Isolation and Functional Analysis of EPHEMERAL1-LIKE (EPH1L) Genes Involved in Flower Senescence in Cultivated Japanese Gentians
Abstract
:1. Introduction
2. Results and Discussion
2.1. Identification of a Homologous Gene of Morning Glory EPHEMERAL1 (EPH1) in Gentians
2.2. Transcription of EPH1L Is Induced with Senescence in Field-Grown Gentians
2.3. Establishment of a Reliable Evaluation System for Flower Longevity of Gentians Using Dark-Induced Senescence
2.4. Production and Sequence Analyses of eph1l Genome-Edited Gentian Lines
2.5. Evaluation of Flower Longevity of eph1l-Genome-Edited Gentian Plants and the Involvement of EPH1L in Flower Senescence
3. Materials and Methods
3.1. Plant Materials and Isolation of Genomic DNAs and RNAs
3.2. Cloning of the EPH1L cDNAs and Genomic Sequences from Gentians
3.3. qRT-PCR Analysis
3.4. Dark-Induced Senescence Treatment
3.5. Construction of a Binary Vector for Genome Editing and the Selection of Genome-Edited Gentian Plants
4. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
Abbreviations
References
- Mochizuki-Kawai, H.; Yamakawa, Y.; Mochizuki, S.; Anzai, S.; Arai, M. Structured floral arrangement programme for improving visuospatial working memory in schizophrenia. Neuropsychol. Rehabil. 2010, 20, 624–636. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Shibuya, K. Molecular aspects of flower senescence and strategies to improve flower longevity. Breed. Sci. 2018, 68, 99–108. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Rogers, H.J. Programmed cell death in floral organs: How and why do flowers die? Ann. Bot. 2006, 97, 309–315. [Google Scholar] [CrossRef] [PubMed]
- Rogers, H.J. From models to ornamentals: How is flower senescence regulated? Plant Mol. Biol. 2013, 82, 563–574. [Google Scholar] [CrossRef] [PubMed]
- van Doorn, W.G.; Woltering, E.J. Physiology and molecular biology of petal senescence. J. Exp. Bot. 2008, 59, 453–480. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Shibuya, K. Molecular mechanisms of petal senescence in ornamental plants. J. Jpn. Soc. Hortic. Sci. 2012, 81, 140–149. [Google Scholar] [CrossRef] [Green Version]
- Woltering, E.J.; Van Doorn, W.G. Role of ethylene in senescence of petals—Morphological and taxonomical relationships. J. Exp. Bot. 1988, 39, 1605–1616. [Google Scholar] [CrossRef]
- Shibuya, K.; Shimizu, K.; Niki, T.; Ichimura, K. Identification of a NAC transcription factor, EPHEMERAL1, that controls petal senescence in Japanese morning glory. Plant J. 2014, 79, 1044–1051. [Google Scholar] [CrossRef]
- Shibuya, K.; Watanabe, K.; Ono, M. CRISPR/Cas9-mediated mutagenesis of the EPHEMERAL1 locus that regulates petal senescence in Japanese morning glory. Plant Physiol. Biochem. 2018, 131, 53–57. [Google Scholar] [CrossRef]
- Nishihara, M.; Tasaki, K.; Sasaki, N.; Takahashi, H. Development of basic technologies for improvement of breeding and cultivation of Japanese gentian. Breed. Sci. 2018, 68, 14–24. [Google Scholar] [CrossRef] [Green Version]
- Goto, T.; Kondo, T.; Tamura, H.; Imagawa, H.; Iino, A.; Takeda, K. Structure of gentiodelphin, an acylated anthocyanin from Gentiana maikinoi, that is stable in dilute aqueous solution. Tetrahedron Lett. 1982, 23, 3695–3698. [Google Scholar] [CrossRef]
- Hosokawa, K.; Fukushi, E.; Kawabata, J.; Fujii, C.; Ito, T.; Yamamura, S. Seven acylated anthocyanins in blue flowers of Gentiana. Phytochemistry 1997, 145, 167–171. [Google Scholar] [CrossRef]
- Nakatsuka, T.; Saito, M.; Yamada, E.; Fujita, K.; Yamagishi, N.; Yoshikawa, N.; Nishihara, M. Isolation and characterization of the C-class MADS-box gene involved in the formation of double flowers in Japanese gentian. BMC Plant Biol. 2015, 15, 182. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Nakatsuka, T.; Saito, M.; Nishihara, M. Functional characterization of duplicated B-class MADS-box genes in Japanese gentian. Plant Cell Rep. 2016, 35, 895–904. [Google Scholar] [CrossRef] [PubMed]
- Imamura, T.; Nakatsuka, T.; Higuchi, A.; Nishihara, M.; Takahashi, H. The gentian orthologs of the FT/TFL1 gene family control floral initiation in Gentiana. Plant Cell Physiol. 2011, 52, 1031–1041. [Google Scholar] [CrossRef] [Green Version]
- Lee, J.; Sugawara, E.; Yokoi, S.; Takahata, Y. Genotypic variation of volatile compounds from flowers of gentians. Breed. Sci. 2010, 60, 9–17. [Google Scholar] [CrossRef] [Green Version]
- Nakatsuka, T.; Nishihara, M.; Mishiba, K.; Yamamura, S. Two different mutations are involved in the formation of white-flowered gentian plants. Plant Sci. 2005, 169, 949–958. [Google Scholar] [CrossRef]
- Nishihara, M.; Hikage, T.; Yamada, E.; Nakatsuka, T. A single-base substitution suppresses flower color mutation caused by a novel miniature inverted-repeat transposable element in gentian. Mol. Genet. Genom. 2011, 286, 371–382. [Google Scholar] [CrossRef]
- Sasaki, N.; Nishizaki, Y.; Yamada, E.; Tatsuzawa, F.; Nakatsuka, T.; Takahashi, H.; Nishihara, M. Identification of the glucosyltransferase that mediates direct flavone C-glucosylation in Gentiana triflora. FEBS Lett. 2015, 589, 182–187. [Google Scholar] [CrossRef] [Green Version]
- Sasaki, N.; Nemoto, K.; Nishizaki, Y.; Sugimoto, N.; Tasaki, K.; Watanabe, A.; Goto, F.; Higuchi, A.; Morgan, E.; Hikage, T.; et al. Identification and characterization of xanthone biosynthetic genes contributing to the vivid red coloration of red-flowered gentian. Plant J. 2021, 107, 1711–1723. [Google Scholar] [CrossRef]
- Tasaki, K.; Higuchi, A.; Watanabe, A.; Sasaki, N.; Nishihara, M. Effects of knocking out three anthocyanin modification genes on the blue pigmentation of gentian flowers. Sci. Rep. 2019, 9, 15831. [Google Scholar] [CrossRef] [Green Version]
- Tasaki, K.; Yoshida, M.; Nakajima, M.; Higuchi, A.; Watanabe, A.; Nishihara, M. Molecular characterization of an anthocyanin-related glutathione S-transferase gene in Japanese gentian with the CRISPR/Cas9 System. BMC Plant Biol. 2020, 20, 370. [Google Scholar] [CrossRef] [PubMed]
- Nakatsuka, T.; Saito, M.; Sato-Ushiku, Y.; Yamada, E.; Nakasato, T.; Hoshi, N.; Fujiwara, K.; Hikage, T.; Nishihara, M. Development of DNA markers that discriminate between white- and blue-flowers in Japanese gentian plants. Euphytica 2011, 184, 335–344. [Google Scholar] [CrossRef]
- Kakizaki, Y.; Nakatsuka, T.; Kawamura, H.; Abe, J.; Abe, Y.; Yamamura, S.; Nishihara, M. Development of codominant DNA marker distinguishing pink from blue flowers in Gentiana scabra. Breed. Res. 2009, 11, 9–14. [Google Scholar] [CrossRef] [Green Version]
- Tasaki, K.; Higuchi, A.; Fujita, K.; Watanabe, A.; Sasaki, N.; Fujiwara, K.; Abe, H.; Naito, Z.; Takahashi, R.; Hikage, T.; et al. Development of molecular markers for breeding of double flowers in Japanese gentian. Mol. Breed. 2017, 37, 33. [Google Scholar] [CrossRef]
- Takahashi, S.; Ozawa, S.; Sonoike, K.; Sasaki, K.; Nishihara, M. Morphological and cytological observation of corolla green spots reveal the presence of functional chloroplasts in Japanese gentian. PLoS ONE 2020, 15, e0237173. [Google Scholar] [CrossRef] [PubMed]
- Nemoto, K.; Niinae, T.; Goto, F.; Sugiyama, N.; Watanabe, A.; Shimizu, M.; Shiratake, K.; Nishihara, M. Calcium-dependent protein kinase 16 phosphorylates and activates the aquaporin PIP2;2 to regulate reversible flower opening in Gentiana scabra. Plant Cell 2022. [Google Scholar] [CrossRef]
- Shimizu-Yumoto, H.; Ichimura, K. Effects of ethylene, pollination, and ethylene inhibitor treatments on flower senescence of gentians. Postharvest Biol. Technol. 2012, 63, 111–115. [Google Scholar] [CrossRef]
- van Doorn, W.G. Categories of petal senescence and abscission: A reevaluation. Ann. Bot. 2001, 87, 447–456. [Google Scholar] [CrossRef]
- Eason, J.R.; Debenham, M.; McLachlan, A.; Morgan, E. Novel red-flowered Gentiana: An export cut flower crop from New Zealand. Acta Hort. 2007, 755, 259–266. [Google Scholar] [CrossRef]
- Zhang, Z.; Leung, D.W.M. Elevation of soluble sugar levels by silver thiosulfate is associated with vase life improvement of cut gentian flowers. J. Appl. Bot. 2001, 75, 85–90. [Google Scholar]
- Thompson, J.D.; Gibson, T.J.; Plewniak, F.; Jeanmougin, F.; Higgins, D.G. The CLUSTAL_X windows interface: Flexible strategies for multiple sequence alignment aided by quality analysis tools. Nucleic Acids Res. 1997, 25, 4876–4882. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Saitou, N.; Nei, M. The neighbor-joining method: A new method for reconstructing phylogenetic trees. Mol. Biol. Evol. 1987, 4, 406–425. [Google Scholar]
- Liebsch, D.; Keech, O. Dark-induced leaf senescence: New insights into a complex light-dependent regulatory pathway. New Phytol. 2016, 212, 563–570. [Google Scholar] [CrossRef] [PubMed]
- Takahashi, H.; Nishihara, M.; Yoshida, C.; Itoh, K. Gentian FLOWERING LOCUS T orthologs regulate phase transitions: Floral induction and endodormancy release. Plant Physiol. 2022, 188, 1887–1899. [Google Scholar] [CrossRef] [PubMed]
- Shibuya, K.; Yamada, T.; Ichimura, K. Morphological changes in senescing petal cells and the regulatory mechanism of petal senescence. J. Exp. Bot. 2016, 67, 5909–5918. [Google Scholar] [CrossRef] [PubMed]
- Olsen, A.N.; Ernst, H.A.; Leggio, L.L.; Skriver, K. NAC transcription factors: Structurally distinct, functionally diverse. Trends Plant Sci. 2005, 10, 79–87. [Google Scholar] [CrossRef]
- Guo, Y.; Gan, S. AtNAP, a NAC family transcription factor, has an important role in leaf senescence. Plant J. 2006, 46, 601–612. [Google Scholar] [CrossRef]
- Nakashima, K.; Takasaki, H.; Mizoi, J.; Shinozaki, K.; Yamaguchi-Shinozaki, K. NAC transcription factors in plant abiotic stress responses. Biochim. Biophys. Acta 2011, 1819, 97–103. [Google Scholar] [CrossRef]
- Puranik, S.; Sahu, P.P.; Srivastava, P.S.; Prasad, M. NAC proteins: Regulation and role in stress tolerance. Trends Plant Sci. 2012, 17, 369–381. [Google Scholar] [CrossRef]
- Podzimska-Sroka, D.; O’Shea, C.; Gregersen, P.L.; Skriver, K. NAC Transcription factors in senescence: From molecular structure to function in crops. Plants 2015, 4, 412–448. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Forlani, S.; Mizzotti, C.; Masiero, S. The NAC side of the fruit: Tuning of fruit development and maturation. BMC Plant Biol. 2021, 21, 238. [Google Scholar] [CrossRef] [PubMed]
- Kim, J.H.; Woo, H.R.; Kim, J.; Lim, P.O.; Lee, I.C.; Choi, S.H.; Hwang, D.; Nam, H.G. Trifurcate feed-forward regulation of age-dependent cell death involving miR164 in Arabidopsis. Science 2009, 323, 1053–1057. [Google Scholar] [CrossRef] [Green Version]
- Balazadeh, S.; Kwasniewski, M.; Caldana, C.; Mehrnia, M.; Zanor, M.I.; Mueller-Roeber, B.; Xue, G.P. ORS1, an H2O2-responsive NAC transcription factor, controls senescence in Arabidopsis thaliana. Mol. Plant 2011, 4, 346–360. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yang, S.D.; Seo, P.J.; Yoon, H.K.; Park, C.M. The Arabidopsis NAC transcription factor VNI2 integrates abscisic acid signals into leaf senescence via the COR/RD genes. Plant Cell 2011, 23, 2155–2168. [Google Scholar] [CrossRef] [Green Version]
- Ohta, Y.; Atsumi, G.; Yoshida, C.; Takahashi, S.; Shimizu, M.; Nishihara, M.; Nakatsuka, T. Post-transcriptional gene silencing of the chalcone synthase gene CHS causes corolla lobe-specifc whiting of Japanese gentian. Planta 2022, 255, 29. [Google Scholar] [CrossRef]
Line | EPH1L | Target 1 | In/del | Target 2 | In/del |
---|---|---|---|---|---|
WT | EPH1La | ACAGAGCTGGAATTACCACCAGG | WT | CCTACTGATGAAGAACTAATTAC | WT |
EPH1Lb | ACAGAGCTGGAATTACCACCAGG | WT | CCTACTGATGAAGAACTAATTAC | WT | |
#6-6 | EPH1La | ACAGAGCTGGAATTACC -------- | −25 bp 1 | ------- GATGAAGAACTAATTAC | −25 bp 1 |
EPH1Lb | ACAGAGCTGGAATTACCACCAGG | WT | CCTAC ---------- ATAATTAC | −10 bp | |
#8-2 | EPH1La | ACAGAGCTGGAATTACC -------- | −25 bp 1 | ------- GATGAAGAACTAATTAC | −25 bp 1 |
EPH1Lb | ACAGAGCTGGAAT --- CACCAGG | −3 bp | CCTAC ----- AAGAACTAATTAC | −5 bp | |
#8-5 | EPH1La | ACAGAGCTGGAATTA (256 bp insert) -- ACCAGG | +236 bp −2 bp | CCT ------- AAGAACTAATTAC | −7 bp |
EPH1Lb | ACAGAGCTGGAA ----- ACCAGG | −5 bp | CCT -------------- AATTAC | −14 bp |
Line | EPH1L | Deduced Amino Acids |
---|---|---|
WT | EPH1La | MEKNSEVSKPVESLETELELPPGFRFHPTDEELITHYLTPKVFDNSFSARAIGEVDL… |
EPH1Lb | MEKNSEVSKPVENLETELELPPGFRFHPTDEELITHYLTPKVFDYSFSARAIGEVDL… | |
#6-6 | EPH1La | MEKNSEVSKPVESLETELELPMKN * |
EPH1Lb | MEKNSEVSKPVENLETELELPPGFRFHPT * | |
#8-2 | EPH1La | MEKNSEVSKPVESLETELELPMKN * |
EPH1Lb | MEKNSEVSKPVENLETELESPGFRFHPTRTNYSLSHPKSFRLQLFCQSHWGGLEES * | |
#8-5 | EPH1La | MEKNSEVSKPVESLETELELGI * |
EPH1Lb | MEKNSEVSKPVENLETELETRISFSSLLTISPQKFSTTAFLPEPLVRWT * |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Takahashi, S.; Yoshida, C.; Takahashi, H.; Nishihara, M. Isolation and Functional Analysis of EPHEMERAL1-LIKE (EPH1L) Genes Involved in Flower Senescence in Cultivated Japanese Gentians. Int. J. Mol. Sci. 2022, 23, 5608. https://doi.org/10.3390/ijms23105608
Takahashi S, Yoshida C, Takahashi H, Nishihara M. Isolation and Functional Analysis of EPHEMERAL1-LIKE (EPH1L) Genes Involved in Flower Senescence in Cultivated Japanese Gentians. International Journal of Molecular Sciences. 2022; 23(10):5608. https://doi.org/10.3390/ijms23105608
Chicago/Turabian StyleTakahashi, Shigekazu, Chiharu Yoshida, Hideyuki Takahashi, and Masahiro Nishihara. 2022. "Isolation and Functional Analysis of EPHEMERAL1-LIKE (EPH1L) Genes Involved in Flower Senescence in Cultivated Japanese Gentians" International Journal of Molecular Sciences 23, no. 10: 5608. https://doi.org/10.3390/ijms23105608
APA StyleTakahashi, S., Yoshida, C., Takahashi, H., & Nishihara, M. (2022). Isolation and Functional Analysis of EPHEMERAL1-LIKE (EPH1L) Genes Involved in Flower Senescence in Cultivated Japanese Gentians. International Journal of Molecular Sciences, 23(10), 5608. https://doi.org/10.3390/ijms23105608