Impact of Semiochemicals Binding to Fel d 1 on Its 3D Conformation and Predicted B-Cell Epitopes Using Computational Approaches
Abstract
1. Introduction
2. Results
2.1. Molecular Dynamics Simulation (MDS)
2.1.1. Backbone Conformation of Fel d 1
2.1.2. Fel d 1–Ligand Complex Dynamics
2.1.3. Radius of Gyration (Rg) Analysis
2.1.4. Hydrogen Bond Interaction Analysis
2.2. Computational Fel d 1 Epitope Prediction
2.2.1. Antigenic Determinant Site Prediction
2.2.2. B-Cell Epitope Prediction Using Webservers
2.2.3. Fel d 1-IgE Interactions
2.3. Conformational Epitope Interaction on Ligand Binding Site
2.4. Binding Free Energy Validation
3. Discussion
4. Materials and Methods
4.1. System Configuration
4.2. Dataset Collection
4.3. Molecular Dynamics Simulation (MDS)
4.3.1. Protein Preparation
4.3.2. Generation of Topology and Solvation
4.3.3. Energy Minimization and Equilibration
4.3.4. Production of MDS
4.3.5. g_mmpbsa Analysis
4.4. B-Cell Conformational Epitope Prediction
4.4.1. Literature Mining
4.4.2. Physio-Chemical Property Analysis
4.4.3. Antigenic Determinant Peptide Prediction
4.4.4. Computational Prediction of B-Cell Epitopes
4.4.5. Molecular Interactions between Fel d 1-IgE Antibody
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Dabrowski, A.J.; Van der Brempt, X.; Soler, M.; Seguret, N.; Lucciani, P.; Charpin, D.; Vervloet, D. Cat skin as an important source of Fel d I allergen. J. Allergy Clin. Immunol. 1990, 86, 462–465. [Google Scholar] [CrossRef] [PubMed]
- Bonnet, B.; Messaoudi, K.; Jacomet, F.; Michaud, E.; Fauquert, J.L.; Caillaud, D.; Evrard, B. An update on molecular cat allergens: Fel d 1 and what else? Chapter 1: Fel d 1, the major cat allergen. Allergy Asthma Clin. Immunol. 2018, 14, 14. [Google Scholar] [CrossRef] [PubMed]
- Platts-Mills, T.A.; Vervloet, D.; Thomas, W.R.; Aalberse, R.C.; Chapman, M.D. Indoor allergens and asthma: Report of the third international workshop. J. Allergy Clin. Immunol. 1997, 100, S2–S24. [Google Scholar] [CrossRef] [PubMed]
- Klug, J.; Beier, H.M.; Bernard, A.; Chilton, B.S.; Fleming, T.P.; Lehrer, R.I.; Miele, L.; Pattabiraman, N.; Singh, G. Uteroglobin/Clara cell 10-kDa family of proteins: Nomenclature committee report. Ann. N. Y. Acad. Sci. 2000, 923, 348–354. [Google Scholar] [CrossRef] [PubMed]
- Roost, H.P.; Künzli, N.; Schindler, C.; Jarvis, D.; Chinn, S.; Perruchoud, A.P.; Ackermann-Liebrich, U.; Burney, P.; Wuthrich, B. Role of current and childhood exposure to cat and atopic sensitization. European Community Respiratory Health Survey. J. Allergy Clin. Immunol. 1999, 104, 941–947. [Google Scholar] [CrossRef]
- Rancé, F. Animal dander allergy in children. Arch. Pediatr. 2006, 13, 584–586. [Google Scholar] [CrossRef]
- Hilger, C.; Kuehn, A.; Hentges, F. Animal lipocalin allergens. Curr. Allergy Asthma Rep. 2012, 12, 438–447. [Google Scholar] [CrossRef]
- Kaiser, L.; Gronlund, H.; Sandalova, T.; Ljunggren, H.G.; van Hage-Hamsten, M.; Achour, A.; Schneider, G. The crystal structure of the major cat allergen Fel d 1, a member of the secretoglobin family. J. Biol. Chem. 2003, 278, 37730–37735. [Google Scholar] [CrossRef]
- Kaiser, L.; Velickovic, T.C.; Badia-Martinez, D.; Adedoyin, J.; Thunberg, S.; Hallén, D.; Berndt, K.; Gronlund, H.; Gafvelin, G.; van Hage, M.; et al. Structural characterization of the tetrameric form of the major cat allergen Fel d 1. J. Mol. Biol. 2007, 370, 714–727. [Google Scholar] [CrossRef]
- Morgenstern, J.P.; Griffith, I.J.; Brauer, A.W.; Rogers, B.L.; Bond, J.F.; Chapman, M.D.; Kuo, M.-C. Amino acid sequence of Fel dI, the major allergen of the domestic cat: Protein sequence analysis and cDNA cloning. Proc. Natl. Acad. Sci. USA 1991, 88, 9690–9694. [Google Scholar] [CrossRef]
- Griffith, I.J.; Craig, S.; Pollock, J.; Yu, X.B.; Morgenstern, J.P.; Rogers, B.L. Expression and genomic structure of the genes encoding FdI, the major allergen from the domestic cat. Gene 1992, 113, 263–268. [Google Scholar] [CrossRef] [PubMed]
- Bienboire-Frosini, C.; Lebrun, R.; Vervloet, D.; Pageat, P.; Ronin, C. Distribution of core fragments from the major cat allergen Fel d 1 is maintained among the main anatomical sites of production. Int. Arch. Allergy Immunol. 2010, 152, 197–206. [Google Scholar] [CrossRef] [PubMed]
- Bienboire-Frosini, C.; Lebrun, R.; Vervloet, D.; Pageat, P.; Ronin, C. Variable content of Fel d 1 variants in house dust and cat extracts may have an impact on allergen measurement. J. Investig. Allergol. Clin. Immunol. 2012, 22, 270–279. [Google Scholar] [PubMed]
- Van Milligen, F.J.; Vroom, T.M.; Aalberse, R.C. Presence of Felis domesticus allergen I in the cat’s salivary and lacrimal glands. Int. Arch. Allergy Appl. Immunol. 1990, 92, 375–378. [Google Scholar] [CrossRef]
- De Andrade, A.D.; Birnbaum, J.; Magalon, C.; Magnol, J.P.; Lanteaume, A.; Charpin, D.; Vervloet, D. Fel d I levels in cat anal glands. Clin. Exp. Allergy 1996, 26, 178–180. [Google Scholar] [CrossRef]
- Carayol, N.; Birnbaum, J.; Magnan, A.; Ramadour, M.; Lanteaume, A.; Vervloet, D.; Tessier, Y.; Pageat, P. Fel d 1 production in the cat skin varies according to anatomical sites. Allergy 2000, 55, 570–573. [Google Scholar] [CrossRef]
- Jalil-Colome, J.; de Andrade, A.D.; Birnbaum, J.; Casanovab, D.; Mège, J.L.; Lanteaume, A.; Charpin, D.; Vervloet, D. Sex difference in Fel d 1 allergen production. J. Allergy Clin. Immunol. 1996, 98, 165–168. [Google Scholar] [CrossRef]
- Ramadour, M.; Birnbaum, J.; Magalon, C.; Lanteaume, A.; Charpin, D.; Vervloet, D. Cat sex differences in major allergen production (Fel d 1). J. Allergy Clin. Immunol. 1998, 101, 282–284. [Google Scholar] [CrossRef]
- Kelly, S.M.; Karsh, J.; Marcelo, J.; Boeckh, D.; Stepner, N.; Santone, B.; Yang, J.; Yang, W.H. Fel d 1 and Fel d 4 levels in cat fur, saliva, and urine. J. Allergy Clin. Immunol. 2018, 142, 1990–1992. [Google Scholar] [CrossRef]
- Zielonka, T.M.; Charpin, D.; Berbis, P.; Lucciani, P.; Casanova, D.; Vervloet, D. Effects of castration and testosterone on Fel dI production by sebaceous glands of male cats: I–Immunological assessment. Clin. Exp. Allergy 1994, 24, 1169–1173. [Google Scholar] [CrossRef]
- Pageat, P.; Gaultier, E. Current research in canine and feline pheromones. Vet. Clin. N. Am. Small Anim. Pract. 2003, 33, 187–211. [Google Scholar] [CrossRef] [PubMed]
- Durairaj, R.; Pageat, P.; Bienboire-Frosini, C. Another cat and mouse game: Deciphering the evolution of the SCGB superfamily and exploring the molecular similarity of major cat allergen Fel d 1 and mouse ABP using computational approaches. PLoS ONE 2018, 13, e0197618. [Google Scholar] [CrossRef] [PubMed]
- Bienboire-Frosini, C.; Durairaj, R.; Pelosi, P.; Pageat, P. The major cat allergen Fel d 1 binds steroid and fatty acid semiochemicals: A combined in silico and in vitro study. Int. J. Mol. Sci. 2020, 21, 1365. [Google Scholar] [CrossRef] [PubMed]
- Bienboire-Frosini, C.; Cozzi, A.; Lafont-Lecuelle, C.; Vervloet, D.; Ronin, C.; Pageat, P. Immunological differences in the global release of the major cat allergen Fel d 1 are influenced by sex and behaviour. Vet. J. 2012, 193, 162–167. [Google Scholar] [CrossRef] [PubMed]
- Ohman Jr, J.L.; Kendall, S.; Lowell, F.C. IgE antibody to cat allergens in an allergic population. J. Allergy Clin. Immunol. 1997, 60, 317–323. [Google Scholar] [CrossRef]
- Yao, B.; Zheng, D.; Liang, S.; Zhang, C. Conformational B-cell epitope prediction on antigen protein structures: A review of current algorithms and comparison with common binding site prediction methods. PLoS ONE 2013, 8, e62249. [Google Scholar] [CrossRef]
- Kulkarni-Kale, U.; Bhosle, S.; Kolaskar, A.S. CEP: A conformational epitope prediction server. Nucleic Acids Res. 2005, 33, W168–W171. [Google Scholar] [CrossRef]
- Dall’Antonia, F.; Pavkov-Keller, T.; Zangger, K.; Keller, W. Structure of allergens and structure based epitope predictions. Methods 2014, 66, 3–21. [Google Scholar] [CrossRef]
- Briner, T.J.; Kuo, M.C.; Keating, K.M.; Rogers, B.L.; Greenstein, J.L. Peripheral T-cell tolerance induced in naive and primed mice by subcutaneous injection of peptides from the major cat allergen Fel d I. Proc. Natl. Acad. Sci. USA 1993, 90, 7608–7612. [Google Scholar] [CrossRef]
- Rogers, B.L.; Morgenstern, J.P.; Garman, R.D.; Bond, J.F.; Mei-Chang, K. Recombinant Fel d I: Expression, purification, IgE binding and reaction with cat-allergic human T cells. Mol. Immunol. 1993, 30, 559–568. [Google Scholar] [CrossRef]
- Counsell, C.M.; Bond, J.F.; Ohman, J.L., Jr.; Greenstein, J.L.; Garman, R.D. Definition of the human T-cell epitopes of Fel d 1, the major allergen of the domestic cat. J. Allergy Clin. Immunol. 1996, 98, 884–894. [Google Scholar] [CrossRef] [PubMed]
- Norman, P.S.; Ohman, J.L., Jr.; Long, A.A.; Creticos, P.S.; Gefter, M.A.; Shaked, Z.; Wood, R.A.; Eggleston, P.A.; Hafner, K.B.; Rao, P.; et al. Treatment of cat allergy with T-cell reactive peptides. Am. J. Respir. Crit. Care Med. 1996, 154, 1623–1628. [Google Scholar] [CrossRef] [PubMed]
- Simons, F.E.R.; Imada, M.; Li, Y.; Watson, W.T.; HayGlass, K.T. Fel d 1 peptides: Effect on skin tests and cytokine synthesis in cat-allergic human subjects. Int. Immunol. 1996, 8, 1937–1945. [Google Scholar] [CrossRef] [PubMed]
- Oldfield, W.L.; Larche, M.; Kay, A.B. Effect of T-cell peptides derived from Fel d 1 on allergic reactions and cytokine production in patients sensitive to cats: A randomised controlled trial. Lancet 2002, 360, 47–53. [Google Scholar] [CrossRef]
- Van’t Hof, W.; Van Milligen, F.J.; Van den Berg, M.; Lombardero, M.; Chapman, M.D.; Aalberse, R.C. Epitope mapping of the cat (Felis domesticus) major allergen Fel d I by overlapping synthetic peptides and monoclonal antibodies against native and denatured Fel d I. Allergy 1993, 48, 255–263. [Google Scholar] [CrossRef]
- Vailes, L.D.; Li, Y.; Bao, Y.; DeGroot, H.; Aalberse, R.C.; Chapman, M.D. Fine specificity of B-cell epitopes on Felis domesticus allergen I (Fel d I): Effect of reduction and alkylation or deglycosylation on Fel d I structure and antibody binding. J. Allergy Clin. Immunol. 1994, 93, 22–33. [Google Scholar] [CrossRef]
- Tasaniyananda, N.; Tungtrongchitr, A.; Seesuay, W.; Sakolvaree, Y.; Indrawattana, N.; Chaicumpa, W.; Sookrung, N. A novel IgE-binding epitope of cat major allergen, Fel d 1. Biochem. Biophys. Res. Commun. 2016, 470, 593–598. [Google Scholar] [CrossRef]
- Chapman, M.D.; Aalberse, R.C.; Brown, M.J.; Platts-Mills, T.A. Monoclonal antibodies to the major feline allergen Fel d I. II. Single step affinity purification of Fel d I, N-terminal sequence analysis, and development of a sensitive two-site immunoassay to assess Fel d I exposure. J. Immunol. 1988, 140, 812–818. [Google Scholar] [CrossRef]
- Slunt, J.B.; Rogers, B.L.; Chapman, M.D. IgE antibodies to recombinant forms of Fel d I: Dichotomy between fluid-phase and solid-phase binding studies. J. Allergy Clin. Immunol. 1995, 95, 1221–1228. [Google Scholar] [CrossRef]
- Batard, T.; Bukovec, F.; Berrouet, C.; Destombes, V.; Didierlaurent, A.; André, C. Demonstration of a partially cryptic epitope of the major cat allergen Fel d 1: Consequences for mAb-based standardization of cat extracts. J. Allergy Clin. Immunol. 2000, 106, 669–676. [Google Scholar] [CrossRef]
- Janssen-Weets, B.; Kerff, F.; Swiontek, K.; Kler, S.; Czolk, R.; Revets, D.; Kuehn, A.; Bindslev-Jensen, C.; Ollert, M.; Hilger, C. Mammalian derived lipocalin and secretoglobin respiratory allergens strongly bind ligands with potentially immune modulating properties. Front. Allergy 2022, 3, 958711. [Google Scholar] [CrossRef] [PubMed]
- Chruszcz, M.; Chew, F.T.; Hoffmann-Sommergruber, K.; Hurlburt, B.K.; Mueller, G.A.; Pomés, A.; Rouvinen, J.; Villalba, M.; Wohrl, B.M.; Breiteneder, H. Allergens and their associated small molecule ligands—Their dual role in sensitization. Allergy 2021, 76, 2367–2382. [Google Scholar] [CrossRef] [PubMed]
- Herre, J.; Grönlund, H.; Brooks, H.; Hopkins, L.; Waggoner, L.; Murton, B.; Gangloff, M.; Opaleye, O.; Chilvers, E.R.; Fitzgerald, K.; et al. Allergens as immunomodulatory proteins: The cat dander protein Fel d 1 enhances TLR activation by lipid ligands. J. Immunol. 2013, 191, 1529–1535. [Google Scholar] [CrossRef] [PubMed]
- Kolaskar, A.S.; Tongaonkar, P.C. A semi-empirical method for prediction of antigenic determinants on protein antigens. FEBS Lett. 1990, 276, 172–174. [Google Scholar] [CrossRef]
- Pomés, A.; Wünschmann, S.; Chapman, M.D. Allergens. In Biomedical Sciences; Ratcliff, M.J.H., Ed.; Academic Press: Cambridge, MA, USA, 2016; Volume 5, pp. 281–289. [Google Scholar] [CrossRef]
- Foo, A.C.; Mueller, G.A. Abundance and stability as common properties of allergens. Front. Allergy 2021, 2, 769728. [Google Scholar] [CrossRef]
- Zahradnik, E.; Raulf, M. Animal allergens and their presence in the environment. Front. Immunol. 2014, 5, 76. [Google Scholar] [CrossRef]
- Gould, H.J.; Sutton, B.J. IgE in allergy and asthma today. Nat. Rev. Immunol. 2008, 8, 205–217. [Google Scholar] [CrossRef]
- Valenta, R. Recombinant allergen-based concepts for diagnosis and therapy of type I allergy. Allergy 2002, 57, 66–67. [Google Scholar] [CrossRef]
- Soria-Guerra, R.E.; Nieto-Gomez, R.; Govea-Alonso, D.O.; Rosales-Mendoza, S. An overview of bioinformatics tools for epitope prediction: Implications on vaccine development. J. Biomed. Inform. 2015, 53, 405–414. [Google Scholar] [CrossRef]
- van Milligen, F.J.; van’t Hof, W.; van den Berg, M.; Aalberse, R.C. IgE epitopes on the cat (Felis domesticus) major allergen Fel d I: A study with overlapping synthetic peptides. J. Allergy Clin. Immunol. 1994, 93, 34–43. [Google Scholar] [CrossRef]
- Dall’Antonia, F.; Gieras, A.; Devanaboyina, S.C.; Valenta, R.; Keller, W. Prediction of IgE-binding epitopes by means of allergen surface comparison and correlation to cross-reactivity. J. Allergy Clin. Immunol. 2011, 128, 872–879. [Google Scholar] [CrossRef] [PubMed]
- Tipu, H.N.; Ahmed, D.; Gardezi, S.A.H. In silico identification of epitopes from house cat and dog proteins as peptide immunotherapy candidates based on human leukocyte antigen binding affinity. Iran. J. Vet. Res. 2007, 18, 56. [Google Scholar]
- Spinelli, S.; Vincent, F.; Pelosi, P.; Tegoni, M.; Cambillau, C. Boar salivary lipocalin: Three-dimensional X-ray structure and androstenol/androstenone docking simulations. Eur. J. Biochem. 2002, 269, 2449–2456. [Google Scholar] [CrossRef] [PubMed]
- Rajesh, D.; Muthukumar, S.; Saibaba, G.; Siva, D.; Akbarsha, M.A.; Gulyás, B.; Padmanabhan, P.; Archunan, G. Structural elucidation of estrus urinary lipocalin protein (EULP) and evaluating binding affinity with pheromones using molecular docking and fluorescence study. Sci. Rep. 2016, 6, 35900. [Google Scholar] [CrossRef]
- Muthukumar, S.; Rajesh, D.; Selvam, R.M.; Saibaba, G.; Suvaithenamudhan, S.; Akbarsha, M.A.; Padmanabhan, P.; Gulyas, B.; Archunan, G. Buffalo nasal odorant-binding protein (bunOBP) and its structural evaluation with putative pheromones. Sci. Rep. 2018, 8, 9323. [Google Scholar] [CrossRef]
- Fedorov, A.A.; Ball, T.; Mahoney, N.M.; Valenta, R.; Almo, S.C. The molecular basis for allergen cross-reactivity: Crystal structure and IgE-epitope mapping of birch pollen profilin. Structure 1997, 5, 33–45. [Google Scholar] [CrossRef]
- Curin, M.; Weber, M.; Hofer, G.; Apostolovic, D.; Keller, W.; Reininger, R.; Swoboda, I.; Spitzauer, S.; Focke-Tejkl, M.; van Hage, M.; et al. Clustering of conformational IgE epitopes on the major dog allergen Can f 1. Sci. Rep. 2017, 7, 12135. [Google Scholar] [CrossRef]
- Aina, R.; Dubiela, P.; Geiselhart, S.; Bublin, M.; Bruschi, M.; Radauer, C.; Nagl, C.; Humeniuk, P.; Asero, R.; Mortz, C.G.; et al. Distinct Lipid Transfer Proteins display different IgE-binding activities that are affected by fatty acid binding. Allergy 2019, 74, 827. [Google Scholar] [CrossRef]
- Brackett, N.F.; Davis, B.W.; Adli, M.; Pomés, A.; Chapman, M.D. Evolutionary biology and gene editing of cat allergen, Fel d 1. CRISPR J. 2022, 5, 213–223. [Google Scholar] [CrossRef]
- Ligabue-Braun, R.; Sachett, L.G.; Pol-Fachin, L.; Verli, H. The calcium goes meow: Effects of ions and glycosylation on Fel d 1, the major cat allergen. PLoS ONE 2015, 10, e0132311. [Google Scholar] [CrossRef]
- Seppälä, U.; Hägglund, P.; Wurtzen, P.A.; Ipsen, H.; Thorsted, P.; Lenhard, T.; Roepstorff, P.; Spangfort, M.D. Molecular characterization of major cat allergen Fel d 1: Expression of heterodimer by use of a baculovirus expression system. J. Biol. Chem. 2005, 280, 3208–3216. [Google Scholar] [CrossRef] [PubMed]
- Lindahl, E. Molecular dynamics simulations. Methods Mol. Biol. 2008, 443, 3–23. [Google Scholar] [CrossRef] [PubMed]
- Abraham, M.J.; Murtola, T.; Schulz, R.; Páll, S.; Smith, J.C.; Hess, B.; Lindahl, E. GROMACS: High performance molecular simulations through multi-level parallelism from laptops to supercomputers. SoftwareX 2015, 1, 19–25. [Google Scholar] [CrossRef]
- Hess, B.; Kutzner, C.; Van Der Spoel, D.; Lindahl, E. GROMACS 4: Algorithms for highly efficient, load-balanced, and scalable molecular simulation. J. Chem. Theory Comput. 2008, 4, 435–447. [Google Scholar] [CrossRef]
- Páll, S.; Abraham, M.J.; Kutzner, C.; Hess, B.; Lindahl, E. Tackling exascale software challenges in molecular dynamics simulations with GROMACS. In Solving Software Challenges for Exascale, EASC 2014, Stockholm, Sweden; Markidis, S., Laure, E., Eds.; Springer: Cham, Switzerland, 2015; Volume 8759, pp. 3–27. [Google Scholar] [CrossRef]
- Hess, B.; Bekker, H.; Berendsen, H.J.; Fraaije, J.G. LINCS: A linear constraint solver for molecular simulations. J. Comput. Chem. 1997, 18, 1463–1472. [Google Scholar] [CrossRef]
- Choudhary, P.; Bhowmik, A.; Chakdar, H.; Khan, M.A.; Selvaraj, C.; Singh, S.K.; Murugan, K.; Kumar, S.; Saxena, A.K. Understanding the biological role of PqqB in Pseudomonas stutzeri using molecular dynamics simulation approach. J. Biomol. Struct. Dyn. 2022, 40, 4237–4249. [Google Scholar] [CrossRef]
- Wohlert, J.; Edholm, O. The range and shielding of dipole-dipole interactions in phospholipid bilayers. Biophys J. 2004, 87, 2433–2445. [Google Scholar] [CrossRef]
- Selvaraj, C.; Omer, A.; Singh, P.; Singh, S.K. Molecular insights of protein contour recognition with ligand pharmacophoric sites through combinatorial library design and MD simulation in validating HTLV-1 PR inhibitors. Mol. Biosyst. 2015, 11, 178–189. [Google Scholar] [CrossRef]
- Homeyer, N.; Gohlke, H. Free energy calculations by the molecular mechanics Poisson−Boltzmann surface area method. Mol. Inform. 2012, 31, 114–122. [Google Scholar] [CrossRef]
- Baker, N.A.; Sept, D.; Joseph, S.; Holst, M.J.; McCammon, J.A. Electrostatics of nanosystems: Application to microtubules and the ribosome. Proc. Natl. Acad. Sci. USA 2001, 98, 10037–10041. [Google Scholar] [CrossRef]
- Kumari, R.; Kumar, R.; Open Source Drug Discovery Consortium; Lynn, A. g_mmpbsa—A GROMACS tool for high-throughput MM-PBSA calculations. J. Chem. Inf. Model. 2014, 54, 1951–1962. [Google Scholar] [CrossRef] [PubMed]
- Weis, A.; Katebzadeh, K.; Söderhjelm, P.; Nilsson, I.; Ryde, U. Ligand affinities predicted with the MM/PBSA method: Dependence on the simulation method and the force field. J. Med. Chem. 2006, 49, 6596–6606. [Google Scholar] [CrossRef] [PubMed]
- Rastelli, G.; Rio, A.D.; Degliesposti, G.; Sgobba, M. Fast and accurate predictions of binding free energies using MM-PBSA and MM-GBSA. J. Comput. Chem. 2010, 31, 797–810. [Google Scholar] [CrossRef]
- Emini, E.A.; Hughes, J.V.; Perlow, D.; Boger, J. Induction of hepatitis A virus-neutralizing antibody by a virus-specific synthetic peptide. J. Virol. 1985, 55, 836–839. [Google Scholar] [CrossRef]
- Liang, S.; Zheng, D.; Standley, D.M.; Yao, B.; Zacharias, M.; Zhang, C. EPSVR and EPMeta: Prediction of antigenic epitopes using support vector regression and multiple server results. BMC Bioinform. 2010, 11, 381. [Google Scholar] [CrossRef]
- Krawczyk, K.; Liu, X.; Baker, T.; Shi, J.; Deane, C.M. Improving B-cell epitope prediction and its application to global antibody-antigen docking. Bioinformatics 2014, 30, 2288–2294. [Google Scholar] [CrossRef] [PubMed]
- Ponomarenko, J.; Bui, H.H.; Li, W.; Fusseder, N.; Bourne, P.E.; Sette, A.; Peters, B. ElliPro: A new structure-based tool for the prediction of antibody epitopes. BMC Bioinform. 2008, 9, 514. [Google Scholar] [CrossRef] [PubMed]
- Foo, A.C.; Thompson, P.M.; Mueller, G.A. Removal and replacement of endogenous ligands from lipid-bound proteins and allergens. J. Vis. Exp. 2021, 168, e61780. [Google Scholar] [CrossRef]
Tools and Webserver Links | Score | Antigenic Peptide_2EJN |
---|---|---|
Predicted Antigenic peptides (http://imed.med.ucm.es/Tools/antigenic.pl (accessed on 11 October 2018)) | 1.0475 | CPAVKRDVDLFL PDEYVEQVAQYKALPVVLEN ILKNCVD KMTEEDKE NALSLLDKIYTSPLCVKMAETCPIFYDVFFAV NELLLDLSLTK KIQDCYVEN LISRVLDGLVMT |
SVMTrip (http://sysbio.unl.edu/SVMTriP/ (accessed on 18 October 2018)) | 1 | NCEICPAVKRDVDLFLTGTP CVDAKMTEEDKENALSVLDK NELLLDLSLT DCYVENGLISRVLDGL |
AlgPred (https://webs.iiitd.edu.in/raghava/algpred2/ (accessed on 6 November 2018)) | 0.29578 | ENARILKNCVDAKMTEEDKENALS |
SCRATCH (http://scratch.proteomics.ics.uci.edu/index.html (accessed on 6 November 2018)) | 0.792789 | QYKALP CVDAKMTEEDKEN SLTKVNATEP TISSSKDCMGEHHHHHH |
EMBOSS (http://imed.med.ucm.es/cgi-bin/emboss.pl?_action=input&_app=antigenic (accessed on 15 October 2018)) | 1.11–1.89 | PAVKRDVDLFLT DEYVEQVAQYKALPVVLENA LKNCVDA ELLLDLSLTKV IQDCYVENG ISRVLDGLVMTT |
Servers and Links | Threshold | Predicted Conformational Epitope Sites |
---|---|---|
PDB ID: 2EJN | ||
DiscoTope (http://tools.iedb.org/discotope/ (accessed on 5 October 2018)) | −7.7 | T17, D19, A47, T50, E51, E52, D53, E55, A74, T105, E106, P107, G123, K141, M144 |
ElliPro (http://tools.iedb.org/ellipro/ (accessed on 28 November 2018)) | 0.5 | K29, A30, L31, P32, V33, T50, E51, E52, D53, E55, V71, K72, M73, A74, E75, N103, A104, T105, E106, P107, T110, S139, S140, K141, D142, C143, M144, G145 |
CBTOPE (https://webs.iiitd.edu.in/raghava/cbtope/submit.php (accessed on 30 November 2018)) | −0.3 | E1, I3, D19, E20, Y21, V22, E23, Q24, V25, A26, Q27, Y28, A30, T50, E51, E52, D53, K54, E55, N56, S59, L61, D63, L69, C70, V71, K72, M73, A74, F80, Y81, N91, A111, M112, K113, K114, I115, Q116, D117, C118, Y119, E121, S138 |
EpiPred (http://opig.stats.ox.ac.uk/webapps/newsabdab/sabpred/epipred/ (accessed on 16 October 2018)) | −3.7 | D11, L12, F13, T15, G16, T17, P18, D19, E20, R39, I40, N43, C44, D46, A47, K48, T50, E51, E52, D53, K54, E55, N56, L58, S59, K114, D117, Y119, E121, N122, D130, G131, M134, S138, S139, S140, D142 |
CEP (http://196.1.114.49/cgi-bin/cep.pl (accessed on 10 October 2018)) | ≥72% | I2, C3, P4, R8, L12, G16, T17, P18, D46, A47, K48, T50, E51, E52, K54, S67, P68, V71, K72, F80, T105, K114, I115, Q116, D130, S138, S139 |
EPSVR (http://sysbio.unl.edu/EPSVR/ (accessed on 26 November 2018)) | 0.638 | G16, T17, P18, D19, E20, E23, A26, A30, L31, L35, R39, I40, N43, D46, E51, E75, D82, F85, N89, G90, N91, L94, L97, V120, I125, G131, S138 |
BEPro (http://pepito.proteomics.ics.uci.edu/index.html (accessed on 30 November 2018)) | 0.85–1.0 | A30, P32, V33, A47, K48, T50, E51, E52, D53, E55, N66, P68, L69, V71, K72, A74, V92, A94, T95, E96, P97, L99, E121, S138, S139, S140, D142, G145 |
BepiPred (https://services.healthtech.dtu.dk/service.php?BepiPred-2.0 (accessed on 26 November 2018)) | 0.55 | P4, K7, R8, D19, E20, E23, Q24, A26, Q27, K29, A30, L31, P32, V33, K48, T50, E51, E52, D53, K54, E55, P68, C70, K72, M73, E75, E92, L97, S98, T100, K101, N103, T105, E106, P107, E108, R109, T110, K113, K114, D117, V120, E121, N122, G123, I125, S126, R127, L129, D130, K141, D142, M144, G145, E146, H148 |
S. No | Article References | Epitope Feature | Chain 1 with Sequence Number | Chain 2 with Sequence Number |
---|---|---|---|---|
1 | Kaiser et al., 2003 [8] | Solvent-exposed IgE epitopes | Q27, L31, P32, E36, A47, E51, E52, E55 | F15, N19, E22, L23, L27 |
2 | van Milligen et al., 1994 [14] | Linear peptides | VAQYKALPVVLENA-K (25–38) DAKMTEEDKENALS-K (46–59) | FAVANGNELLLDCS-K (15–28) |
3 | van’t Hof et al., 1993 [35] | Conformational sites in peptides | EICPAVKRDVDLFLT (1–15) LLDKIYTSPLC (60–70) | VKMAETCPIFYDVF (1–14) KKIQDCYVENGLIS (43–56) |
4 | Tasaniyananda et al., 2016 [37] | IgE-binding conformational epitopes | L12, T15, T17, P18, E20, E23, R39, K42, N43, D46, E51, K54 |
Servers | Methods |
---|---|
DiscoTope | Structure-based antibody prediction. |
ElliPro | Ag-3D structure linear and conformational epitope prediction protrusion index (PI). |
CBTOPE | This algorithm discriminates the antibody epitope residues and non-epitope residues for a given primary sequence. |
EPiPred | Predicting the structural epitopes by knowledge-based asymmetric Ag–Ab scoring. |
CEP | Conformational epitope prediction based on antigens and antibodies available in PDB. |
EPSVR | Antigenic epitopes prediction with support vector regression. |
BEPro | Ag-3D structure based discontinuous B-cell epitope prediction. |
BepiPred 2.0 | Prediction of potential linear B-cell epitopes. It is based on a random forest algorithm trained on epitopes annotated from antibody–antigen protein structures. |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Durairaj, R.; Pageat, P.; Bienboire-Frosini, C. Impact of Semiochemicals Binding to Fel d 1 on Its 3D Conformation and Predicted B-Cell Epitopes Using Computational Approaches. Int. J. Mol. Sci. 2023, 24, 11685. https://doi.org/10.3390/ijms241411685
Durairaj R, Pageat P, Bienboire-Frosini C. Impact of Semiochemicals Binding to Fel d 1 on Its 3D Conformation and Predicted B-Cell Epitopes Using Computational Approaches. International Journal of Molecular Sciences. 2023; 24(14):11685. https://doi.org/10.3390/ijms241411685
Chicago/Turabian StyleDurairaj, Rajesh, Patrick Pageat, and Cécile Bienboire-Frosini. 2023. "Impact of Semiochemicals Binding to Fel d 1 on Its 3D Conformation and Predicted B-Cell Epitopes Using Computational Approaches" International Journal of Molecular Sciences 24, no. 14: 11685. https://doi.org/10.3390/ijms241411685
APA StyleDurairaj, R., Pageat, P., & Bienboire-Frosini, C. (2023). Impact of Semiochemicals Binding to Fel d 1 on Its 3D Conformation and Predicted B-Cell Epitopes Using Computational Approaches. International Journal of Molecular Sciences, 24(14), 11685. https://doi.org/10.3390/ijms241411685