Next Article in Journal
Expression Analysis Reveals Differentially Expressed Genes in BPH and WBPH Associated with Resistance in Rice RILs Derived from a Cross between RP2068 and TN1
Next Article in Special Issue
Therapeutic Strategies for Pancreatic-Cancer-Related Type 2 Diabetes Centered around Natural Products
Previous Article in Journal
Transcriptomic Analysis of Metarhizium anisopliae-Induced Immune-Related Long Non-Coding RNAs in Polymorphic Worker Castes of Solenopsis invicta
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Amphibian-Derived Natural Anticancer Peptides and Proteins: Mechanism of Action, Application Strategies, and Prospects

Faculty of Basic Medical Sciences, Kunming Medical University, Kunming 650500, China
*
Authors to whom correspondence should be addressed.
These authors contributed equally to this work.
Int. J. Mol. Sci. 2023, 24(18), 13985; https://doi.org/10.3390/ijms241813985
Submission received: 18 July 2023 / Revised: 30 July 2023 / Accepted: 1 August 2023 / Published: 12 September 2023
(This article belongs to the Special Issue Anti-cancer Effects of Natural Products)

Abstract

Cancer is one of the major diseases that seriously threaten human life. Traditional anticancer therapies have achieved remarkable efficacy but have also some unavoidable side effects. Therefore, more and more research focuses on highly effective and less-toxic anticancer substances of natural origin. Amphibian skin is rich in active substances such as biogenic amines, alkaloids, alcohols, esters, peptides, and proteins, which play a role in various aspects such as anti-inflammatory, immunomodulatory, and anticancer functions, and are one of the critical sources of anticancer substances. Currently, a range of natural anticancer substances are known from various amphibians. This paper aims to review the physicochemical properties, anticancer mechanisms, and potential applications of these peptides and proteins to advance the identification and therapeutic use of natural anticancer agents.

1. Introduction

Cancer has become one of the leading cause of premature death in most countries worldwide. If current cancer incidence trends persist, we predict that by 2070, cancer rates will double from 2020 levels [1], which will create a significant physical and economic burden on people globally. Cancer treatment relies on surgery, radiotherapy, and chemotherapy [2], which have achieved remarkable therapeutic efficacy. However, conventional methods sometimes have some deficiencies, such as lacking a specific drug delivery system and the inability to differentiate between cancerous and normal cells, which may lead to systemic toxicities [3]. Therefore, there is a need for more targeted and effective new drugs to address this issue. In this regard, bioactive substances are increasingly being considered as promising candidates for cancer therapy and applications.
Anticancer substances are abundant in nature, with plants, animals, and microorganisms being major sources [4]. Compared to traditional synthetic small molecule drugs, natural anticancer substances typically have larger molecular weight, more hydrogen bond acceptors and donors, a lower lipid–water partition coefficient, and higher molecular rigidity [5]. Moreover, they can act through multiple pathways and target coordination, rather than a single mode of action. These characteristics significantly expand the range of bioactive compounds and offer promising opportunities for the discovery of active drugs [4]. Recently, amphibians have garnered more attention in the search for biologically active substances due to their ability to survive in diverse habitats, which are attributed to their adaptations in morphology, physiology, biochemistry, and behavior [6]. Amphibians also produce a rich array of chemicals that serve as their self-defense system. In fact, as of June 2023, 108 out of 276 natural anticancer peptides are derived from amphibians (https://aps.unmc.edu/database/anti, accessed on 20 June 2023). Thus, amphibians are a valuable source of bioactive anticancer substances. This paper aims to review the physicochemical properties of natural gene-encoded anticancer substances found in amphibians and to discuss their unique sources, potential mechanisms of action, and future development prospects.

2. Physicochemical Properties of Natural Anticancer Peptides and Proteins of Amphibian Origin

The skin of amphibians serves a vital purpose in physiological processes and also acts as a defense against invading pathogens [7]. Additionally, the skin secretions of amphibians contain a diverse range of compounds that possess biologically active functions, such as peptides and esters. In one study, caerin 1.1, derived from Australian tree frogs of the genus Litoria, demonstrated a remarkable ability to suppress the growth of cervical cancer Hela cells. Even at a concentration as low as 1.9 nm, it exhibited significant inhibitory effects [8]. Similarly, BMP1 extracted from Indian toads (Bufo melanostictus Schneider) showed promising results in reducing the MTT value of EAC cells. At a dosage of 1 mg/kg, it achieved a 74.1% reduction, surpassing the effectiveness of 5-FU at 10 mg/kg, which only managed to reduce the MTT value by approximately 64.6% [9]. In the non-small cell lung cancer H157 mouse xenograft tumor model, the tumor growth inhibition rate of 8 mM Dermaseptin-PP (from Phyllomedusa palliata) was significantly higher than that of the 0.7 mM cisplatin positive control group. Moreover, there were no observable side effects on mice [10]. However, it is important to consider the differences in drug concentrations when comparing the effects of different drugs. In brief, these compounds have the potential to kill tumors at lower concentrations and with fewer toxic and side effects, which has generated a significant amount of interest.
Currently, most peptides with potential anticancer properties have been isolated from the skin of amphibians, although some protease inhibitors obtained from amphibian oocytes have also shown anticancer activity [11]. These peptides, as listed in Table 1, typically consist of 8 to 48 amino acid residues, with a majority bearing a positive charge ranging from +1 to +4, while they are composed of 40% to 70% hydrophobic amino acids [12]. There are also a few examples of anticancer peptides that exhibit negative charge properties. Nuclear magnetic resonance (NMR) studies have shown that these peptides tend to form amphiphilic α-helices in membrane-mimetic solvents, a structure that lays the foundation for their anticancer activity [13]. Another extensively researched compound is HuaChansu, a traditional Chinese medicine isolated from Bufo gargarizans, which contains active ingredients such as Bufalin, Bufotalin, Cinobufagin, and Cinobufotalin (Figure 1). Studies have demonstrated its efficacy in treating various cancers, including leukemia, breast cancer, liver cancer, gastric cancer, and colorectal cancer, and it has been shown to possess potent anticancer properties [14].

3. Action Mode and Mechanism of Anticancer Peptides and Proteins

Amphibians seem to be a unique source of anticancer substances. From the current literature, it appears that these substances are not only selectively toxic to cancer cells, but also exhibit low toxicity to normal cells [43]. A multitude of anticancer substances derived from amphibian skin have shown an ability to induce cell cycle arrest and apoptosis, and have even demonstrated efficacy in animal models [44].

3.1. Interaction Directly through the Cell Membrane

Cancer cells are subject to oxidative stress, inflammation, and other stimuli that cause an increase in glycosylated mucin sialic acid and heparan sulfate on the cell membrane surface [45,46]. This leads to a loss of membrane symmetry and the manifestation of factors such as phosphatidylserine eversion and an increased negative charge on the membrane surface. This property allows positively charged amphiphilic anticancer peptides to selectively interact with cancer cells, leading to the depolarization of their membranes and eventual dissolution. This mechanism also partially explains how anticancer peptides can selectively bind to normal and tumor cells [46]. This direct interaction through the cell membrane is summarized in the following three main models: Carpet-like model, Barrel–Stave model, and Toroidal pore model (Figure 2).
Temporin1CEa is a peptide used by the host to defend against pathogens. It is derived from the skin secretion of the Chinese brown frog (Rana chensinensis). When incubated with breast cancer cells at a specific concentration, it causes a loss of membrane symmetry and integrity, leading to a decrease in cell vitality [47]. A similar effect has been observed in melanoma. In fact, studies have shown that human A375 melanoma cells express 50 times more PS than non-cancerous HaCaT cells. As a result, Temporin1CE can bind to PS with high affinity, causing cytotoxicity [48]. Anionic anticancer peptides have also been found to have anticancer effects through direct membrane lysis. Maximin H5 is the first anionic amphibian-derived anticancer peptide demonstrating anticancer activity. After deamination of its C-terminus, Maximin H5 exhibits a lower level of an α-helical structure while penetrating glioma cell membranes, which suggests that the terminal amide group of Maximin H5 is necessary for its membrane-lytic and anticancer activities [49]. Other anticancer peptides with similar functions include citropin 1.1 from the tree frog Litoria citropa [50], aurein 1.2 from Litoria raniformis [15], and Magainins from Xenopus laevis [51] (Table 2).

3.2. Acting on Tumor Growth

Anticancer substances not only interact directly with cancer cell membranes to alter their integrity and permeability, but they can also target the endogenous pathways of cancer cells through different channels. This can lead to the blockage of the cancer cell cycle, inhibition of cell proliferation, and the induction of cell senescence or death (Figure 3).

3.2.1. Regulation of Tumor Cell Cycle and Proliferation

The cell cycle is a fundamental process in the life of a cell, and its proper functioning relies on the precise regulation of regulatory factors at all levels. When this control is lost, it can lead to cancer. However, the anticancer peptide TSE, derived from the Indian toad Bufo melanostictus, has been found to inhibit the expression of PCNA in U937 and K562 cells. PCNA primarily blocks the progression of the G1 phase of the cell cycle and regulates and coordinates DNA replication. As a result, TSE may have therapeutic potential in treating human myeloid leukemia [57]. Pentadactylin is a peptide found in the South American bullfrog Leptodactylus pentadactylus that has been shown to be effective in fighting cancer. It works by arresting the cell cycle of B16F10 cells in the S phase and reducing the number of cells in the G1 phase, which significantly inhibits the proliferation of melanoma [58]. In a similar study by Antony Gomes et al., the protein toxin BMP1 was found to arrest the cell cycle of U937 and K562 cells in the sub-G1 and G1 phases. Additionally, it was shown to inhibit the expression of PCNA and CDK2 in HepG2 cells and promote the protein levels of CDKIs such as p21 and p27. These findings suggest that BMP1 can effectively inhibit the proliferation of malignant tumors by regulating the expression of these cell cycle-related genes [9,59]. In leukemia, a similar effect has been noted with Bufalin, which causes an increase in the activity of casein kinase 2 (CK2) by translocating to the nucleus. Additionally, it inhibits the expression of PKA and PKC or binds to β-tubulin, which ultimately leads to the inhibition of proliferation [43].

3.2.2. Inducing Tumor Cells Senescence

Cellular senescence serves as a natural barrier to tumor formation by inhibiting cell proliferation [60]. Therefore, inducing tumor cell senescence may prove to be an effective anticancer strategy. Interestingly, amphibians possess regenerative abilities that are closely linked to aging and cancer. A recent study discovered that the tadpole tail bud base extracts TAD A1 from the stream frog, Strongylopus grayii, which has anticancer potential. Treatment of human malignant embryonic rhabdomyoma cells with TAD A1 resulted in significant morphological changes such as cellular swelling, irregularly enlarged nuclei, and hallmarks of senescent cells. Western blotting results also indicated an increase in the expression of the senescence-related protein p16INK4a [61]. Bufalin is involved in prostate cancer by promoting the expression of senescence-related genes, including CYR6/CCNI, CTGF/CCN2, and the p53 target gene CDKN1A (p21). This leads to an increase in the number of cells undergoing positive senescence, as indicated by β-galactosidase activity [62]. Additionally, certain ribonucleases derived from amphibians [63], such as RC-6 from bullfrogs, have demonstrated anticancer properties. For example, RC-6 has been shown to elevate the levels of the p16 protein in human embryonic carcinoma cells (NT2) and induce cell senescence [64].

3.2.3. Inducing Apoptosis of Tumor Cells

Numerous studies have established that anticancer compounds can activate apoptosis pathways to perform their functions. Apoptosis is classified into two pathways, intrinsic and extrinsic, with caspase-9 and -8 serving as the intermediate activators of both. Additionally, caspase-3, 6, and 7 act as the common apoptosis executors for both pathways [65].
Intrinsic apoptosis is a pathway that occurs in the mitochondria and activates caspases by releasing caspase-activating factors. Recent studies have shown that Pentadactylin not only blocks the cell cycle but also causes cell volume to decrease, mitochondrial membrane potential to decrease, and DNA fragmentation to increase [58]. In addition, Lee et al. discovered that BuforinIIb, an anticancer peptide from the Bufo bufo gargarizans, has a strong killing effect on 62 different cancer cell lines. This peptide can destroy the mitochondrial membrane, release cytochrome C, activate the caspase cascade reaction, induce a series of hydrolyses, and lead to cell disintegration, ultimately initiating endogenous apoptosis [66]. After treatment of U-251 MG cells with Dermaseptin-PS1, there was a significant increase in the protein expression levels of cleaved caspase 3, cleaved caspase 9, apoptosis protease activating factor 1 (Apaf-1), Bcl2-related X protein (Bax), and phosphate p53. Additionally, there was a notable increase in cytochrome c release. Z-VAD-FMK pretreatment was able to abolish the increase in cleaved caspase 3 of U-251 MG induced by Dermaseptin-PS1. These findings suggest that Dermaseptin-PS1 can induce endogenous apoptotic pathways, exhibiting anti-glucose Glioma activity [54]. Several other proteins, including Ranatuerin-2PLx from the pickerel frog [39], ribonuclease RC-6 from Rana catesbeiana [64], and protein toxin BMP1 from the Indian toad (Bufo melanostictus, Schneider) [9,59], are also capable of inducing endogenous apoptosis.
Extrinsic apoptosis, also known as the death receptor pathway, is activated by extracellular signals that trigger intracellular caspase to perform its function. Brevinin-1RL1, an anticancer peptide derived from the Rana limnocharis, has been shown to induce significant increases in PI single staining and cleavage of caspase-8, caspase-9, caspase-3, and PARP in lung cancer cells. Additionally, the potential of the mitochondrial membrane decreases, indicating an involvement of both exogenous and endogenous apoptotic pathways [67].
Additionally, specific anticancer peptides may not trigger apoptosis through the caspase-dependent pathway. Instead, they facilitate the transfer of apoptosis-inducing factor (AIF) and endonuclease G (EndoG) from the inner and outer membrane space of mitochondria to the nucleus. This process ultimately leads to DNA cleavage, chromatin condensation, and other effects [68]. One example is the anticancer peptide HN-1, which is derived from the Hainan cascade frog, Amolops hainanensis. HN-1 has been shown to activate the MAPK/NF-κB pathway, which in turn boosts the expression of the tumor suppressor gene p53 in cells. This activation also increases the expression of pro-apoptotic proteins from the Bcl-2 family, such as BAX, Bak, and Puma. These proteins can then alter mitochondrial functions, ultimately releasing AIF and EndoG into the nucleus to trigger apoptosis [69].

3.2.4. Inducing Tumor Cells Autophagy

Autophagy is the process by which lysosomes break down intracellular components. It plays a crucial role in maintaining cellular homeostasis by degrading intracellular components and providing cell degradation products [70]. As research on autophagy deepens, its role in tumors has become a topic of widespread interest [71].
After treating U2OS human osteosarcoma cells with Cinobufagin, it was observed that a significant number of autophagosomes were formed, and the conversion of LC3-I to LC3-II was increased [72]. Autophagy is triggered by stresses such as ROS and endoplasmic reticulum stress, which activates pathways such as JNK/P38 [73]. These pathways have been found to be activated in both Cinobufagin-induced osteosarcoma [72] and gastric cancer [74]. Bufalin has been found to promote autophagy in liver cancer, colorectal cancer, and glioma by increasing the ratio of LC3-II/LC3-I [75,76,77]. In liver cancer, the combined use of Bufalin and the autophagy inhibitor 3-MA resulted in a significant reduction in autophagosomes in HCC-LM3 cells and inhibited the expression of LC3-II and Beclin-1 [75]. Conversely, upregulation of LC3-II and p62 inhibited autophagy [75]. Bufalin activated the JNK pathway in colorectal cancer by inducing ROS production in HT-29 cells, leading to increased expression of autophagy-related proteins such as ATG5 and Beclin-1 [76]. Bufalin-induced autophagy is linked to ATP depletion and endoplasmic reticulum stress in glioma. Specifically, Bufalin activates the AMPK signaling pathway by using up ATP, which in turn inactivates mTOR via AMPK-mediated phosphorylation of TSC2 and Raptor. When combined with the endoplasmic reticulum stress inhibitor TUDC, Bufalin transplants GRP78 and LC3-II protein. Knockdown of the eIF2α or CHOP gene or expression of the AMPK/mTOR and PERK/eIF2α/CHOP pathways partially inhibits Bufalin-induced LC3-II transformation, indicating their crucial role in the link between Bufalin-induced autophagy and ER stress [77].
In addition, there are some anticancer substances that can cause both autophagy and apoptosis, such as Bufalin [77], RC-RNase [78], Cinobufagin [72], and so on.

3.2.5. Inducing Tumor Cells Necrosis

In addition to apoptosis and autophagy, cell necrosis is another form of programmed cell death closely linked to tumor patients’ progression and prognosis [79]. Research has demonstrated that targeting tumor cell necrosis can be an effective strategy for avoiding drug resistance in apoptosis and promoting anticancer immunity [80].
Brevinin-1RL1 has been found to not only cause apoptosis in lung cancer cells but also trigger necrosis. Necrosis is characterized by massive vacuolation of cells, increased fragmentation, rupture of cell membranes, and increased release of lactate dehydrogenase (LDH) from intracellular contents [69]. Conversely, Bufalin has been found to induce RIP1-dependent and ROS-dependent programmed necrosis in MDA-MB-468 and T47D cells in breast cancer by targeting the RIP1/RIP3/PGAM5 pathway [81]. The same phenomenon was also observed in drug-resistant triple-negative breast cancer cells, MDA-MB-231 [82]. Research has demonstrated that inhibiting the activity of Caspase-8 can cause cells to transition from apoptosis to necrosis [83]. In the case of glioma, knocking down Caspase-8 resulted in weakened Bufalin-induced apoptosis and a significant increase in cell necrosis. This finding effectively addresses the issue of apoptosis escape without requiring additional treatment [84]. The necrosome, which consists of RIPK1, RIPK3, and MLKL, is the primary executor and defining characteristic of necrosis [85]. Research indicates that partially attenuated necrosis induced by Bufalin can be achieved through the knockout of TNFR1 and RIPK1 genes. In summary, Bufalin can trigger both apoptosis and necrosis in glioma, and their manifestation is closely linked to the status of TNF-α, Caspase-8, and RIPK1 proteins [84].

3.2.6. Inducing Other Forms of Tumor Cells Death

Brevinin-2R is a defensin that has been isolated from the skin of Rana ridibunda. This novel peptide has been found to exhibit preferential cytotoxicity against various types of cancer cells, including lymphoma, colon cancer, fibrosarcoma, breast cancer, and lung cancer, as compared to normal cells [86]. Interestingly, Brevinin-2R-induced cell death was found to be independent of caspases, and was associated with decreased mitochondrial membrane potential, increased ROS production, and decreased ATP production. BNIP3 is a protein that can promote apoptosis by targeting mitochondria without requiring caspases. In fact, MCF-7 cells that were transfected with a BNIP3 mutant lacking the transmembrane domain were able to significantly reverse Brevinin-2R-induced cell death [86]. Furthermore, it is crucial to upregulate lysosomal function in response to the high energy demands of tumor hyperproliferation and metastasis [87]. Lysosomal hydrolases, such as cysteine cathepsins B and L, can displace the function of caspases and trigger necrosis or apoptosis. Treatment with Brevinin-2R resulted in enlarged cell lysosomes, and the inhibition of cathepsin B and L partially prevented brevinin-2R-induced cell death. This unique mechanism semi-selectively kills cancer cells through the lysosomal-mitochondrial death pathway [86].

3.3. Inhibiting Tumor Angiogenesis

Angiogenesis is often upregulated in malignant tumors, and this process is closely linked to the tumor’s malignant phenotype [88]. As such, inhibiting tumor angiogenesis or the expression of related factors may be an effective strategy for treating tumors.
Dermaseptins B2 and B3 have been shown to effectively inhibit the formation of PC-3 cell colonies and the proliferation of aortic endothelial ABAE cells. In the presence of the angiogenic factor FGF-2, ABAE cells can form a tubular network. However, when combined with Dermaseptins B2 or B3, the inhibition rate of capillary network formation exceeded 88%. This suggests that Dermaseptins B2 and B3 are capable of inhibiting the proliferation and differentiation of vascular endothelial cells [89]. In the context of liver cancer, the combination of Bufalin and Sorafenib has been found to effectively inhibit angiogenesis by regulating the AKT/VEGF signaling pathway [90]. Additionally, Bufalin has been shown to inhibit tumor microenvironment-mediated angiogenesis by down-regulating the expression of pro-angiogenic genes, including VEGF, PDGFA, e-selectin, and p-selectin in HUVECs through the inhibition of the STAT3 pathway. This suggests that Bufalin may have potential as an anti-angiogenic agent in the treatment of colorectal cancer [91] (Figure 3).

3.4. Inhibiting Epithelial Mesenchymal Transition and Metastasis of Tumor Cells

Cells that undergo epithelial–mesenchymal transition (EMT) exhibit significantly enhanced migration ability. In epithelial tumors, EMT plays a crucial role in tumor migration, invasion, and metastasis [92]. Studies have demonstrated that NF-κB, a multifunctional transcription factor, can regulate the expression of various target genes during the migration and invasion of tumor cells [93]. The IκB kinase (IKK) complex, an upstream kinase necessary for activating NFκB activity, has been identified as a critical factor in this process. Treatment with Arenobufagin can reverse the EMT process of lung cancer cells by inhibiting the cascade activation of the IKKβ/NF-κB pathway, thereby effectively inhibiting the metastasis of lung cancer [94]. In colorectal cancer, the Wnt/β-Catenin pathway is crucial in promoting tumor growth and metastasis [95]. However, treatment with Cinobufacini has been found to promote the expression of APC, a protein that facilitates the nuclear transfer of β-Catenin [96]. At the same time, the expression of β-Catenin, wnt3a, c-Myc, cyclin D1, and MMP7 is inhibited, indicating that Cinobufacini can effectively inhibit the junctional role of EMT in rectal cancer and its metastasis, by blocking the Wnt/β-Catenin protein signaling pathway [97]. Matrix metalloproteinases are enzymes that can break down the extracellular matrix and facilitate the movement of cancer cells into the basement membrane [98]. Cinobufacin has been shown to inhibit the invasion of pancreatic cancer cells by suppressing the expression of MMP-2 and MMP-9. In addition, in the liver, cinobufacin has been found to reduce the specific gravity and expression of MMP-2 and MMP-9 in liver metastases. These findings suggest that cinobufacin may possess anti-hepatic metastasis properties for pancreatic cancer [99]. TGF-β is known to promote tumor cell invasion and metastasis through several mechanisms, including angiogenesis, inflammation, immune escape, and epithelial–mesenchymal transition [100]. However, bufalin has been found to inhibit TGF-β-induced EMT. In addition, activation of the transcription factor Twist2 and expression of the TGF-β receptor have been shown to suppress metastasis in liver and lung cancers [101]. It is worth noting that bufalin can also promote the expression of metalloproteinase tissue inhibitor protein [102], regulate the phosphorylation of tight junction and invasion-related protein GSK3-β [103], and induce the overexpression of fibronectin [104], among other ways to inhibit tumor cell migration and metastasis.
Furthermore, patients with various tumors have been found to have elevated circulating concentrations of IL-10, which is known to be associated with tumor progression and metastasis [105]. Host defense peptides Ps-1Pb and Ps-2Pa, derived from Pseudhymenochirus merlini, have been shown to inhibit the release of IL-10 and have the potential to improve the efficacy of other chemotherapeutic drugs while also inhibiting metastasis. However, the effect of Ps-1Pb and Ps-2Pa on IL-10 and their mechanism of action on cancer cell metastasis require further exploration [105] (Figure 3).

3.5. Activating Tumor Immunity

Tumor cells exist within a complex tumor microenvironment. On one hand, the tumor cells can promote growth and metastasis by secreting transforming growth factor-β, vascular endothelial growth factor, and other factors. However, they also have various mechanisms, such as surveillance functions, that enable them to evade the immune system [106]. Consequently, targeting immune attacks and breaking immune escape has become a major area of research. Active substances secreted by amphibians are a crucial component of the innate immune defense system and can regulate various biological processes, including inflammation, injury, and even tumors.
In addition to inducing tumor cell apoptosis, HN-1 also has the ability to regulate cancer immune-related cytokines/chemokines such as IL-12 and MCP-1 and activate T lymphocytes, B lymphocytes, monocytes, and macrophages. The activation of CD4+ T cells leads to a significant increase in their proliferation as well as the activation of tumor-associated macrophages, resulting in an increased CD4+/CD8+ ratio and enhanced tumor immunity [69]. Similarly, Cinobufagin has been shown to stimulate the proliferation of splenocytes, enhance the phagocytosis of peritoneal macrophages, and promote the production of Th1-related cytokines interferon-γ and tumor necrosis factor-α while inhibiting the levels of Th2 cytokines interleukin-4 and interleukin-10. This leads to an increased Th1/Th2 ratio and has the potential to activate immunity in cancer [107]. Furthermore, Cinobufocini has the ability to inhibit TNF-α-induced inflammatory activation of NF-κB and COX-2 in lung adenocarcinoma cells, thereby exerting anticancer effects [108]. Natural killer cells, a crucial class of innate immune cells, perform tumor recognition and killing functions by regulating the balance of activating and inhibitory receptors without attacking healthy self-tissues [109]. Upon injection of Frenatin 2.1S, there was a significant increase in CD3-CD49b+ NK cells in the peritoneal cavity, leading to the cytotoxicity of NK cells through the mediation of Fas ligand (FasL) expression, resulting in cell lysis and the promotion of immune regulatory factor IL-10 production [110] (Figure 3).

3.6. Other Possible Ways to Relate to Oxidative Stress

Imbalance of redox homeostasis is a common characteristic in most cancers, which tend to maintain a high level of oxidation. This oxidative environment promotes both anti-oxidation and pro-oxidation therapeutic strategies [111]. The body’s production of reactive oxygen species (ROS) plays a crucial role in this process [111]. Research has demonstrated that ROS can participate in various stages of tumor development, including proliferation, invasion, metastasis, and angiogenesis. Additionally, ROS is closely associated with chronic inflammation, cell cycle regulation, and tumor suppressor gene expression [112]. Amphibian skin is known to engage in respiratory exercise, which also contributes to the regulation of redox levels in the body to some extent [7]. Further investigation is required to determine its potential role in cancer regulation. However, it has been proven that peptides secreted by the skin possess antioxidant effects, and certain peptides can inhibit cancer development by promoting ROS generation [113]. Yao Li et al. discovered that the level of ROS in U251 cells treated with 100 nM Bufalin increased by 4.93 times. Additionally, the ratio of glutathione (GSH) to oxidized glutathione (GSSG) and the adenosine triphosphate (ATP) content decreased significantly. These findings suggest that Bufalin promotes GSH consumption and affects ATP production in U251 cells. However, it remains unclear whether these changes ultimately result in cell apoptosis [113]. Similar results were also observed in Bufalin, which induces autophagy and cell death in human colorectal cancer cells by promoting the generation of ROS and activating JNK [76]. Bufadienolides were found to increase ROS levels in HeLa cells, cause cell cycle arrest in S and G2/M phases, and exhibit cytotoxic effects [114].
As mentioned earlier, although these anticancer substances caused changes in oxidative stress levels, whether it was because oxidative stress ultimately affects tumor progression has not been fully elucidated by the researchers, which is one of the questions that will need to be addressed in subsequent studies.

4. Application Strategies of Natural Anticancer Peptides and Proteins from Amphibians

4.1. Structural Modification

For decades, amphibians have been a valuable source of natural anticancer substances. However, the stability and bioavailability of these substances are limited, which reduces their effectiveness. To address this issue, structural modifications can be made to these natural compounds. By doing so, their pharmacological properties can be improved, and their efficacy as anticancer drugs can be enhanced. There are two primary methods for modifying subject molecules: the addition of positively charged residues and the incorporation of d-amino acids [115].
Under the condition of keeping the conservative amino acids unchanged, natural anticancer peptides can be altered through the substitution or modification of certain amino acids. This process can effectively reduce immunogenicity and toxicity while also increasing tolerance to proteases and enhancing anticancer activity. Brevinin-1OS (B1OS) was a wild-type des-Leu2 brevinin peptide from Odorrana schmackeri. Two variants, B1-OS-L and B1-OS-DL, were designed by adding L-leucine and d-leucine residues to the second-position leucine residues, respectively. It was discovered that their anticancer activity is approximately 10 times greater than B1OS. Interestingly, human non-small cell lung cancer cells cannot survive after 2 h of treatment with only 10 μM of d-leucine alone, significantly increasing the killing efficiency. Furthermore, this treatment showed low cytotoxicity to normal cells [32].
The cationic-enhancing analog t-DPH1-5K was designed using the peptide t-DPH1 from Phyllomedusa hypochondrialis. The study discovered that, by introducing two net positive charges, the MIC value of t-DPH1-5K decreased by 7–20 times on PC-3, H838, H157, and U251MG tumor cells [116]. A similar phenomenon was observed in the peptides found in Phyllomedusa sauvagii. By substituting two neutral amino acid residues with lysine and leucine residues at positions 10 and 11 in DPS3, we obtain L10,11-DPS3, which exhibits a significantly enhanced anticancer effect [117].
The high hydrophobicity of temporins often results in strong cytotoxicity towards normal cells, which presents a significant limitation in their application as anticancer peptides. This issue must be addressed in order to fully utilize their potential [118]. By substituting leucine 4 on the hydrophilic surface, we obtained a new derivative called temporin-PKE-3K. This derivative showed a significant reduction in its toxicity to HACAT cells [115]. The evaluation of six temporin-1CEa-derived peptides’ anticancer activity suggests that increasing cationicity while maintaining moderate hydrophobicity is an effective strategy to improve anticancer cytotoxicity and reduce hemolytic activity [119].

4.2. Combined with Other Drugs

In recent years, there has been a significant auxiliary effect in the field of cancer treatment through the combination of natural anticancer drugs with advanced technologies and materials (Figure 4). This also has led to the precise control of curative effects and targeting, resulting in improved outcomes in experimental studies and therapeutic effects on patients.

4.2.1. Combined with Radioimmunotherapy

Radioimmunotherapy (RIT) is an effective anticancer strategy established by binding radioisotopes to specific molecules that can recognize and selectively search for cancer cells [120]. In the field of diagnosis and treatment, there are numerous radionuclides utilized. However, iodine-131 stands out due to its longer half-life of 8.1 days and fewer side effects. This makes it a popular choice for clinical radioimmunoconjugates when it comes to radioisotope labeling [121].
In human anaplastic thyroid cancer, Lin Ruoting et al. developed a radioimmunocouple based on caerin 1.1 natural peptide combined with iodine labeling which has been shown to have multiple inhibitory effects on CAL62 cells. It can inhibit the phosphorylation of Akt, arrest cells in the S phase, induce apoptosis, activate immunity, and effectively inhibit the growth and migration of thyroid cancer when used in conjunction with radiotherapy. Further studies are required to determine whether this method is suitable for in situ treatment of anaplastic thyroid cancer [122].

4.2.2. Combined with Chemotherapy

Cisplatin is considered as the pioneer of platinum-based chemotherapeutic drugs, belonging to the first generation. Despite being one of the oldest chemotherapeutic drugs, it still holds a prominent position in clinical practice and is widely used. A meta-analysis showed that, compared with platinum-based chemotherapy (PBC) alone, Huachansu injection (HSC) + PBC significantly improved the 1-year and 2-year survival rates of patients with advanced NSCLC and reduced the adverse reactions of patients. This suggests that HCS may be a valuable adjuvant therapy for PBC in the treatment of advanced NSCLC. However, high-quality and more extensive sample size studies are needed to support this conclusion [123].
In their study, Jufeng Xia et al. discovered that the growth of HCC cells was significantly suppressed when cinobufacini and doxorubicin were used in combination. The combination group induced apoptosis more effectively by influencing the protein and RNA expression of apoptosis-related elements like Bcl-2, Bax, Bid, and cytochrome c. Additionally, as a mixture of components, it exhibited stronger apoptosis-inducing activity than a specific single component or a simple mixture of few components. In conclusion, combining cinobufacini and doxorubicin presents a promising new approach to inhibiting the proliferation of HCC cells [124].
Malignant mesothelioma is cancer that originates from mesothelial cells and is known for its aggressive nature. Unfortunately, there are limited clinical treatment options available for this disease. One promising option is a combination therapy involving pemetrexed and cisplatin, which has been shown to improve response rate, overall survival, and quality of life in mesothelioma patients [125]. However, it is essential to note that many patients treated with this therapy experience tumor progression or recurrence within a year [125]. Recent studies have shown that a sialic acid-binding lectin isolated from Rana catesbeiana oocytes has the potential as an anticancer agent. When tested on H28 cells in combination with pemetrexed, cisplatin, or alone, this lectin was found to decrease cell viability and proliferation levels and arrest the cell cycle. Compared with pemetrexed or cisplatin, cSBL has exhibited potent anticancer effects in various mesothelioma cell lines owing to its high selectivity for cancer cells and cytotoxic activity. The combination of pemetrexed and cSBL has shown a robust synergistic effect, which is similar to or even better than the conventional pemetrexed and cisplatin regimen [126].

4.2.3. Combined with PD-1 Immune Checkpoint Inhibitors

The use of immune checkpoint inhibitors has significantly enhanced the long-term response rates in patients with different types of solid tumors. Nevertheless, when used alone, immune checkpoint inhibitors like PD-12 and CTLA-4 blockade are not as effective in treating advanced cervical cancer [127]. A clinical trial has demonstrated that combining immune checkpoint PD-1 blockade with therapeutic vaccination results in a synergistic effect, leading to effective tumor control. Herein, Guoying Ni et al. demonstrated that administering caerin 1.1/1.9 peptide intratumorally, in combination with E7 antigen-specific immunotherapy and IL-10 and PD-1 blockade, improved the TC-1 tumor microenvironment (TME) and increased the efficacy of anti-PD-1 treatment in TC-1 tumor-bearing mice. The injection of caerin 1.1/1.9 peptides led to an increase in the number of M1 macrophages and NK cells, both of which exhibited elevated levels of immune activation. Additionally, the functions of M2 immunosuppressive macrophages and immunosuppressive B cells were reduced, which prolonged the peptide’s action time [128].

4.2.4. Combined with PARP Inhibitors

The inhibition of Poly (ADP-ribose) polymerase (PARP) is known to cause the accumulation of DNA strand breaks, resulting in cellular damage. As a result, PARP inhibitors (PARPi) have become a promising tool in the fight against various types of cancer [129]. The study found that using onconase with a PARPi, AZD2461, had a low synergistic effect. However, it was discovered that AZD2461 did not induce drug resistance in A375 cells even after being treated with high concentrations of the molecule for 2 months. In contrast, A375 cells that were treated with AZD2461 for a longer period became more susceptible to the pro-apoptotic effect of ONC compared to untreated A375 cells. This study can provide guidance on the clinical use of AZD2461 combination therapy [130].

4.2.5. Binding to Tumor Cell Targeted Receptors

In addition to chemotherapy, androgen deprivation therapy using luteinizing hormone-releasing hormone (LHRH) agonists or antagonists is an alternative treatment option for men with inoperable hormone-sensitive metastatic prostate cancer. However, this approach has not been effective in improving the median survival time of patients [131]. A potential solution to this problem is the use of Dermaseptins B2, a peptide derived from the Phyllomedusa bicolor, which is combined with hormonotoxin (H-B2) to target the LHRH receptor on the surface of prostate cancer cells. This optimization of the interaction between the peptide and the cell membrane shows promise in improving treatment outcomes for patients. The study revealed that, while the enrichment of cell surface receptors was not significant, the combination of Dermaseptins B2 with hormonotoxin can effectively reduce the toxic dose of Dermaseptins B2 alone. This finding indicates a promising avenue for targeted therapy through further optimization [132].

5. Prospects for the Development of Natural Anticancer Peptides and Proteins from Amphibians

Amphibians, as an ancient group, have the unique ability to adapt to both terrestrial and aquatic life. This evolutionary trait has also led to the development of their distinct adaptive immune and defense systems [133]. Due to their natural resistance to cancer, spontaneous tumors in amphibians are rare, and even in laboratory settings, it is challenging to induce tumors using chemical or biological methods. This natural advantage makes amphibians a promising source for mining anticancer substances [134]. With the advent of new technologies and methods to enhance drug efficacy and promote drug development and clinical transformation, it is expected that more highly effective anticancer substances will be discovered and elucidated. However, continuous efforts are still required to explore these possibilities.

Author Contributions

Conceptualization, Q.C.; Formal analysis, Q.C.; Investigation, J.W.; Methodology, X.L. and Z.Y.; Supervision, H.Y. and L.M.; Writing—original draft, Q.C. and J.W.; Writing—review & editing, Q.C. and L.M. Project administration, H.Y. and L.M. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by the Chinese National Natural Science Foundation (82160680, 81673401, 81560581) and the Natural Science Foundation of Yunnan Province (202101AY070001-004).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

Not applicable.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Soerjomataram, I.; Bray, F. Planning for tomorrow: Global cancer incidence and the role of prevention 2020–2070. Nat. Rev. Clin. Oncol. 2021, 18, 663–672. [Google Scholar] [CrossRef] [Scilit]
  2. Miller, K.D.; Nogueira, L.; Mariotto, A.B.; Rowland, J.H.; Yabroff, K.R.; Alfano, C.M.; Jemal, A.; Kramer, J.L.; Siegel, R.L. Cancer treatment and survivorship statistics, 2019. CA A Cancer J. Clin. 2019, 69, 363–385. [Google Scholar] [CrossRef] [Scilit]
  3. Schirrmacher, V. From chemotherapy to biological therapy: A review of novel concepts to reduce the side effects of systemic cancer treatment (Review). Int. J. Oncol. 2019, 54, 407–419. [Google Scholar] [CrossRef] [Scilit]
  4. Kim, C.; Kim, B. Anti-Cancer Natural Products and Their Bioactive Compounds Inducing ER Stress-Mediated Apoptosis: A Review. Nutrients 2018, 10, 1021. [Google Scholar] [CrossRef] [Scilit]
  5. Bade, R.; Chan, H.F.; Reynisson, J. Characteristics of known drug space. Natural products, their derivatives and synthetic drugs. Eur. J. Med. Chem. 2010, 45, 5646–5652. [Google Scholar] [CrossRef] [Scilit]
  6. Conlon, J.M.; Woodhams, D.C.; Raza, H.; Coquet, L.; Leprince, J.; Jouenne, T.; Vaudry, H.; Rollins-Smith, L.A. Peptides with differential cytolytic activity from skin secretions of the lemur leaf frog Hylomantis lemur (Hylidae: Phyllomedusinae). Toxicon 2007, 50, 498–506. [Google Scholar] [CrossRef] [Scilit]
  7. Varga, J.F.A.; Bui-Marinos, M.P.; Katzenback, B.A. Frog Skin Innate Immune Defences: Sensing and Surviving Pathogens. Front. Immunol. 2018, 9, 3128. [Google Scholar] [CrossRef] [Scilit]
  8. Ni, G.; Chen, S.; Chen, M.; Wu, J.; Yang, B.; Yuan, J.; Walton, S.F.; Li, H.; Wei, M.Q.; Wang, Y.; et al. Host-Defense Peptides Caerin 1.1 and 1.9 Stimulate TNF-Alpha-Dependent Apoptotic Signals in Human Cervical Cancer HeLa Cells. Front. Cell Dev. Biol. 2020, 8, 676. [Google Scholar] [CrossRef] [Scilit]
  9. Bhattacharjee, P.; Giri, B.; Gomes, A. Apoptogenic activity and toxicity studies of a cytotoxic protein (BMP1) from the aqueous extract of common Indian toad (Bufo melanostictus Schneider) skin. Toxicon 2011, 57, 225–236. [Google Scholar] [CrossRef] [Scilit]
  10. Dong, Z.; Hu, H.; Yu, X.; Tan, L.; Ma, C.; Xi, X.; Li, L.; Wang, L.; Zhou, M.; Chen, T.; et al. Novel Frog Skin-Derived Peptide Dermaseptin-PP for Lung Cancer Treatment: In vitro/vivo Evaluation and Anti-tumor Mechanisms Study. Front. Chem. 2020, 8, 476. [Google Scholar] [CrossRef] [Scilit]
  11. Kariya, Y.; Tatsuta, T.; Sugawara, S.; Kariya, Y.; Nitta, K.; Hosono, M. RNase activity of sialic acid-binding lectin from bullfrog eggs drives antitumor effect via the activation of p38 MAPK to caspase-3/7 signaling pathway in human breast cancer cells. Int. J. Oncol. 2016, 49, 1334–1342. [Google Scholar] [CrossRef] [Scilit]
  12. Bobone, S.; Stella, L. Selectivity of Antimicrobial Peptides: A Complex Interplay of Multiple Equilibria. Adv. Exp. Med. Biol. 2019, 1117, 175–214. [Google Scholar]
  13. Conlon, J.M.; Mechkarska, M.; Lukic, M.L.; Flatt, P.R. Potential therapeutic applications of multifunctional host-defense peptides from frog skin as anti-cancer, anti-viral, immunomodulatory, and anti-diabetic agents. Peptides 2014, 57, 67–77. [Google Scholar] [CrossRef] [Scilit]
  14. Jia, J.; Li, J.; Zheng, Q.; Li, D. A research update on the antitumor effects of active components of Chinese medicine ChanSu. Front. Oncol. 2022, 12, 1014637. [Google Scholar] [CrossRef] [Scilit]
  15. Rozek, T.; Wegener, K.L.; Bowie, J.H.; Olver, I.N.; Carver, J.A.; Wallace, J.C.; Tyler, M.J. The antibiotic and anticancer active aurein peptides from the Australian Bell Frogs Litoria aurea and Litoria raniformis the solution structure of aurein 1.2. Eur. J. Biochem. 2000, 267, 5330–5341. [Google Scholar] [CrossRef] [Scilit]
  16. Lai, R.; Zheng, Y.T.; Shen, J.H.; Liu, G.J.; Liu, H.; Lee, W.H.; Tang, S.Z.; Zhang, Y. Antimicrobial peptides from skin secretions of Chinese red belly toad Bombina maxima. Peptides 2002, 23, 427–435. [Google Scholar] [CrossRef] [Scilit]
  17. Swithenbank, L.; Cox, P.; Harris, L.G.; Dudley, E.; Sinclair, K.; Lewis, P.; Cappiello, F.; Morgan, C. Temporin A and Bombinin H2 Antimicrobial Peptides Exhibit Selective Cytotoxicity to Lung Cancer Cells. Scientifica 2020, 2020, 3526286. [Google Scholar] [CrossRef] [Scilit]
  18. Mignogna, G.; Simmaco, M.; Kreil, G.; Barra, D. Antibacterial and haemolytic peptides containing D-alloisoleucine from the skin of Bombina variegata. EMBO J. 1993, 12, 4829–4832. [Google Scholar] [CrossRef] [Scilit]
  19. Simmaco, M.; Mignogna, G.; Canofeni, S.; Miele, R.; Mangoni, M.L.; Barra, D. Temporins, antimicrobial peptides from the European red frog Rana temporaria. Eur. J. Biochem. 1996, 242, 788–792. [Google Scholar] [CrossRef] [Scilit]
  20. Rinaldi, A.C.; Mangoni, M.L.; Rufo, A.; Luzi, C.; Barra, D.; Zhao, H.; Kinnunen, P.K.; Bozzi, A.; Di Giulio, A.; Simmaco, M. Temporin L: Antimicrobial, haemolytic and cytotoxic activities, and effects on membrane permeabilization in lipid vesicles. Biochem. J. 2002, 368 Pt 1, 91–100. [Google Scholar] [CrossRef] [Scilit]
  21. Conlon, J.M.; Al-Kharrge, R.; Ahmed, E.; Raza, H.; Galadari, S.; Condamine, E. Effect of aminoisobutyric acid (Aib) substitutions on the antimicrobial and cytolytic activities of the frog skin peptide, temporin-1DRa. Peptides 2007, 28, 2075–2080. [Google Scholar] [CrossRef] [Scilit]
  22. Sang, M.; Wu, Q.; Xi, X.; Ma, C.; Wang, L.; Zhou, M.; Burrows, J.F.; Chen, T. Identification and target-modifications of temporin-PE: A novel antimicrobial peptide in the defensive skin secretions of the edible frog, Pelophylax kl. esculentus. Biochem. Biophys. Res. Commun. 2018, 495, 2539–2546. [Google Scholar] [CrossRef] [Scilit]
  23. Mechkarska, M.; Attoub, S.; Sulaiman, S.; Pantic, J.; Lukic, M.L.; Conlon, J.M. Anti-cancer, immunoregulatory, and antimicrobial activities of the frog skin host-defense peptides pseudhymenochirin-1Pb and pseudhymenochirin-2Pa. Regul. Pept. 2014, 194–195, 69–76. [Google Scholar] [CrossRef] [Scilit]
  24. van Zoggel, H.; Hamma-Kourbali, Y.; Galanth, C.; Ladram, A.; Nicolas, P.; Courty, J.; Amiche, M.; Delbé, J. Antitumor and angiostatic peptides from frog skin secretions. Amino Acids 2012, 42, 385–395. [Google Scholar] [CrossRef] [Scilit]
  25. Charpentier, S.; Amiche, M.; Mester, J.; Vouille, V.; Le Caer, J.P.; Nicolas, P.; Delfour, A. Structure, synthesis, and molecular cloning of dermaseptins B, a family of skin peptide antibiotics. J. Biol. Chem. 1998, 273, 14690–14697. [Google Scholar] [CrossRef] [Scilit]
  26. Zhu, H.; Ding, X.; Li, W.; Lu, T.; Ma, C.; Xi, X.; Wang, L.; Zhou, M.; Burden, R.; Chen, T. Discovery of two skin-derived dermaseptins and design of a TAT-fusion analogue with broad-spectrum antimicrobial activity and low cytotoxicity on healthy cells. PeerJ 2018, 6, e5635. [Google Scholar] [CrossRef] [Scilit]
  27. Shi, D.; Hou, X.; Wang, L.; Gao, Y.; Wu, D.; Xi, X.; Zhou, M.; Kwok, H.F.; Duan, J.; Chen, T.; et al. Two Novel Dermaseptin-Like Antimicrobial Peptides with Anticancer Activities from the Skin Secretion of Pachymedusa dacnicolor. Toxins 2016, 8, 144. [Google Scholar] [CrossRef] [Scilit]
  28. Huang, L.; Chen, D.; Wang, L.; Lin, C.; Ma, C.; Xi, X.; Chen, T.; Shaw, C.; Zhou, M. Dermaseptin-PH: A Novel Peptide with Antimicrobial and Anticancer Activities from the Skin Secretion of the South American Orange-Legged Leaf Frog, Pithecopus (Phyllomedusa) hypochondrialis. Molecules 2017, 22, 1805. [Google Scholar] [CrossRef] [Scilit]
  29. Chen, D.; Zhou, X.; Chen, X.; Huang, L.; Xi, X.; Ma, C.; Zhou, M.; Wang, L.; Chen, T. Evaluating the Bioactivity of a Novel Antimicrobial and Anticancer Peptide, Dermaseptin-PS4(Der-PS4), from the Skin Secretion of Phyllomedusa sauvagii. Molecules 2019, 24, 2974. [Google Scholar] [CrossRef] [Scilit]
  30. Jiang, Y.; Wu, Y.; Wang, T.; Chen, X.; Zhou, M.; Ma, C.; Xi, X.; Zhang, Y.; Chen, T.; Shaw, C.; et al. Brevinin-1GHd: A novel Hylarana guentheri skin secretion-derived Brevinin-1 type peptide with antimicrobial and anticancer therapeutic potential. Biosci. Rep. 2020, 40, BSR20200019. [Google Scholar] [CrossRef] [Scilit]
  31. Pei, X.; Gong, Z.; Wu, Q.; Chen, X.; Wang, L.; Ma, C.; Xi, X.; Chen, T.; Shaw, C.; Zhou, M. Characterisation of a novel peptide, Brevinin-1H, from the skin secretion of Amolops hainanensis and rational design of several analogues. Chem. Biol. Drug Des. 2021, 97, 273–282. [Google Scholar] [CrossRef] [Scilit]
  32. Yao, A.; Ma, Y.; Chen, X.; Zhou, M.; Xi, X.; Ma, C.; Ren, S.; Chen, T.; Shaw, C.; Wang, L. Modification Strategy of D-leucine Residue Addition on a Novel Peptide from Odorrana schmackeri, with Enhanced Bioactivity and In Vivo Efficacy. Toxins 2021, 13, 611. [Google Scholar] [CrossRef] [Scilit]
  33. Peng, X.; Zhou, C.; Hou, X.; Liu, Y.; Wang, Z.; Peng, X.; Zhang, Z.; Wang, R.; Kong, D. Molecular characterization and bioactivity evaluation of two novel bombinin peptides from the skin secretion of Oriental fire-bellied toad, Bombina orientalis. Amino Acids 2018, 50, 241–253. [Google Scholar] [CrossRef] [Scilit]
  34. Zhou, C.; Wang, Z.; Peng, X.; Liu, Y.; Lin, Y.; Zhang, Z.; Qiu, Y.; Jin, M.; Wang, R.; Kong, D. Discovery of two bombinin peptides with antimicrobial and anticancer activities from the skin secretion of Oriental fire-bellied toad, Bombina orientalis. Chem. Biol. Drug Des. 2018, 91, 50–61. [Google Scholar] [CrossRef] [Scilit]
  35. Lyu, P.; Ge, L.; Ma, R.; Wei, R.; McCrudden, C.M.; Chen, T.; Shaw, C.; Kwok, H.F. Identification and pharmaceutical evaluation of novel frog skin-derived serine proteinase inhibitor peptide-PE-BBI (Pelophylax esculentus Bowman-Birk inhibitor) for the potential treatment of cancer. Sci. Rep. 2018, 8, 14502. [Google Scholar] [CrossRef] [Scilit]
  36. Liu, Y.; Du, Q.; Ma, C.; Xi, X.; Wang, L.; Zhou, M.; Burrows, J.F.; Chen, T.; Wang, H. Structure-activity relationship of an antimicrobial peptide, Phylloseptin-PHa: Balance of hydrophobicity and charge determines the selectivity of bioactivities. Drug Des. Dev. Ther. 2019, 13, 447–458. [Google Scholar] [CrossRef] [Scilit]
  37. Conlon, J.M.; Mechkarska, M.; Prajeep, M.; Arafat, K.; Zaric, M.; Lukic, M.L.; Attoub, S. Transformation of the naturally occurring frog skin peptide, alyteserin-2a into a potent, non-toxic anti-cancer agent. Amino Acids 2013, 44, 715–723. [Google Scholar] [CrossRef] [Scilit]
  38. Zhang, L.; Chen, X.; Wu, Y.; Zhou, M.; Ma, C.; Xi, X.; Chen, T.; Walker, B.; Shaw, C.; Wang, L. A Bowman-Birk type chymotrypsin inhibitor peptide from the amphibian, Hylarana erythraea. Sci. Rep. 2018, 8, 5851. [Google Scholar] [CrossRef] [Scilit]
  39. Chen, X.; Zhang, L.; Ma, C.; Zhang, Y.; Xi, X.; Wang, L.; Zhou, M.; Burrows, J.F.; Chen, T. A novel antimicrobial peptide, Ranatuerin-2PLx, showing therapeutic potential in inhibiting proliferation of cancer cells. Biosci. Rep. 2018, 38, BSR20180710. [Google Scholar] [CrossRef] [Scilit]
  40. Attoub, S.; Arafat, H.; Mechkarska, M.; Conlon, J.M. Anti-tumor activities of the host-defense peptide hymenochirin-1B. Regul. Pept. 2013, 187, 51–56. [Google Scholar] [CrossRef] [Scilit]
  41. Attoub, S.; Mechkarska, M.; Sonnevend, A.; Radosavljevic, G.; Jovanovic, I.; Lukic, M.L.; Conlon, J.M. Esculentin-2CHa: A host-defense peptide with differential cytotoxicity against bacteria, erythrocytes and tumor cells. Peptides 2013, 39, 95–102. [Google Scholar] [CrossRef] [Scilit]
  42. Santana, C.J.C.; Magalhães, A.C.M.; Dos Santos Júnior, A.C.M.; Ricart, C.A.O.; Lima, B.D.; Álvares, A.; Freitas, S.M.; Pires, O.R., Jr.; Fontes, W.; Castro, M.S. Figainin 1, a Novel Amphibian Skin Peptide with Antimicrobial and Antiproliferative Properties. Antibiotics 2020, 9, 625. [Google Scholar] [CrossRef] [Scilit]
  43. Abdelfatah, S.; Lu, X.; Schmeda-Hirschmann, G.; Efferth, T. Cytotoxicity and antimitotic activity of Rhinella schneideri and Rhinella marina venoms. J. Ethnopharmacol. 2019, 242, 112049. [Google Scholar] [CrossRef] [Scilit]
  44. Zhang, D.M.; Liu, J.S.; Deng, L.J.; Chen, M.F.; Yiu, A.; Cao, H.H.; Tian, H.Y.; Fung, K.P.; Kurihara, H.; Pan, J.X.; et al. Arenobufagin, a natural bufadienolide from toad venom, induces apoptosis and autophagy in human hepatocellular carcinoma cells through inhibition of PI3K/Akt/mTOR pathway. Carcinogenesis 2013, 34, 1331–1342. [Google Scholar] [CrossRef] [Scilit]
  45. Wang, W.; Wu, S.; Cen, Z.; Zhang, Y.; Chen, Y.; Huang, Y.; Cillo, A.R.; Prokopec, J.S.; Quarato, G.; Vignali, D.A.A.; et al. Mobilizing phospholipids on tumor plasma membrane implicates phosphatidylserine externalization blockade for cancer immunotherapy. Cell Rep. 2022, 41, 111582. [Google Scholar] [CrossRef] [Scilit]
  46. Ran, S.; Downes, A.; Thorpe, P.E. Increased exposure of anionic phospholipids on the surface of tumor blood vessels. Cancer Res. 2002, 62, 6132–6140. [Google Scholar]
  47. Wang, C.; Tian, L.L.; Li, S.; Li, H.B.; Zhou, Y.; Wang, H.; Yang, Q.Z.; Ma, L.J.; Shang, D.J. Rapid cytotoxicity of antimicrobial peptide tempoprin-1CEa in breast cancer cells through membrane destruction and intracellular calcium mechanism. PLoS ONE 2013, 8, e60462. [Google Scholar] [CrossRef] [Scilit]
  48. Wang, C.; Chen, Y.W.; Zhang, L.; Gong, X.G.; Zhou, Y.; Shang, D.J. Melanoma cell surface-expressed phosphatidylserine as a therapeutic target for cationic anticancer peptide, temporin-1CEa. J. Drug Target. 2016, 24, 548–556. [Google Scholar] [CrossRef] [Scilit]
  49. Dennison, S.R.; Harris, F.; Phoenix, D.A. Investigations into the potential anticancer activity of Maximin H5. Biochimie 2017, 137, 29–34. [Google Scholar] [CrossRef] [Scilit]
  50. Doyle, J.; Brinkworth, C.S.; Wegener, K.L.; Carver, J.A.; Llewellyn, L.E.; Olver, I.N.; Bowie, J.H.; Wabnitz, P.A.; Tyler, M.J. nNOS inhibition, antimicrobial and anticancer activity of the amphibian skin peptide, citropin 1.1 and synthetic modifications. The solution structure of a modified citropin 1.1. Eur. J. Biochem. 2003, 270, 1141–1153. [Google Scholar] [CrossRef] [Scilit]
  51. Lehmann, J.; Retz, M.; Sidhu, S.S.; Suttmann, H.; Sell, M.; Paulsen, F.; Harder, J.; Unteregger, G.; Stöckle, M. Antitumor activity of the antimicrobial peptide magainin II against bladder cancer cell lines. Eur. Urol. 2006, 50, 141–147. [Google Scholar] [CrossRef] [Scilit]
  52. Conlon, J.M.; Galadari, S.; Raza, H.; Condamine, E. Design of potent, non-toxic antimicrobial agents based upon the naturally occurring frog skin peptides, ascaphin-8 and peptide XT-7. Chem. Biol. Drug Des. 2008, 72, 58–64. [Google Scholar] [CrossRef] [Scilit]
  53. Li, M.; Xi, X.; Ma, C.; Chen, X.; Zhou, M.; Burrows, J.F.; Chen, T.; Wang, L. A Novel Dermaseptin Isolated from the Skin Secretion of Phyllomedusa tarsius and Its Cationicity-Enhanced Analogue Exhibiting Effective Antimicrobial and Anti-Proliferative Activities. Biomolecules 2019, 9, 628. [Google Scholar] [CrossRef] [Scilit]
  54. Long, Q.; Li, L.; Wang, H.; Li, M.; Wang, L.; Zhou, M.; Su, Q.; Chen, T.; Wu, Y. Novel peptide dermaseptin-PS1 exhibits anticancer activity via induction of intrinsic apoptosis signalling. J. Cell. Mol. Med. 2019, 23, 1300–1312. [Google Scholar] [CrossRef] [Scilit]
  55. Li, B.; Lyu, P.; Xie, S.; Qin, H.; Pu, W.; Xu, H.; Chen, T.; Shaw, C.; Ge, L.; Kwok, H.F. LFB: A Novel Antimicrobial Brevinin-Like Peptide from the Skin Secretion of the Fujian Large Headed Frog, Limnonectes fujianensi. Biomolecules 2019, 9, 242. [Google Scholar] [CrossRef] [Scilit]
  56. Wang, C.; Zhou, Y.; Li, S.; Li, H.; Tian, L.; Wang, H.; Shang, D. Anticancer mechanisms of temporin-1CEa, an amphipathic α-helical antimicrobial peptide, in Bcap-37 human breast cancer cells. Life Sci. 2013, 92, 1004–1014. [Google Scholar] [CrossRef] [Scilit]
  57. Giri, B.; Gomes, A.; Debnath, A.; Saha, A.; Biswas, A.K.; Dasgupta, S.C.; Gomes, A. Antiproliferative, cytotoxic and apoptogenic activity of Indian toad (Bufo melanostictus, Schneider) skin extract on U937 and K562 cells. Toxicon 2006, 48, 388–400. [Google Scholar] [CrossRef] [Scilit]
  58. Libério, M.S.; Joanitti, G.A.; Azevedo, R.B.; Cilli, E.M.; Zanotta, L.C.; Nascimento, A.C.; Sousa, M.V.; Pires Júnior, O.R.; Fontes, W.; Castro, M.S. Anti-proliferative and cytotoxic activity of pentadactylin isolated from Leptodactylus labyrinthicus on melanoma cells. Amino Acids 2011, 40, 51–59. [Google Scholar] [CrossRef] [Scilit]
  59. Gomes, A.; Giri, B.; Alam, A.; Mukherjee, S.; Bhattacharjee, P.; Gomes, A. Anticancer activity of a low immunogenic protein toxin (BMP1) from Indian toad (Bufo melanostictus, Schneider) skin extract. Toxicon 2011, 58, 85–92. [Google Scholar] [CrossRef] [Scilit]
  60. Collado, M.; Serrano, M. Senescence in tumours: Evidence from mice and humans. Nat. Rev. Cancer 2010, 10, 51–57. [Google Scholar] [CrossRef] [Scilit]
  61. Harrison, V.; Khan, S.F.; Damerell, V.; Bleloch, J.; ArulJothi, K.N.; Sinkala, M.; Lennard, K.; Mulder, N.; Calder, B.; Blackburn, J.; et al. Strongylopus grayii tadpole blastema extract exerts cytotoxic effects on embryonal rhabdomyosarcoma cells. Vitr. Cell. Dev. Biol. Anim. 2022, 58, 679–692. [Google Scholar] [CrossRef] [Scilit]
  62. Zhang, Y.; Dong, Y.; Melkus, M.W.; Yin, S.; Tang, S.N.; Jiang, P.; Pramanik, K.; Wu, W.; Kim, S.; Ye, M.; et al. Role of P53-Senescence Induction in Suppression of LNCaP Prostate Cancer Growth by Cardiotonic Compound Bufalin. Mol. Cancer Ther. 2018, 17, 2341–2352. [Google Scholar] [CrossRef] [Scilit]
  63. Ardelt, W.; Ardelt, B.; Darzynkiewicz, Z. Ribonucleases as potential modalities in anticancer therapy. Eur. J. Pharmacol. 2009, 625, 181–189. [Google Scholar] [CrossRef] [Scilit]
  64. Yiang, G.T.; Tsai, H.F.; Chen, J.R.; Chou, P.L.; Wu, T.K.; Liu, H.C.; Chang, W.J.; Liu, L.C.; Tseng, H.H.; Yu, Y.L. RC-6 ribonuclease induces caspase activation, cellular senescence and neuron-like morphology in NT2 embryonal carcinoma cells. Oncol. Rep. 2014, 31, 1738–1744. [Google Scholar] [CrossRef] [Scilit]
  65. Obeng, E. Apoptosis (programmed cell death) and its signals—A review. Braz. J. Biol. 2021, 81, 1133–1143. [Google Scholar] [CrossRef] [Scilit]
  66. Lee, H.S.; Park, C.B.; Kim, J.M.; Jang, S.A.; Park, I.Y.; Kim, M.S.; Cho, J.H.; Kim, S.C. Mechanism of anticancer activity of buforin IIb, a histone H2A-derived peptide. Cancer Lett. 2008, 271, 47–55. [Google Scholar] [CrossRef] [Scilit]
  67. Ju, X.; Fan, D.; Kong, L.; Yang, Q.; Zhu, Y.; Zhang, S.; Su, G.; Li, Y. Antimicrobial Peptide Brevinin-1RL1 from Frog Skin Secretion Induces Apoptosis and Necrosis of Tumor Cells. Molecules 2021, 26, 2059. [Google Scholar] [CrossRef] [Scilit]
  68. Giampazolias, E.; Tait, S.W.G. Caspase-independent cell death: An anti-cancer double whammy. Cell Cycle 2018, 17, 269–270. [Google Scholar] [CrossRef] [Scilit]
  69. Qiao, X.; Yang, H.; Gao, J.; Cai, S.; Shi, N.; Wang, M.; Wang, Y.; Yu, H. A small cytotoxic peptide from frog elicits potent antitumor immunity to prevent local tumor growth and metastases. Future Med. Chem. 2019, 11, 2505–2525. [Google Scholar] [CrossRef] [Scilit]
  70. Ichimiya, T.; Yamakawa, T.; Hirano, T.; Yokoyama, Y.; Hayashi, Y.; Hirayama, D.; Wagatsuma, K.; Itoi, T.; Nakase, H. Autophagy and Autophagy-Related Diseases: A Review. Int. J. Mol. Sci. 2020, 21, 8974. [Google Scholar] [CrossRef] [Scilit]
  71. Hamurcu, Z.; Delibaşı, N.; Nalbantoglu, U.; Sener, E.F.; Nurdinov, N.; Tascı, B.; Taheri, S.; Özkul, Y.; Donmez-Altuntas, H.; Canatan, H.; et al. FOXM1 plays a role in autophagy by transcriptionally regulating Beclin-1 and LC3 genes in human triple-negative breast cancer cells. J. Mol. Med. 2019, 97, 491–508. [Google Scholar] [CrossRef] [Scilit]
  72. Ma, K.; Zhang, C.; Huang, M.Y.; Li, W.Y.; Hu, G.Q. Cinobufagin induces autophagy-mediated cell death in human osteosarcoma U2OS cells through the ROS/JNK/p38 signaling pathway. Oncol. Rep. 2016, 36, 90–98. [Google Scholar] [CrossRef] [Scilit]
  73. Xia, H.; Green, D.R.; Zou, W. Autophagy in tumour immunity and therapy. Nat. Rev. Cancer 2021, 21, 281–297. [Google Scholar] [CrossRef] [Scilit]
  74. Xiong, X.; Lu, B.; Tian, Q.; Zhang, H.; Wu, M.; Guo, H.; Zhang, Q.; Li, X.; Zhou, T.; Wang, Y. Inhibition of autophagy enhances cinobufagin-induced apoptosis in gastric cancer. Oncol. Rep. 2019, 41, 492–500. [Google Scholar] [CrossRef] [Scilit]
  75. Sheng, X.; Zhu, P.; Qin, J.; Li, Q. The biological role of autophagy in regulating and controlling the proliferation of liver cancer cells induced by bufalin. Oncol. Rep. 2018, 39, 2931–2941. [Google Scholar] [CrossRef] [Scilit]
  76. Xie, C.M.; Chan, W.Y.; Yu, S.; Zhao, J.; Cheng, C.H. Bufalin induces autophagy-mediated cell death in human colon cancer cells through reactive oxygen species generation and JNK activation. Free. Radic. Biol. Med. 2011, 51, 1365–1375. [Google Scholar] [CrossRef] [Scilit]
  77. Shen, S.; Zhang, Y.; Wang, Z.; Liu, R.; Gong, X. Bufalin induces the interplay between apoptosis and autophagy in glioma cells through endoplasmic reticulum stress. Int. J. Biol. Sci. 2014, 10, 212–224. [Google Scholar] [CrossRef] [Scilit]
  78. Yiang, G.T.; Yu, Y.L.; Chou, P.L.; Tsai, H.F.; Chen, L.A.; Chen, Y.H.; Su, K.J.; Wang, J.J.; Bau, D.T.; Wei, C.W. The cytotoxic protein can induce autophagocytosis in addition to apoptosis in MCF-7 human breast cancer cells. In Vivo 2012, 26, 403–409. [Google Scholar]
  79. Ghavami, G.; Kiasari, R.E.; Pakzad, F.; Sardari, S. Effect of metformin alone and in combination with etoposide and epirubicin on proliferation, apoptosis, necrosis, and migration of B-CPAP and SW cells as thyroid cancer cell lines. Res. Pharm. Sci. 2023, 18, 185–201. [Google Scholar]
  80. Khan, I.; Yousif, A.; Chesnokov, M.; Hong, L.; Chefetz, I. A decade of cell death studies: Breathing new life into necroptosis. Pharmacol. Ther. 2021, 220, 107717. [Google Scholar] [CrossRef] [Scilit]
  81. Li, Y.; Gong, P.; Kong, C.; Tian, X. Bufalin engages in RIP1-dependent and ROS-dependent programmed necroptosis in breast cancer cells by targeting the RIP1/RIP3/PGAM5 pathway. Anti-Cancer Drugs 2019, 30, e0770. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  82. Liu, X.D.; Song, C.Y.; Kong, C.C.; Tian, X. Bufalin Induces Programmed Necroptosis in Triple-Negative Breast Cancer Drug-Resistant Cell Lines through RIP1/ROS-Mediated Pathway. Chin. J. Integr. Med. 2022, 28, 900–908. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  83. Tummers, B.; Green, D.R. Caspase-8: Regulating life and death. Immunol. Rev. 2017, 277, 76–89. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  84. LingHu, H.R.; Luo, H.; Gang, L. Bufalin Induces Glioma Cell Death by Apoptosis or Necroptosis. OncoTargets Ther. 2020, 13, 4767–4778. [Google Scholar] [CrossRef] [Scilit]
  85. Lo, Y.L.; Fang, Y.H.; Chiu, Y.J.; Chang, C.Y.; Lee, C.H.; Liao, Z.X.; Wang, L.F. Light- and Redox-Responsive Block Copolymers of mPEG-SS-ONBMA as a Smart Drug Delivery Carrier for Cancer Therapy. Pharmaceutics 2022, 14, 2594. [Google Scholar] [CrossRef] [Scilit]
  86. Ghavami, S.; Asoodeh, A.; Klonisch, T.; Halayko, A.J.; Kadkhoda, K.; Kroczak, T.J.; Gibson, S.B.; Booy, E.P.; Naderi-Manesh, H.; Los, M. Brevinin-2R(1) semi-selectively kills cancer cells by a distinct mechanism, which involves the lysosomal-mitochondrial death pathway. J. Cell. Mol. Med. 2008, 12, 1005–1022. [Google Scholar] [CrossRef] [Scilit]
  87. Du, W.; Gu, M.; Hu, M.; Pinchi, P.; Chen, W.; Ryan, M.; Nold, T.; Bannaga, A.; Xu, H. Lysosomal Zn2+ release triggers rapid, mitochondria-mediated, non-apoptotic cell death in metastatic melanoma. Cell Rep. 2021, 37, 109848. [Google Scholar] [CrossRef] [Scilit]
  88. La Porta, S.; Roth, L.; Singhal, M.; Mogler, C.; Spegg, C.; Schieb, B.; Qu, X.; Adams, R.H.; Baldwin, H.S.; Savant, S.; et al. Endothelial Tie1-mediated angiogenesis and vascular abnormalization promote tumor progression and metastasis. J. Clin. Investig. 2018, 128, 834–845. [Google Scholar] [CrossRef] [Scilit]
  89. van Zoggel, H.; Carpentier, G.; Dos Santos, C.; Hamma-Kourbali, Y.; Courty, J.; Amiche, M.; Delbé, J. Antitumor and angiostatic activities of the antimicrobial peptide dermaseptin B2. PLoS ONE 2012, 7, e44351. [Google Scholar] [CrossRef] [Scilit]
  90. Yang, H.; Liu, Y.; Zhao, M.M.; Guo, Q.; Zheng, X.K.; Liu, D.; Zeng, K.W.; Tu, P.F. Therapeutic potential of targeting membrane-spanning proteoglycan SDC4 in hepatocellular carcinoma. Cell Death Dis. 2021, 12, 492. [Google Scholar] [CrossRef] [Scilit]
  91. Fang, K.; Zhan, Y.; Zhu, R.; Wang, Y.; Wu, C.; Sun, M.; Qiu, Y.; Yuan, Z.; Liang, X.; Yin, P.; et al. Bufalin suppresses tumour microenvironment-mediated angiogenesis by inhibiting the STAT3 signalling pathway. J. Transl. Med. 2021, 19, 383. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  92. Pastushenko, I.; Blanpain, C. EMT Transition States during Tumor Progression and Metastasis. Trends Cell Biol. 2019, 29, 212–226. [Google Scholar] [CrossRef] [Scilit]
  93. Mirzaei, S.; Saghari, S.; Bassiri, F.; Raesi, R.; Zarrabi, A.; Hushmandi, K.; Sethi, G.; Tergaonkar, V. NF-κB as a regulator of cancer metastasis and therapy response: A focus on epithelial-mesenchymal transition. J. Cell. Physiol. 2022, 237, 2770–2795. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  94. Zhao, J.; Zhang, Q.; Zou, G.; Gao, G.; Yue, Q. Arenobufagin, isolated from toad venom, inhibited epithelial-to-mesenchymal transition and suppressed migration and invasion of lung cancer cells via targeting IKKβ/NFκB signal cascade. J. Ethnopharmacol. 2020, 250, 112492. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  95. Schatoff, E.M.; Goswami, S.; Zafra, M.P.; Foronda, M.; Shusterman, M.; Leach, B.I.; Katti, A.; Diaz, B.J.; Dow, L.E. Distinct Colorectal Cancer-Associated APC Mutations Dictate Response to Tankyrase Inhibition. Cancer Discov. 2019, 9, 1358–1371. [Google Scholar] [PubMed]
  96. Ghosh, N.; Hossain, U.; Mandal, A.; Sil, P.C. The Wnt signaling pathway: A potential therapeutic target against cancer. Ann. N. Y. Acad. Sci. 2019, 1443, 54–74. [Google Scholar] [CrossRef] [Scilit]
  97. Wang, J.; Cai, H.; Liu, Q.; Xia, Y.; Xing, L.; Zuo, Q.; Zhang, Y.; Chen, C.; Xu, K.; Yin, P.; et al. Cinobufacini Inhibits Colon Cancer Invasion and Metastasis via Suppressing Wnt/β-Catenin Signaling Pathway and EMT. Am. J. Chin. Med. 2020, 48, 703–718. [Google Scholar] [CrossRef] [Scilit]
  98. Bruno, A.; Bassani, B.; D’Urso, D.G.; Pitaku, I.; Cassinotti, E.; Pelosi, G.; Boni, L.; Dominioni, L.; Noonan, D.M.; Mortara, L.; et al. Angiogenin and the MMP9-TIMP2 axis are up-regulated in proangiogenic, decidual NK-like cells from patients with colorectal cancer. FASEB J. 2018, 32, 5365–5377. [Google Scholar] [CrossRef] [Scilit]
  99. Yin, J.H.; Zhu, X.Y.; Shi, W.D.; Liu, L.M. Huachansu injection inhibits metastasis of pancreatic cancer in mice model of human tumor xenograft. BMC Complement. Altern. Med. 2014, 14, 483. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  100. Tauriello, D.V.F.; Palomo-Ponce, S.; Stork, D.; Berenguer-Llergo, A.; Badia-Ramentol, J.; Iglesias, M.; Sevillano, M.; Ibiza, S.; Cañellas, A.; Hernando-Momblona, X.; et al. TGFβ drives immune evasion in genetically reconstituted colon cancer metastasis. Nature 2018, 554, 538–543. [Google Scholar] [CrossRef] [Scilit]
  101. Wang, H.; Zhang, C.; Xu, L.; Zang, K.; Ning, Z.; Jiang, F.; Chi, H.; Zhu, X.; Meng, Z. Bufalin suppresses hepatocellular carcinoma invasion and metastasis by targeting HIF-1α via the PI3K/AKT/mTOR pathway. Oncotarget 2016, 7, 20193–20208. [Google Scholar]
  102. Hong, S.H.; Kim, G.Y.; Chang, Y.C.; Moon, S.K.; Kim, W.J.; Choi, Y.H. Bufalin prevents the migration and invasion of T24 bladder carcinoma cells through the inactivation of matrix metalloproteinases and modulation of tight junctions. Int. J. Oncol. 2013, 42, 277–286. [Google Scholar] [PubMed]
  103. Gai, J.Q.; Sheng, X.; Qin, J.M.; Sun, K.; Zhao, W.; Ni, L. The effect and mechanism of bufalin on regulating hepatocellular carcinoma cell invasion and metastasis via Wnt/β-catenin signaling pathway. Int. J. Oncol. 2016, 48, 338–348. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  104. Zhang, D.M.; Feng, L.X.; Liu, M.; Jin, W.H.; Luo, J.; Nie, A.Y.; Zhou, Y.; Li, Y.; Wu, W.Y.; Jiang, B.H.; et al. Possible target-related proteins and signal network of bufalin in A549 cells suggested by both iTRAQ-based and label-free proteomic analysis. Proteomics 2016, 16, 935–945. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  105. Maimon, A.; Levi-Yahid, V.; Ben-Meir, K.; Halpern, A.; Talmi, Z.; Priya, S.; Mizraji, G.; Mistriel-Zerbib, S.; Berger, M.; Baniyash, M.; et al. Myeloid cell-derived PROS1 inhibits tumor metastasis by regulating inflammatory and immune responses via IL-10. J. Clin. Investig. 2021, 131, e126089. [Google Scholar] [CrossRef] [Scilit]
  106. Hinshaw, D.C.; Shevde, L.A. The Tumor Microenvironment Innately Modulates Cancer Progression. Cancer Res. 2019, 79, 4557–4566. [Google Scholar] [CrossRef] [Scilit]
  107. Wang, X.L.; Zhao, G.H.; Zhang, J.; Shi, Q.Y.; Guo, W.X.; Tian, X.L.; Qiu, J.Z.; Yin, L.Z.; Deng, X.M.; Song, Y. Immunomodulatory effects of cinobufagin isolated from Chan Su on activation and cytokines secretion of immunocyte in vitro. J. Asian Nat. Prod. Res. 2011, 13, 383–392. [Google Scholar] [CrossRef] [Scilit]
  108. Wang, J.Y.; Chen, L.; Zheng, Z.; Wang, Q.; Guo, J.; Xu, L. Cinobufocini inhibits NF-κB and COX-2 activation induced by TNF-α in lung adenocarcinoma cells. Oncol. Rep. 2012, 27, 1619–1624. [Google Scholar]
  109. Sivori, S.; Pende, D.; Quatrini, L.; Pietra, G.; Della Chiesa, M.; Vacca, P.; Tumino, N.; Moretta, F.; Mingari, M.C.; Locatelli, F.; et al. NK cells and ILCs in tumor immunotherapy. Mol. Asp. Med. 2021, 80, 100870. [Google Scholar] [CrossRef] [Scilit]
  110. Pantic, J.M.; Jovanovic, I.P.; Radosavljevic, G.D.; Gajovic, N.M.; Arsenijevic, N.N.; Conlon, J.M.; Lukic, M.L. The frog skin host-defense peptide frenatin 2.1S enhances recruitment, activation and tumoricidal capacity of NK cells. Peptides 2017, 93, 44–50. [Google Scholar] [CrossRef] [Scilit]
  111. Jiang, H.; Zuo, J.; Li, B.; Chen, R.; Luo, K.; Xiang, X.; Lu, S.; Huang, C.; Liu, L.; Tang, J.; et al. Drug-induced oxidative stress in cancer treatments: Angel or devil? Redox Biol. 2023, 63, 102754. [Google Scholar]
  112. Firczuk, M.; Bajor, M.; Graczyk-Jarzynka, A.; Fidyt, K.; Goral, A.; Zagozdzon, R. Harnessing altered oxidative metabolism in cancer by augmented prooxidant therapy. Cancer Lett. 2020, 471, 1–11. [Google Scholar] [PubMed]
  113. Li, Y.; Zhang, Y.; Wang, X.; Yang, Q.; Zhou, X.; Wu, J.; Yang, X.; Zhao, Y.; Lin, R.; Xie, Y.; et al. Bufalin induces mitochondrial dysfunction and promotes apoptosis of glioma cells by regulating Annexin A2 and DRP1 protein expression. Cancer Cell Int. 2021, 21, 424. [Google Scholar] [PubMed]
  114. Dong, Q.; Turdu, G.; Dongmulati, N.; Maimaitijang, A.; Aisa, H.A.; Yili, A. Bufadienolides from the Bufo viridis toad venom exert cytotoxic effects on cancer cells by inducing cell apoptosis and cell cycle arrest. Toxicol. Vitr. Int. J. Publ. Assoc. BIBRA 2023, 89, 105566. [Google Scholar]
  115. Lin, Y.; Jiang, Y.; Zhao, Z.; Lu, Y.; Xi, X.; Ma, C.; Chen, X.; Zhou, M.; Chen, T.; Shaw, C.; et al. Discovery of a Novel Antimicrobial Peptide, Temporin-PKE, from the Skin Secretion of Pelophylax kl. esculentus, and Evaluation of Its Structure-Activity Relationships. Biomolecules 2022, 12, 759. [Google Scholar]
  116. Qin, H.; Fang, H.; Chen, X.; Wang, L.; Ma, C.; Xi, X.; Chen, T.; Shaw, C.; Zhou, M. Exploration of the Structure-Function Relationships of a Novel Frog Skin Secretion-Derived Bioactive Peptide, t-DPH1, through Use of Rational Design, Cationicity Enhancement and In Vitro Studies. Antibiotics 2021, 10, 1529. [Google Scholar]
  117. Tan, Y.; Chen, X.; Ma, C.; Xi, X.; Wang, L.; Zhou, M.; Burrows, J.F.; Kwok, H.F.; Chen, T. Biological Activities of Cationicity-Enhanced and Hydrophobicity-Optimized Analogues of an Antimicrobial Peptide, Dermaseptin-PS3, from the Skin Secretion of Phyllomedusa sauvagii. Toxins 2018, 10, 320. [Google Scholar]
  118. André, S.; Raja, Z.; Humblot, V.; Piesse, C.; Foulon, T.; Sereno, D.; Oury, B.; Ladram, A. Functional Characterization of Temporin-SHe, a New Broad-Spectrum Antibacterial and Leishmanicidal Temporin-SH Paralog from the Sahara Frog (Pelophylax saharicus). Int. J. Mol. Sci. 2020, 21, 6713. [Google Scholar]
  119. Yang, Q.Z.; Wang, C.; Lang, L.; Zhou, Y.; Wang, H.; Shang, D.J. Design of potent, non-toxic anticancer peptides based on the structure of the antimicrobial peptide, temporin-1CEa. Arch. Pharmacal Res. 2013, 36, 1302–1310. [Google Scholar]
  120. Pandit-Taskar, N. Targeted Radioimmunotherapy and Theranostics with Alpha Emitters. J. Med. Imaging Radiat. Sci. 2019, 50 (Suppl. S1), S41–S44. [Google Scholar]
  121. Coerts, H.I.; de Keizer, B.; Marlowe, R.J.; Verburg, F.A. Recombinant or endogenous thyroid-stimulating hormone for radioactive iodine therapy in thyroid cancer: State of knowledge and current controversies. Eur. J. Endocrinol. 2023, 188, lvad006. [Google Scholar]
  122. Lin, R.; Ma, B.; Liu, N.; Zhang, L.; He, T.; Liu, X.; Chen, T.; Liu, W.; Liang, Y.; Wang, T.; et al. Targeted radioimmunotherapy with the iodine-131-labeled caerin 1.1 peptide for human anaplastic thyroid cancer in nude mice. Ann. Nucl. Med. 2021, 35, 811–822. [Google Scholar]
  123. Tan, X.; Liang, X.; Xi, J.; Guo, S.; Meng, M.; Chen, X.; Li, Y. Clinical efficacy and safety of Huachansu injection combination with platinum-based chemotherapy for advanced non-small cell lung cancer: A systematic review and meta-analysis of randomized controlled trials. Medicine 2021, 100, e27161. [Google Scholar]
  124. Xia, J.; Inagaki, Y.; Gao, J.; Qi, F.; Song, P.; Han, G.; Sawakami, T.; Gao, B.; Luo, C.; Kokudo, N.; et al. Combination of Cinobufacini and Doxorubicin Increases Apoptosis of Hepatocellular Carcinoma Cells through the Fas- and Mitochondria-Mediated Pathways. Am. J. Chin. Med. 2017, 45, 1537–1556. [Google Scholar]
  125. Sun, B.; Dong, Y.; Xu, J.; Wang, Z. Current status and progress in immunotherapy for malignant pleural mesothelioma. Chronic Dis. Transl. Med. 2022, 8, 91–99. [Google Scholar]
  126. Satoh, T.; Tatsuta, T.; Sugawara, S.; Hara, A.; Hosono, M. Synergistic anti-tumor effect of bullfrog sialic acid-binding lectin and pemetrexed in malignant mesothelioma. Oncotarget 2017, 8, 42466–42477. [Google Scholar]
  127. Tuyaerts, S.; Van Nuffel, A.M.T.; Naert, E.; Van Dam, P.A.; Vuylsteke, P.; De Caluwé, A.; Aspeslagh, S.; Dirix, P.; Lippens, L.; De Jaeghere, E.; et al. PRIMMO study protocol: A phase II study combining PD-1 blockade, radiation and immunomodulation to tackle cervical and uterine cancer. BMC Cancer 2019, 19, 506. [Google Scholar]
  128. Ni, G.; Yang, X.; Li, J.; Wu, X.; Liu, Y.; Li, H.; Chen, S.; Fogarty, C.E.; Frazer, I.H.; Chen, G.; et al. Intratumoral injection of caerin 1.1 and 1.9 peptides increases the efficacy of vaccinated TC-1 tumor-bearing mice with PD-1 blockade by modulating macrophage heterogeneity and the activation of CD8+ T cells in the tumor microenvironment. Clin. Transl. Immunol. 2021, 10, e1335. [Google Scholar]
  129. Wooten, J.; Mavingire, N.; Damar, K.; Perez, A.L.; Brantley, E. Triumphs and challenges in exploiting poly(ADP-ribose) polymerase inhibition to combat triple-negative breast cancer. J. Cell. Physiol. p. 2023, in press. [CrossRef] [Scilit]
  130. Raineri, A.; Prodomini, S.; Fasoli, S.; Gotte, G.; Menegazzi, M. Influence of onconase in the therapeutic potential of PARP inhibitors in A375 malignant melanoma cells. Biochem. Pharmacol. 2019, 167, 173–181. [Google Scholar]
  131. McNevin, C.S.; Baird, A.M.; McDermott, R.; Finn, S.P. Diagnostic Strategies for Treatment Selection in Advanced Prostate Cancer. Diagnostics 2021, 11, 345. [Google Scholar]
  132. Couty, M.; Dusaud, M.; Miro-Padovani, M.; Zhang, L.; Zadigue, P.; Zargarian, L.; Lequin, O.; de la Taille, A.; Delbe, J.; Hamma-Kourbali, Y.; et al. Antitumor Activity and Mechanism of Action of Hormonotoxin, an LHRH Analog Conjugated to Dermaseptin-B2, a Multifunctional Antimicrobial Peptide. Int. J. Mol. Sci. 2021, 22, 11303. [Google Scholar]
  133. Zhang, L.; Liu, G.; Xia, T.; Yang, X.; Sun, G.; Zhao, C.; Xu, C.; Zhang, H. Evolution of toll-like receptor gene family in amphibians. Int. J. Biol. Macromol. 2022, 208, 463–474. [Google Scholar]
  134. Torres-Dimas, E.; Cruz-Ramírez, A.; Bermúdez-Cruz, R.M. Cancer in Amphibia, a rare phenomenon? Cell Biol. Int. 2022, 46, 1992–1998. [Google Scholar]
Figure 1. The structure of the main active ingredient in HuaChansu. (Structural formulae from the website: https://pubchem.ncbi.nlm.nih.gov/, accessed on 16 July 2023).
Figure 1. The structure of the main active ingredient in HuaChansu. (Structural formulae from the website: https://pubchem.ncbi.nlm.nih.gov/, accessed on 16 July 2023).
Ijms 24 13985 g001
Figure 2. Membrane cleavage of natural anticancer peptides of amphibian origin.
Figure 2. Membrane cleavage of natural anticancer peptides of amphibian origin.
Ijms 24 13985 g002
Figure 3. Mechanism of action of natural anticancer peptides and proteins of amphibian origin.
Figure 3. Mechanism of action of natural anticancer peptides and proteins of amphibian origin.
Ijms 24 13985 g003
Figure 4. Combination strategies of natural anticancer peptides and proteins.
Figure 4. Combination strategies of natural anticancer peptides and proteins.
Ijms 24 13985 g004
Table 1. Information on anti-tumor peptides from amphibians.
Table 1. Information on anti-tumor peptides from amphibians.
NameSpeciesAmino Acid Numbers (aa)Primary StructureCancersReferences
Aurein 2.5Litoria aurea,
Litoria raniformis
16GLFDIVKKVVGAFGSLLeukaemia,
Lung, Colon, CNS, Melanoma,
Ovarian, Renal, Prostate, Breast
[15]
Aurein 2.6Litoria raniformis16GLFDIAKKVIGVIGSL
Aurein 3.1Litoria aurea,
Litoria raniformis
17GLFDIVKKIAGHIAGSI
Aurein 3.2Litoria aurea,
L itoria raniformis
17GLFDIVKKIAGHIASSI
Aurein 3.3Litoria raniformis17GLFDIVKKIAGHIVSSI
Maximin-1Bombina maxima27GIGTKILGGVKTALKGALKELASTYANLeukaemia, Bladder[16]
Maximin-3Bombina maxima27GIGGKILSGLKTALKGAAKELASTYLHLeukaemia, Bladder[16]
Maximin-4Bombina maxima27GIGGVLLSAGKAALKGLAKVLAEKYANLeukaemia[16]
Maximin-5Bombina maxima27SIGAKILGGVKTFFKGALKELASTYLQLeukaemia[16]
Bombinin H2Bombina variegata20IIGPVLGLVGSALGGLLKKINSCLC[17,18]
Temporin ARana temporaria13FLPLIGRVLSGILNSCLC[17,19]
Temporin LRana temporaria13FVQWFSKFLGRILLeukaemia, Lymphoma[20]
Temporin-1DRaRana draytonii14HFLGTLVNLAKKILLiver[21]
Temporin-PEPelophylax esculentus13FLPIVAKLLSGLLLung, Glioma, Prostate, Breast[22]
Ps-1PbPseudhymenochirus merlini29IKIPSFFRNILKKVGKEAVSLIAGALKQSLung, Breast, Colon[23]
Ps-2PaPseudhymenochirus merlini27GIFPIFAKLLGKVIKVASSLISKGRTELung, Breast, Colon[23]
Dermaseptin-B2Phyllomedusa bicolor33GLWSKIKEVGKEAAKAAAKAAGKAALGAVSEAVProstate, Pancreas, Melanoma[24]
Dermaseptin-B3Phyllomedusa bicolor29ALWKNMLKGIGKLAGQAALGAVKTLVGAEProstate, Breast[24]
Dermaseptin-B4Phyllomedusa bicolor28ALWKDILKNVGKAAGKAVLNTVTDMVNQBreast[25]
DRS-DU-1Phyllomedusa duellmani28ALWKSLLKNVGKAAGKAALNAVTDMVNQLung, Prostate[26]
Dermaseptin-PD1Pachymedusa dacnicolor31GMWSKIKETAMAAAKEAAKAAGKTISDMIKQGlioma[27]
Dermaseptin-PD2Pachymedusa dacnicolor33GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAILung, Prostate,
Glioma
[27]
Dermaseptin-PHPhyllomedusa hypochondrialis23ALWKEVLKNAGKAALNEINNLVQLung, Glioma, Prostate, Breast[28]
Dermaseptin-PS4Phyllomedusa sauvagii28ALWKTLLKHVGKAAGKAALNAVTDMVNQLung, Glioma, Prostate, Breast[29]
Brevinin-1GHdHylarana guentheri24FLGALFKVASKLVPAAICSISKKCLung, Glioma, Prostate, Breast[30]
Brevinin-1HAmolops hainanensis21FALGAVTKVLPKLFCLITRKCLung, Prostate, Melanoma, Colon[31]
Brevinin-1OSOdorrana schmackeri23FPLIASLAGNVVPKIFCKITKRCLung, Glioma, Prostate, Breast, Colon[32]
Bombinin-BO1Bombina orientalis25GIGSAILSAGKSIIKGLAKGLAEHFLiver[33]
Bombinin H-BO1Bombina orientalis17IIGPVLGLVGKALGGLLLiver[33]
BLP-7Bombina orientalis27GIGGALLSAGKSALKGLAKGLAEHFANLiver[34]
Bombinin H-BOBombina orientalis17IIGPVLGLIGKALGGLLLiver[34]
PE-BBIPelophylax esculentus16GALKGCWTKSIPPKPCColon[35]
Phylloseptin-PHaPithecopus hypochondrialis19FLSLIPAAISAVSALANHFColon, Breast[36]
Alyteserin-2Alytes obstetricans16ILGKLLSTAAGLLSNLLung[37]
HECIHylarana erythraea17TVLRGCWTFSFPPKPCILung, Prostate, Breast[38]
Ranatuerin-2PLxRhodopseudomonas palustris28GIMDTVKNAAKNLAGQLLDKLKCKITACLung, Prostate, Breast, Glioma[39]
Hymenochirin-1BHymenochirus boettgeri27KLSPETKDNLKKVLKGAIKGAIVAKMVLung, Breast, Colon, Liver[40]
Esculentin-2CHaLithobates chiricahuensis37GFSSIFRGVAKFASKGLGKDLAKLGVDLVACKISKQCLung[41]
Figainin 1Boana raniceps18FIGTLIPLALGALTKLFKMelanoma, Breast, Cervical[42]
Table 2. Peptides from amphibians that exert anti-tumor effects by membrane dissolution. (The net charges theoretical values obtained from the prediction of the peptide when it is under neutral conditions (pH = 7), the website is https://www.novopro.cn/tools/calc_peptide_property.html, accessed on 16 July 2023).
Table 2. Peptides from amphibians that exert anti-tumor effects by membrane dissolution. (The net charges theoretical values obtained from the prediction of the peptide when it is under neutral conditions (pH = 7), the website is https://www.novopro.cn/tools/calc_peptide_property.html, accessed on 16 July 2023).
NameSpeciesAmino Acid Numbers (aa)Primary StructureNet ChargesCancersReferences
Ascaphin-8Ascaphus truei19GFKDLLKGAAKALVKTVLF3Liver[52]
Aurein 1.2Litoria raniformis13GLFDIIKKIAESF0Leukaemia, Lung, Colon, CNS, Melanoma, Ovarian, Renal, Prostate, Breast[15]
Citropin 1.1Litoria citropa16GLFDVIKKVASVIGGL1Leukaemia, Lung, Colon, CNS, Melanoma, Ovarian, Renal, Prostate, Breast[50]
Dermaseptin-L1Hylomantis lemur32GLWSKIKEAAKAAGKAALNAVTGLVNQGDQPS2Liver[6]
Dermaseptin-PT9Phyllomedusa tarsius25GLWSKIKDAAKTAGKAALGFVNEMV2Lung, Glioma, Prostate, Breast, Pancreas[53]
Dermaseptin-PS1Paralabidochromis sauvagei31ALWKTMLKKLGTVALHAGKAALGAVADTISQ3.1Glioma[54]
LFBLimnonectes fujianensis33GLFSVVKGVLKGVGKNVSGSLLDQLKCKISGGC3.9Lung, Breast, Glioma, Colon[55]
Magainin 2Bombina maxima23GIGKFLHSAKKFGKAFVGEIMNS3.1Bladder[51]
Peptide XT-7Xenopus tropicalis18GLLGPLLKIAAKVGSNLL2Liver[52]
Phylloseptin-L1Hylomantis lemur18LLGMIPLAISAISALSKL1Liver[6]
Phylloseptin-PHaPithecopus hypochondrialis19FLSLIPAAISAVSALANHF0.1Lung, Glioma, Prostate, Breast, Colon[36]
Temporin-1CEaRana chensinensis17FVDLKKIANIINSIFGK2Melanoma, Breast, Liver, Lung, Carcinoma, Colon[47,48,56]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Chen, Q.; Wu, J.; Li, X.; Ye, Z.; Yang, H.; Mu, L. Amphibian-Derived Natural Anticancer Peptides and Proteins: Mechanism of Action, Application Strategies, and Prospects. Int. J. Mol. Sci. 2023, 24, 13985. https://doi.org/10.3390/ijms241813985

AMA Style

Chen Q, Wu J, Li X, Ye Z, Yang H, Mu L. Amphibian-Derived Natural Anticancer Peptides and Proteins: Mechanism of Action, Application Strategies, and Prospects. International Journal of Molecular Sciences. 2023; 24(18):13985. https://doi.org/10.3390/ijms241813985

Chicago/Turabian Style

Chen, Qian, Jing Wu, Xiang Li, Ziyi Ye, Hailong Yang, and Lixian Mu. 2023. "Amphibian-Derived Natural Anticancer Peptides and Proteins: Mechanism of Action, Application Strategies, and Prospects" International Journal of Molecular Sciences 24, no. 18: 13985. https://doi.org/10.3390/ijms241813985

APA Style

Chen, Q., Wu, J., Li, X., Ye, Z., Yang, H., & Mu, L. (2023). Amphibian-Derived Natural Anticancer Peptides and Proteins: Mechanism of Action, Application Strategies, and Prospects. International Journal of Molecular Sciences, 24(18), 13985. https://doi.org/10.3390/ijms241813985

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop