Enhancing the Antimicrobial Properties of Peptides through Cell-Penetrating Peptide Conjugation: A Comprehensive Assessment
Abstract
:1. Introduction
2. Results
2.1. Design, Construction, Synthesis, and Checking
2.2. Results of the Amyloidogenicity Prediction of Antimicrobial Peptides
2.3. Thioflavin T Assay
2.4. Antibacterial Activity of Peptides R23IT and V31KT against Gram-Negative and Gram-Positive Bacteria in Liquid Medium
2.5. Antibacterial Activity of Peptides R23LP, V31KP, and R44KP against Gram-Positive and Gram-Negative Bacteria in Liquid Medium
2.6. Peptides’ Antibacterial Activity against S. aureus, MRSA, P. aeruginosa, and E. coli
2.7. Effect of R23IT Peptide on Membrane Ionic Permeability
2.8. Toxicity of V31KT, I31KP, and R44KP against Eukaryotic Cells
3. Discussion
4. Materials and Methods
4.1. Design and Synthesis of Hybrid Peptides with Cell-Penetrating Peptides and Amyloidogenic Regions
4.2. Prediction of Amyloidogenicity of Antimicrobial Peptides
4.3. Thioflavin T Fluorescence Measurement
4.4. Strains of Microorganisms
4.5. Measurement of the Antibacterial Activity of Peptides against S. aureus, MRSA, and P. aeruginosa in Liquid Medium
4.6. Electrophysiological Assay
4.7. Determination of Toxicity of Peptides against Eukaryotic Cells
4.8. Statistical Analysis
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
Abbreviations
AMP | antimicrobial peptide |
CPP | cell-penetrating peptide |
MRSA | methicillin-resistant Staphylococcus aureus |
ThT | thioflavin T |
References
- Li, T.; Wang, Z.; Guo, J.; de la Fuente-Nunez, C.; Wang, J.; Han, B.; Tao, H.; Liu, J.; Wang, X. Bacterial resistance to antibacterial agents: Mechanisms, control strategies, and implications for global health. Sci. Total Environ. 2023, 860, 160461. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Q.-Y.; Yan, Z.-B.; Meng, Y.-M.; Hong, X.-Y.; Shao, G.; Ma, J.-J.; Cheng, X.-R.; Liu, J.; Kang, J.; Fu, C.-Y. Antimicrobial peptides: Mechanism of action, activity and clinical potential. Mil. Med. Res. 2021, 8, 48. [Google Scholar] [CrossRef] [PubMed]
- Li, X.; Zuo, S.; Wang, B.; Zhang, K.; Wang, Y. Antimicrobial Mechanisms and Clinical Application Prospects of Antimicrobial Peptides. Molecules 2022, 27, 2675. [Google Scholar] [CrossRef] [PubMed]
- Kravchenko, S.V.; Domnin, P.A.; Grishin, S.Y.; Panfilov, A.V.; Azev, V.N.; Mustaeva, L.G.; Gorbunova, E.Y.; Kobyakova, M.I.; Surin, A.K.; Glyakina, A.V.; et al. Multiple Antimicrobial Effects of Hybrid Peptides Synthesized Based on the Sequence of Ribosomal S1 Protein from Staphylococcus aureus. Int. J. Mol. Sci. 2022, 23, 524. [Google Scholar] [CrossRef] [PubMed]
- Zhu, Y.; Hao, W.; Wang, X.; Ouyang, J.; Deng, X.; Yu, H.; Wang, Y. Antimicrobial peptides, conventional antibiotics, and their synergistic utility for the treatment of drug-resistant infections. Med. Res. Rev. 2022, 42, 1377–1422. [Google Scholar] [CrossRef]
- Li, W.; Separovic, F.; O’Brien-Simpson, N.M.; Wade, J.D. Chemically modified and conjugated antimicrobial peptides against superbugs. Chem. Soc. Rev. 2021, 50, 4932–4973. [Google Scholar] [CrossRef] [PubMed]
- Sharma, K.; Sharma, K.K.; Sharma, A.; Jain, R. Peptide-based drug discovery: Current status and recent advances. Drug Discov. Today 2023, 28, 103464. [Google Scholar] [CrossRef]
- Fosgerau, K.; Hoffmann, T. Peptide therapeutics: Current status and future directions. Drug Discov. Today 2015, 20, 122–128. [Google Scholar] [CrossRef]
- Han, Y.; Zhang, M.; Lai, R.; Zhang, Z. Chemical modifications to increase the therapeutic potential of antimicrobial peptides. Peptides 2021, 146, 170666. [Google Scholar] [CrossRef]
- Sun, G.; Zhang, Q.; Dong, Z.; Dong, D.; Fang, H.; Wang, C.; Dong, Y.; Wu, J.; Tan, X.; Zhu, P.; et al. Antibiotic resistant bacteria: A bibliometric review of literature. Front. Public Health 2022, 10, 1002015. [Google Scholar] [CrossRef]
- Kurpe, S.R.; Grishin, S.Y.; Surin, A.K.; Panfilov, A.V.; Slizen, M.V.; Chowdhury, S.D.; Galzitskaya, O.V. Antimicrobial and Amyloidogenic Activity of Peptides. Can Antimicrobial Peptides Be Used against SARS-CoV-2? Int. J. Mol. Sci. 2020, 21, 9552. [Google Scholar] [CrossRef] [PubMed]
- Li, X.; Hu, Q.; Lin, Q.; Luo, J.; Xu, J.; Chen, L.; Xu, L.; Lin, X. Inhibition of Candida albicans in vivo and in vitro by antimicrobial peptides chromogranin A-N12 through microRNA-155/suppressor of cytokine signaling 1 axis. Bioengineered 2022, 13, 2513–2524. [Google Scholar] [CrossRef] [PubMed]
- Karas, J.A.; Chen, F.; Schneider-Futschik, E.K.; Kang, Z.; Hussein, M.; Swarbrick, J.; Hoyer, D.; Giltrap, A.M.; Payne, R.J.; Li, J.; et al. Synthesis and structure−activity relationships of teixobactin. Ann. N. Y. Acad. Sci. 2020, 1459, 86–105. [Google Scholar] [CrossRef] [PubMed]
- Masadeh, M.M.; Laila, S.A.; Haddad, R.; Alzoubi, K.; Alhaijaa, A.A.; Alrabadi, N. The Antimicrobial Effect Against Multi-drug Resistant Bacteria of the SK4 Peptide: A Novel Hybrid Peptide of Cecropin-A and BMAP-27. Curr. Pharm. Biotechnol. 2023, 24, 1070–1078. [Google Scholar] [CrossRef] [PubMed]
- Grishin, S.Y.; Domnin, P.A.; Kravchenko, S.V.; Azev, V.N.; Mustaeva, L.G.; Gorbunova, E.Y.; Kobyakova, M.I.; Surin, A.K.; Makarova, M.A.; Kurpe, S.R.; et al. Is It Possible to Create Antimicrobial Peptides Based on the Amyloidogenic Sequence of Ribosomal S1 Protein of P. aeruginosa? Int. J. Mol. Sci. 2021, 22, 9776. [Google Scholar] [CrossRef]
- Chowdhary, R.; Mubarak, M.M.; Kantroo, H.A.; ur Rahim, J.; Malik, A.; Sarkar, A.R.; Bashir, G.; Ahmad, Z.; Rai, R. Synthesis, Characterization, and Antimicrobial Activity of Ultra-Short Cationic β-Peptides. ACS Infect. Dis. 2023, 9, 1437–1448. [Google Scholar] [CrossRef] [PubMed]
- Zhu, C.; Bai, Y.; Zhao, X.; Liu, S.; Xia, X.; Zhang, S.; Wang, Y.; Zhang, H.; Xu, Y.; Chen, S.; et al. Antimicrobial Peptide MPX with Broad-Spectrum Bactericidal Activity Promotes Proper Abscess Formation and Relieves Skin Inflammation. Probiotics Antimicrob. Proteins 2023, in press. [Google Scholar] [CrossRef]
- Yang, S.; Dai, J.; Aweya, J.J.; Lin, R.; Weng, W.; Xie, Y.; Jin, R. The Antibacterial Activity and Pickering Emulsion Stabilizing Effect of a Novel Peptide, SA6, Isolated from Salt-Fermented Penaeus vannamei. Food Bioprocess Technol. 2023, 16, 1312–1323. [Google Scholar] [CrossRef]
- Zhang, R.; Yan, H.; Wang, X.; Cong, H.; Yu, B.; Shen, Y. Screening of a short chain antimicrobial peptide-FWKFK and its application in wound healing. Biomater. Sci. 2023, 11, 1867–1875. [Google Scholar] [CrossRef]
- Hao, M.; Zhang, L.; Chen, P. Membrane Internalization Mechanisms and Design Strategies of Arginine-Rich Cell-Penetrating Peptides. Int. J. Mol. Sci. 2022, 23, 9038. [Google Scholar] [CrossRef]
- Derossi, D.; Joliot, A.H.; Chassaing, G.; Prochiantz, A. The third helix of the Antennapedia homeodomain translocates through biological membranes. J. Biol. Chem. 1994, 269, 10444–10450. [Google Scholar] [CrossRef]
- Vivès, E.; Brodin, P.; Lebleu, B. A Truncated HIV-1 Tat Protein Basic Domain Rapidly Translocates through the Plasma Membrane and Accumulates in the Cell Nucleus. J. Biol. Chem. 1997, 272, 16010–16017. [Google Scholar] [CrossRef]
- Khemaissa, S.; Walrant, A.; Sagan, S. Tryptophan, more than just an interfacial amino acid in the membrane activity of cationic cell-penetrating and antimicrobial peptides. Q. Rev. Biophys. 2022, 55, e10. [Google Scholar] [CrossRef]
- Christiaens, B.; Grooten, J.; Reusens, M.; Joliot, A.; Goethals, M.; Vandekerckhove, J.; Prochiantz, A.; Rosseneu, M. Membrane interaction and cellular internalization of penetratin peptides. Eur. J. Biochem. 2004, 271, 1187–1197. [Google Scholar] [CrossRef]
- Turner, J.J. Synthesis, cellular uptake and HIV-1 Tat-dependent trans-activation inhibition activity of oligonucleotide analogues disulphide-conjugated to cell-penetrating peptides. Nucleic Acids Res. 2005, 33, 27–42. [Google Scholar] [CrossRef]
- Nooranian, S.; Oskuee, R.K.; Jalili, A. Antimicrobial Peptides, a Pool for Novel Cell Penetrating Peptides Development and Vice Versa. Int. J. Pept. Res. Ther. 2021, 27, 1205–1220. [Google Scholar] [CrossRef]
- Horváti, K.; Bacsa, B.; Mlinkó, T.; Szabó, N.; Hudecz, F.; Zsila, F.; Bősze, S. Comparative analysis of internalisation, haemolytic, cytotoxic and antibacterial effect of membrane-active cationic peptides: Aspects of experimental setup. Amino Acids 2017, 49, 1053–1067. [Google Scholar] [CrossRef] [PubMed]
- Lee, H.; Lim, S.I.; Shin, S.-H.; Lim, Y.; Koh, J.W.; Yang, S. Conjugation of Cell-Penetrating Peptides to Antimicrobial Peptides Enhances Antibacterial Activity. ACS Omega 2019, 4, 15694–15701. [Google Scholar] [CrossRef] [PubMed]
- Dias, S.A.; Freire, J.M.; Pérez-Peinado, C.; Domingues, M.M.; Gaspar, D.; Vale, N.; Gomes, P.; Andreu, D.; Henriques, S.T.; Castanho, M.A.R.B.; et al. New Potent Membrane-Targeting Antibacterial Peptides from Viral Capsid Proteins. Front. Microbiol. 2017, 8, 775. [Google Scholar] [CrossRef]
- Beveridge, T. Use of the Gram stain in microbiology. Biotech. Histochem. 2001, 76, 111–118. [Google Scholar] [CrossRef]
- Kurpe, S.; Grishin, S.; Surin, A.; Selivanova, O.; Fadeev, R.; Dzhus, U.; Gorbunova, E.; Mustaeva, L.; Azev, V.; Galzitskaya, O. Antimicrobial and Amyloidogenic Activity of Peptides Synthesized on the Basis of the Ribosomal S1 Protein from Thermus Thermophilus. Int. J. Mol. Sci. 2020, 21, 6382. [Google Scholar] [CrossRef]
- Garbuzynskiy, S.O.; Lobanov, M.Y.; Galzitskaya, O.V. FoldAmyloid: A method of prediction of amyloidogenic regions from protein sequence. Bioinformatics 2010, 26, 326–332. [Google Scholar] [CrossRef]
- Trovato, A.; Seno, F.; Tosatto, S.C.E. The PASTA server for protein aggregation prediction. Protein Eng. Des. Sel. 2007, 20, 521–523. [Google Scholar] [CrossRef] [PubMed]
- Maurer-Stroh, S.; Debulpaep, M.; Kuemmerer, N.; de la Paz, M.L.; Martins, I.C.; Reumers, J.; Morris, K.L.; Copland, A.; Serpell, L.; Serrano, L.; et al. Exploring the sequence determinants of amyloid structure using position-specific scoring matrices. Nat. Methods 2010, 7, 237–242. [Google Scholar] [CrossRef] [PubMed]
- Conchillo-Solé, O.; de Groot, N.S.; Avilés, F.X.; Vendrell, J.; Daura, X.; Ventura, S. AGGRESCAN: A server for the prediction and evaluation of “hot spots” of aggregation in polypeptides. BMC Bioinform. 2007, 8, 65. [Google Scholar] [CrossRef] [PubMed]
- Parsons, J.B.; Rock, C.O. Bacterial lipids: Metabolism and membrane homeostasis. Prog. Lipid Res. 2013, 52, 249–276. [Google Scholar] [CrossRef]
- Sohlenkamp, C.; Geiger, O. Bacterial membrane lipids: Diversity in structures and pathways. FEMS Microbiol. Rev. 2016, 40, 133–159. [Google Scholar] [CrossRef]
- Epand, R.M.; Epand, R.F. Lipid domains in bacterial membranes and the action of antimicrobial agents. Biochim. Biophys. Acta—Biomembr. 2009, 1788, 289–294. [Google Scholar] [CrossRef]
- Pizzirusso, A.; De Nicola, A.; Sevink, G.J.A.; Correa, A.; Cascella, M.; Kawakatsu, T.; Rocco, M.; Zhao, Y.; Celino, M.; Milano, G. Biomembrane solubilization mechanism by Triton X-100: A computational study of the three stage model. Phys. Chem. Chem. Phys. 2017, 19, 29780–29794. [Google Scholar] [CrossRef]
- Nascimento, J.M.; Franco, O.L.; Oliveira, M.D.L.; Andrade, C.A.S. Evaluation of Magainin I interactions with lipid membranes: An optical and electrochemical study. Chem. Phys. Lipids 2012, 165, 537–544. [Google Scholar] [CrossRef]
- Finkelstein, A.; Andersen, O.S. The gramicidin a channel: A review of its permeability characteristics with special reference to the single-file aspect of transport. J. Membr. Biol. 1981, 59, 155–171. [Google Scholar] [CrossRef]
- Andersen, O.S.; Koeppe, R.E.; Roux, B. Gramicidin channels. IEEE Trans. Nanobiosci. 2005, 4, 10–20. [Google Scholar] [CrossRef]
- Sheth, T.R.; Henderson, R.M.; Hladky, S.B.; Cuthbert, A.W. Ion channel formation by duramycin. Biochim. Biophys. Acta—Biomembr. 1992, 1107, 179–185. [Google Scholar] [CrossRef]
- Efimova, S.S.; Shekunov, E.V.; Chernyshova, D.N.; Zakharova, A.A.; Ostroumova, O.S. The Dependence of the Channel-Forming Ability of Lantibiotics on the Lipid Composition of the Membranes. Biochem. Suppl. Ser. A Membr. Cell Biol. 2022, 16, 144–150. [Google Scholar] [CrossRef]
- Helmy, Y.A.; Taha-Abdelaziz, K.; Hawwas, H.A.E.-H.; Ghosh, S.; AlKafaas, S.S.; Moawad, M.M.M.; Saied, E.M.; Kassem, I.I.; Mawad, A.M.M. Antimicrobial Resistance and Recent Alternatives to Antibiotics for the Control of Bacterial Pathogens with an Emphasis on Foodborne Pathogens. Antibiotics 2023, 12, 274. [Google Scholar] [CrossRef] [PubMed]
- Vergalli, J.; Bodrenko, I.V.; Masi, M.; Moynié, L.; Acosta-Gutiérrez, S.; Naismith, J.H.; Davin-Regli, A.; Ceccarelli, M.; van den Berg, B.; Winterhalter, M.; et al. Porins and small-molecule translocation across the outer membrane of Gram-negative bacteria. Nat. Rev. Microbiol. 2020, 18, 164–176. [Google Scholar] [CrossRef]
- Zgurskaya, H.I.; Rybenkov, V.V. Permeability barriers of Gram-negative pathogens. Ann. N. Y. Acad. Sci. 2020, 1459, 5–18. [Google Scholar] [CrossRef] [PubMed]
- Darby, E.M.; Trampari, E.; Siasat, P.; Gaya, M.S.; Alav, I.; Webber, M.A.; Blair, J.M.A. Molecular mechanisms of antibiotic resistance revisited. Nat. Rev. Microbiol. 2023, 21, 280–295. [Google Scholar] [CrossRef]
- Chen, H.; Battalapalli, D.; Draz, S.M.; Zhang, P.; Ruan, Z. The Application of Cell-Penetrating-Peptides in Antibacterial Agents. Curr. Med. Chem. 2021, 28, 5896–5925. [Google Scholar] [CrossRef]
- Garmay, Y.; Rubel, A.; Egorov, V. Peptide from NSP7 is able to form amyloid-like fibrils: Artifact or challenge to drug design? Biochim. Biophys. Acta—Proteins Proteom. 2023, 1871, 140884. [Google Scholar] [CrossRef]
- Wang, X.; Zhang, S.; Zhang, J.; Wang, Y.; Jiang, X.; Tao, Y.; Li, D.; Zhong, C.; Liu, C. Rational design of functional amyloid fibrillar assemblies. Chem. Soc. Rev. 2023, 52, 4603–4631. [Google Scholar] [CrossRef] [PubMed]
- Boparai, J.K.; Sharma, P.K. Mini Review on Antimicrobial Peptides, Sources, Mechanism and Recent Applications. Protein Pept. Lett. 2019, 27, 4–16. [Google Scholar] [CrossRef] [PubMed]
- Robles-Loaiza, A.A.; Pinos-Tamayo, E.A.; Mendes, B.; Ortega-Pila, J.A.; Proaño-Bolaños, C.; Plisson, F.; Teixeira, C.; Gomes, P.; Almeida, J.R. Traditional and Computational Screening of Non-Toxic Peptides and Approaches to Improving Selectivity. Pharmaceuticals 2022, 15, 323. [Google Scholar] [CrossRef] [PubMed]
- Chapa González, C.; González García, L.I.; Burciaga Jurado, L.G.; Carrillo Castillo, A. Bactericidal activity of silver nanoparticles in drug-resistant bacteria. Braz. J. Microbiol. 2023, 54, 691–701. [Google Scholar] [CrossRef] [PubMed]
- Riu, F.; Ruda, A.; Ibba, R.; Sestito, S.; Lupinu, I.; Piras, S.; Widmalm, G.; Carta, A. Antibiotics and Carbohydrate-Containing Drugs Targeting Bacterial Cell Envelopes: An Overview. Pharmaceuticals 2022, 15, 942. [Google Scholar] [CrossRef]
- Chen, D.; Liu, X.; Chen, Y.; Lin, H. Amyloid peptides with antimicrobial and/or microbial agglutination activity. Appl. Microbiol. Biotechnol. 2022, 106, 7711–7720. [Google Scholar] [CrossRef]
- Galzitskaya, O.V.; Kurpe, S.R.; Panfilov, A.V.; Glyakina, A.V.; Grishin, S.Y.; Kochetov, A.P.; Deryusheva, E.I.; Machulin, A.V.; Kravchenko, S.V.; Domnin, P.A.; et al. Amyloidogenic Peptides: New Class of Antimicrobial Peptides with the Novel Mechanism of Activity. Int. J. Mol. Sci. 2022, 23, 5463. [Google Scholar] [CrossRef]
- Hurtado-Rios, J.J.; Carrasco-Navarro, U.; Almanza-Pérez, J.C.; Ponce-Alquicira, E. Ribosomes: The New Role of Ribosomal Proteins as Natural Antimicrobials. Int. J. Mol. Sci. 2022, 23, 9123. [Google Scholar] [CrossRef]
- Wei, D.; Zhang, X. Biosynthesis, bioactivity, biotoxicity and applications of antimicrobial peptides for human health. Biosaf. Health 2022, 4, 118–134. [Google Scholar] [CrossRef]
- Wei, D.; Zhang, X.; Hailun, G. Biosynthesis of antimicrobial peptides and its medical application. Synth. Biol. J. 2022, 3, 709–727. [Google Scholar]
- Singh, O.; Hsu, W.-L.; Su, E.C.-Y. Co-AMPpred for in silico-aided predictions of antimicrobial peptides by integrating composition-based features. BMC Bioinform. 2021, 22, 389. [Google Scholar] [CrossRef] [PubMed]
- Grishin, S.Y.; Dzhus, U.F.; Glukhov, A.S.; Selivanova, O.M.; Surin, A.K.; Galzitskaya, O.V. Identification of Amyloidogenic Regions in Pseudomonas aeruginosa Ribosomal S1 Protein. Int. J. Mol. Sci. 2021, 22, 7291. [Google Scholar] [CrossRef] [PubMed]
- Montal, M.; Mueller, P. Formation of Bimolecular Membranes from Lipid Monolayers and a Study of Their Electrical Properties. Proc. Natl. Acad. Sci. USA 1972, 69, 3561–3566. [Google Scholar] [CrossRef] [PubMed]
Peptide | FoldAmyloid | Waltz | AGGRESCAN | Pasta 2.0 |
---|---|---|---|---|
Peptides based on the S1 sequence of T. thermophilus | ||||
RKKRRQRRRGGGGVTDFGVFVEI § (CPP1 + AF, R23IT), 23 a.a. | GVFVEI (18–23 a.a.) | No | TDFGVFVEI (15–23 a.a.) | VTDFGVFV (14–21 a.a.) |
VTDFGVFVEIGGGGSRQIKIWFQNRRMKWKK (AF + CPP2, V31KT), 31 a.a. | GVFVE (5–9 a.a.), IKIWFQ (18–23 a.a.) | VFVEIG (6–11 a.a.) | DFGVFVEI (3–10 a.a.), IKIWF (18–22 a.a.) | VTDFGVFV (1–8 a.a.) |
Peptides based on the S1 sequence of P. aeruginosa | ||||
RKKRRQRRRGGGGITDFGIFIGL (CPP1 + AF, R23LP), 23 a.a. | TDFGIF IGL (15–23 a.a.) | No | TDFGIFIGL (15–23 a.a.) | No |
ITDFGIFIGLGGGGSRQIKIWFQNRRMKWKK (AF + CPP2, I31KP), 31 a.a. | TDFGIFIG (2–9 a.a.), IKIWFQ (18–23 a.a.) | No | TDFGIFIGL (2–10 a.a.), IKIWF (18–22 a.a.) | No |
RKKRRQRRRGGGGITDFGIFIGLGGGGSRQIKIWFQNRRMKWKK (CPP1 + AF + CPP2, R44KP), 44 a.a. | TDFGIFIG (15–22 a.a.), IKIWFQ (31–36 a.a.) | No | TDFGIFIGL (15–23 a.a.), IKIWF (31–35 a.a.) | No |
Tested Peptide | Microorganisms | Peptide Activity in Liquid Medium after 15 h of Incubation (Gentamicin as Positive Control), µM, Bacteria Strain | Peptide Activity in Liquid Medium after 24 h of Incubation (Meropenem as a Positive Control), µM, Bacteria Strain |
---|---|---|---|
R23IT based on the sequence S1 from T. thermophilus | S. aureus | 12 µM, 209P strain | >3740 µM, 129B strain |
MRSA | >12 µM, ATCC 43300 strain | >3740 µM, SA 180-F strain | |
P. aeruginosa | >12 µM, ATCC 28753 | >3740 µM, 2943 strain | |
E. coli | >12 µM, K12 strain | >3740 µM, MG1655 strain | |
V31KT based on the sequence S1 from T. thermophilus | S. aureus | >12 µM, 209P strain | >2730 µM, 129B strain |
MRSA | >12 µM, ATCC 43300 strain | >2730 µM, SA 180-F strain | |
P. aeruginosa | >12 µM, ATCC 28753 | >2730 µM, 2943 strain | |
E. coli | >12 µM, K12 strain | >2730 µM, MG1655 strain | |
I10LP (ITDFGIFIGL) based on the sequence S1 from P. aeruginosa | S. aureus | 913 µM, 209P strain | No data |
MRSA | 913 µM, ATCC 43300 strain | No data | |
P. aeruginosa | No data | No data | |
E. coli | 913 µM, K12 strain | No data | |
R23LP based on the sequence S1 from P. aeruginosa | S. aureus | 12 µM, 209P strain | >3780 µM, 129B strain |
MRSA | 12 µM, ATCC 43300 strain | >3780 µM, SA 180-F strain | |
P. aeruginosa | 12 µM, ATCC 28753 | ≥3780 µM, 2943 strain | |
E. coli | 12 µM, K12 strain | ≥3780 µM, MG1655 strain | |
I31KP based on the sequence S1 from P. aeruginosa | S. aureus | >12 µM, 209P strain | >2750 µM, 129B strain |
MRSA | >12 µM, ATCC 43300 strain | >2750 µM, SA 180-F strain | |
P. aeruginosa | >12 µM, ATCC 28753 | >2750 µM, 2943 strain | |
E. coli | >12 µM, K12 strain | >2750 µM, MG1655 strain | |
R44KP based on the sequence S1 from P. aeruginosa | S. aureus | 12 µM, 209P strain | >1930 µM, 129B strain |
MRSA | 12 µM, ATCC 43300 strain | >1930 µM, SA 180-F strain | |
P. aeruginosa | 6 µM, ATCC 28753 | ≥1930 µM, 2943 strain | |
E. coli | >12 µM, K12 strain | >1930 µM, MG1655 strain |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Kravchenko, S.V.; Domnin, P.A.; Grishin, S.Y.; Vershinin, N.A.; Gurina, E.V.; Zakharova, A.A.; Azev, V.N.; Mustaeva, L.G.; Gorbunova, E.Y.; Kobyakova, M.I.; et al. Enhancing the Antimicrobial Properties of Peptides through Cell-Penetrating Peptide Conjugation: A Comprehensive Assessment. Int. J. Mol. Sci. 2023, 24, 16723. https://doi.org/10.3390/ijms242316723
Kravchenko SV, Domnin PA, Grishin SY, Vershinin NA, Gurina EV, Zakharova AA, Azev VN, Mustaeva LG, Gorbunova EY, Kobyakova MI, et al. Enhancing the Antimicrobial Properties of Peptides through Cell-Penetrating Peptide Conjugation: A Comprehensive Assessment. International Journal of Molecular Sciences. 2023; 24(23):16723. https://doi.org/10.3390/ijms242316723
Chicago/Turabian StyleKravchenko, Sergey V., Pavel A. Domnin, Sergei Y. Grishin, Nikita A. Vershinin, Elena V. Gurina, Anastasiia A. Zakharova, Viacheslav N. Azev, Leila G. Mustaeva, Elena Y. Gorbunova, Margarita I. Kobyakova, and et al. 2023. "Enhancing the Antimicrobial Properties of Peptides through Cell-Penetrating Peptide Conjugation: A Comprehensive Assessment" International Journal of Molecular Sciences 24, no. 23: 16723. https://doi.org/10.3390/ijms242316723
APA StyleKravchenko, S. V., Domnin, P. A., Grishin, S. Y., Vershinin, N. A., Gurina, E. V., Zakharova, A. A., Azev, V. N., Mustaeva, L. G., Gorbunova, E. Y., Kobyakova, M. I., Surin, A. K., Fadeev, R. S., Ostroumova, O. S., Ermolaeva, S. A., & Galzitskaya, O. V. (2023). Enhancing the Antimicrobial Properties of Peptides through Cell-Penetrating Peptide Conjugation: A Comprehensive Assessment. International Journal of Molecular Sciences, 24(23), 16723. https://doi.org/10.3390/ijms242316723