(2) Lead to New Insights into Anti-Inflammatory Therapy in Humans? A Theoretical Study. Toxins 2017, 9, 341. [Google Scholar] [CrossRef] [Green Version]
- Micsonai, A.; Wien, F.; Bulyaki, E.; Kun, J.; Moussong, E.; Lee, Y.H.; Goto, Y.; Refregiers, M.; Kardos, J. BeStSel: A web server for accurate protein secondary structure prediction and fold recognition from the circular dichroism spectra. Nucleic Acids Res. 2018, 46, W315–W322. [Google Scholar] [CrossRef]
- Laemmli, U.K. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 1970, 227, 680–685. [Google Scholar] [CrossRef]
Protein | Amino Acid Sequence * | ID (%) |
---|---|---|
1--------10--------20--------30--------40-------50---------61 | ||
Crotoxin B | HLLQFNKMIKFETRKNAIPFYAFYGCYCGWGGRGRPKDATDRCCFVHDCCYGKLAKCNTKW | 100 |
HisrCrotoxin B | HLLQFNKMIKFETRKNAIPFYAFYGCYCGWGGRGQPKDATDRCCFVHDCCYGKLAKCNTKW | 99 |
**********************************:************************** | ||
62------70--------80--------90-------100------110---------122 | ||
Crotoxin B | DIYPYSLKSGYITCGKGTWCEEQICECDRVAAECLRRSLSTYKYGYMFYPDSRCRGPSETC | 100 |
HisrCrotoxin B | DIYPYSLKSGYITCGKGTWCEEQICECDRVAAECLRRSLSTYKYGYMFYPDSRCRGPSETC | 99 |
************************************************************* |
Protein/Venom | IC50 (µg/mL) | CI * |
---|---|---|
Native Crotoxin B | 0.1 | 0.09–0.14 |
C. tigris | 0.3 | 0.28–0.38 |
C. s. salvini | 7.6 | 6.2–9.6 |
C. mictlantecuhtli | 12.3 | 10.9–13.9 |
C. s. scutulatus | 23.2 | 19.5–28.9 |
M. melanurum | 29.1 | 25.0–35.4 |
C. basiliscus | 70.2 | 42.2–165.5 |
C. tzabcan | 910.4 | 265–4451 |
O. smaragdinus | >4000 | nd |
C. m. nigrescens | >4000 | nd |
C. atrox | >4000 | nd |
Venom/Toxin | LD50 µg/mouse | ED50 mg/3LD50 | Crotoxin B (%) | Potency (µg venom/mg AV) |
---|---|---|---|---|
Native Crotoxin B | 6.7 | 1.5 | 100 | 13.4 |
C. s. salvini | 4.7 | 14.0 | 8.9 | 1.0 |
C. tzabcan | 19 | 1.5 | 7.7 | 38.0 |
C. mictlantecuhtli | 4 | 2.1 | 10.3 | 5.7 |
C. m. nigrecens | 59.2 | >15 | 0 | - |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Mejía-Sánchez, M.A.; Clement, H.; Corrales-García, L.L.; Olamendi-Portugal, T.; Carbajal, A.; Corzo, G. Crotoxin B: Heterologous Expression, Protein Folding, Immunogenic Properties, and Irregular Presence in Crotalid Venoms. Toxins 2022, 14, 382. https://doi.org/10.3390/toxins14060382
Mejía-Sánchez MA, Clement H, Corrales-García LL, Olamendi-Portugal T, Carbajal A, Corzo G. Crotoxin B: Heterologous Expression, Protein Folding, Immunogenic Properties, and Irregular Presence in Crotalid Venoms. Toxins. 2022; 14(6):382. https://doi.org/10.3390/toxins14060382
Chicago/Turabian StyleMejía-Sánchez, Miguel Angel, Herlinda Clement, Ligia Luz Corrales-García, Timoteo Olamendi-Portugal, Alejandro Carbajal, and Gerardo Corzo. 2022. "Crotoxin B: Heterologous Expression, Protein Folding, Immunogenic Properties, and Irregular Presence in Crotalid Venoms" Toxins 14, no. 6: 382. https://doi.org/10.3390/toxins14060382
APA StyleMejía-Sánchez, M. A., Clement, H., Corrales-García, L. L., Olamendi-Portugal, T., Carbajal, A., & Corzo, G. (2022). Crotoxin B: Heterologous Expression, Protein Folding, Immunogenic Properties, and Irregular Presence in Crotalid Venoms. Toxins, 14(6), 382. https://doi.org/10.3390/toxins14060382