Characterization of a Novel Aspartic Protease from Rhizomucor miehei Expressed in Aspergillus niger and Its Application in Production of ACE-Inhibitory Peptides
Abstract
:1. Introduction
2. Materials and Methods
2.1. Strains, Culture Media, and Reagents
2.2. Bioinformatics Analysis and Construction of the Recombinant Plasmid
2.3. Transformation and Screening of the Recombinant A. niger
2.4. Expression and Production of RmproB
2.5. Measurement of Protease Activity and Protein Content
2.6. Purification of RmproB
2.7. Biochemical Properties of RmproB
2.8. Substrate Specificity and Kinetic Parameters of RmproB
2.9. Analysis of Milk-Clotting Activity and Casein Hydrolysis of RmproB
2.10. Preparation of ACE-Inhibitory Peptides by RmproB
3. Results
3.1. Gene Cloning and Sequence Analysis of RmproB
3.2. Expression and Purification of RmproB
3.3. Biochemical Characterization of RmproB
3.4. Milk-Clotting Activity and Casein Hydrolysis
3.5. Preparation of ACE-Inhibitory Peptides by RmproB
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Conflicts of Interest
References
- Gurumallesh, P.; Alagu, K.; Ramakrishnan, B.; Muthusamy, S. A systematic reconsideration on proteases. Int. J. Biol. Macromol. 2019, 128, 254–267. [Google Scholar] [CrossRef] [PubMed]
- Razzaq, A.; Shamsi, S.; Ali, A.; Ali, Q.; Sajjad, M.; Malik, A.; Ashraf, M. Microbial Proteases Applications. Front. Bioeng. Biotechnol. 2019, 7, 110. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Theron, L.W.; Divol, B. Microbial aspartic proteases: Current and potential applications in industry. Appl. Microbiol. Biotechnol. 2014, 98, 8853–8868. [Google Scholar] [CrossRef] [PubMed]
- Belenkaya, S.V.; Balabova, D.V.; Belov, A.N.; Koval, A.D.; Shcherbakov, D.N.; Elchaninov, V.V. Basic Biochemical Properties of Recombinant Chymosins (Review). Appl. Biochem. Microbiol. 2020, 56, 363–372. [Google Scholar] [CrossRef]
- Dalgleish, D.G.; Corredig, M. The Structure of the Casein Micelle of Milk and Its Changes During Processing. Annu. Rev. Food Sci. Technol. 2012, 3, 449–467. [Google Scholar] [CrossRef]
- Da Silva, R.R. Exploring Microbial Peptidases for Cheese Production: A Viewpoint on the Current Conjecture. J. Agric. Food Chem. 2018, 66, 1305–1306. [Google Scholar] [CrossRef]
- Leite Júnior, B.R.D.C.; Tribst, A.A.L.; Cristianini, M. Influence of high pressure homogenization on commercial protease from Rhizomucor miehei: Effects on proteolytic and milk-clotting activities. LWT Food Sci. Technol. 2015, 63, 739–744. [Google Scholar] [CrossRef] [Green Version]
- Stergiou, P.Y.; Foukis, A.; Gkini, O.A.; Barouni, E.; Georgoulia, P.S.; Kanellaki, M.; Koutinas, A.A.; Papagianni, M.; Papamichael, E.M. Novel FRET-substrates of Rhizomucor pusillus rennin: Activity and mechanistic studies. Food Chem. 2018, 245, 926–933. [Google Scholar] [CrossRef]
- Yegin, S.; Goksungur, Y.; Fernandez-Lahore, M. Purification, structural characterization, and technological properties of an aspartyl proteinase from submerged cultures of Mucor mucedo DSM 809. Food Chem. 2012, 133, 1312–1319. [Google Scholar] [CrossRef]
- Meyer, V.; Basenko, E.Y.; Benz, J.P.; Braus, G.H.; Caddick, M.X.; Csukai, M.; De Vries, R.P.; Endy, D.; Frisvad, J.C.; Gunde-Cimerman, N.; et al. Growing a circular economy with fungal biotechnology: A white paper. Fungal Biol. Biotechnol. 2020, 7, 5. [Google Scholar] [CrossRef] [Green Version]
- Mojzita, D.; Rantasalo, A.; Jäntti, J. Gene expression engineering in fungi. Curr. Opin. Biotechnol. 2019, 59, 141–149. [Google Scholar] [CrossRef]
- Schuster, E.; Dunn-Coleman, N.; Frisvad, J.; van Dijck, P. On the safety of Aspergillus niger—A review. Appl. Microbiol. Biotechnol. 2002, 59, 426–435. [Google Scholar] [CrossRef]
- Mohanty, A.; Mukhopadhyay, U.; Grover, S.; Batish, V. Bovine chymosin: Production by rDNA technology and application in cheese manufacture. Biotechnol. Adv. 1999, 17, 205–217. [Google Scholar] [CrossRef]
- Sharma, R.; Katoch, M.; Srivastava, P.S.; Qazi, G.N. Approaches for refining heterologous protein production in filamentous fungi. World J. Microbiol. Biotechnol. 2009, 25, 2083–2094. [Google Scholar] [CrossRef]
- Ward, M.; Wilson, L.J.; Kodama, K.H.; Rey, M.W.; Berka, R.M. Improved Production of Chymosin in Aspergillus by Expression as a Glucoamylase-Chymosin Fusion. Nat. Biotechnol. 1990, 8, 435–440. [Google Scholar] [CrossRef]
- Dunn-Coleman, N.S.; Bloebaum, P.; Berka, R.M.; Bodie, E.; Robinson, N.; Armstrong, G.; Ward, M.; Przetak, M.; Carter, G.L.; LaCost, R.; et al. Commercial Levels of Chymosin Production by Aspergillus. Bio/Technology 1991, 9, 976–981. [Google Scholar] [CrossRef]
- van den Brink, H.M.; Petersen, S.G.; Rahbek-Nielsen, H.; Hellmuth, K.; Harboe, M. Increased production of chymosin by glycosylation. J. Biotechnol. 2006, 125, 304–310. [Google Scholar] [CrossRef]
- Nevalainen, H.; Peterson, R. Making recombinant proteins in filamentous fungi- are we expecting too much? Front. Microbiol. 2014, 5, 75. [Google Scholar] [CrossRef]
- Wösten, H.A.B. Filamentous fungi for the production of enzymes, chemicals and materials. Curr. Opin. Biotechnol. 2019, 59, 65–70. [Google Scholar] [CrossRef]
- Coronado-Cáceres, L.J.; Hernández-Ledesma, B.; Mojica, L.; Quevedo-Corona, L.; Rabadán-Chávez, G.; Castillo-Herrera, G.A.; Lugo Cervantes, E. Cocoa (Theobroma cacao L.) Seed-Derived Peptides Reduce Blood Pressure by Interacting with the Catalytic Site of the Angiotensin-Converting Enzyme. Foods 2021, 10, 2340. [Google Scholar] [CrossRef]
- Xue, L.; Yin, R.; Howell, K.; Zhang, P. Activity and bioavailability of food protein-derived angiotensin-I-converting enzyme–inhibitory peptides. Compr. Rev. Food Sci. Food Saf. 2021, 20, 1150–1187. [Google Scholar] [CrossRef]
- Han, Z.-L.; Han, S.-Y.; Zheng, S.-P.; Lin, Y. Enhancing thermostability of a Rhizomucor miehei lipase by engineering a disulfide bond and displaying on the yeast cell surface. Appl. Microbiol. Biotechnol. 2009, 85, 117–126. [Google Scholar] [CrossRef]
- Soltani, M.; Sahingil, D.; Gokce, Y.; Hayaloglu, A.A. Changes in volatile composition and sensory properties of Iranian ultrafiltered white cheese as affected by blends of Rhizomucor miehei protease or camel chymosin. J. Dairy Sci. 2016, 99, 7744–7754. [Google Scholar] [CrossRef]
- Sun, Q.; Chen, F.; Geng, F.; Luo, Y.; Gong, S.; Jiang, Z. A novel aspartic protease from Rhizomucor miehei expressed in Pichia pastoris and its application on meat tenderization and preparation of turtle peptides. Food Chem. 2018, 245, 570–577. [Google Scholar] [CrossRef]
- Chen, X.; Wang, B.; Pan, L. Heterologous expression and characterization of Penicillium citrinum nuclease P1 in Aspergillus niger and its application in the production of nucleotides. Protein Expr. Purif. 2019, 156, 36–43. [Google Scholar] [CrossRef]
- Cai, L.-N.; Xu, S.-N.; Lu, T.; Lin, D.-Q.; Yao, S.-J. Directed expression of halophilic and acidophilic β-glucosidases by introducing homologous constitutive expression cassettes in marine Aspergillus niger. J. Biotechnol. 2019, 292, 12–22. [Google Scholar] [CrossRef]
- Anson, M.L. The estimation of pepsin, trypsin, papain, and cathepsin with hemoglobin. J. Gen. Physiol. 1938, 22, 79–89. [Google Scholar] [CrossRef]
- Lowry, O.H.; Rosebrough, N.J.; Farr, A.L.; Randall, R.J. Protein measurement with the Folin phenol reagent. J. Biol. Chem. 1951, 193, 265–275. [Google Scholar] [CrossRef]
- Arima, K.; Iwasaki, S.; Tamura, G. Milk Clotting Enzyme from Microorganisms. Agric. Biol. Chem. 1967, 31, 540–551. [Google Scholar] [CrossRef]
- Egito, A.; Girardet, J.-M.; Laguna, L.; Poirson, C.; Mollé, D.; Miclo, L.; Humbert, G.; Gaillard, J.-L. Milk-clotting activity of enzyme extracts from sunflower and albizia seeds and specific hydrolysis of bovine κ-casein. Int. Dairy J. 2007, 17, 816–825. [Google Scholar] [CrossRef]
- Zhang, P.; Chang, C.; Liu, H.; Li, B.; Yan, Q.; Jiang, Z. Identification of novel angiotensin I-converting enzyme (ACE) inhibitory peptides from wheat gluten hydrolysate by the protease of Pseudomonas aeruginosa. J. Funct. Foods 2020, 65, 103751. [Google Scholar] [CrossRef]
- Cushman, D.; Cheung, H. Spectrophotometric assay and properties of the angiotensin-converting enzyme of rabbit lung. Biochem. Pharmacol. 1971, 20, 1637–1648. [Google Scholar] [CrossRef]
- Woolford, C.; Daniels, L.B.; Park, F.J.; Jones, E.W.; Van Arsdell, J.N.; A Innis, M. The PEP4 gene encodes an aspartyl protease implicated in the posttranslational regulation of Saccharomyces cerevisiae vacuolar hydrolases. Mol. Cell. Biol. 1986, 6, 2500–2510. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Reichard, U.; Cole, G.T.; Rüchel, R.; Monod, M. Molecular cloning and targeted deletion of PEP2 which encodes a novel aspartic proteinase from Aspergillus fumigatus. Int. J. Med. Microbiol. 2000, 290, 85–96. [Google Scholar] [CrossRef]
- Vázquez-Laslop, N.; Tenney, K.; Bowman, B.J. Characterization of a Vacuolar Protease in Neurospora crassa and the Use of Gene RIPing to Generate Protease-deficient Strains. J. Biol. Chem. 1996, 271, 21944–21949. [Google Scholar] [CrossRef] [Green Version]
- Celebi, M.; Topuzogullari, M.; Kuzu, H. Thermal Destabilization of Rhizomucor miehei Rennet with Aldehyde Dextran Sulfate: Purification, Bioconjugation and Milk-Clotting Activities. Appl. Biochem. Biotechnol. 2016, 180, 261–273. [Google Scholar] [CrossRef]
- Deng, J.-J.; Huang, W.-Q.; Li, Z.; Lu, D.-L.; Zhang, Y.; Luo, X.-C. Biocontrol activity of recombinant aspartic protease from Trichoderma harzianum against pathogenic fungi. Enzym. Microb. Technol. 2018, 112, 35–42. [Google Scholar] [CrossRef]
- Guo, Y.; Li, X.; Jia, W.; Huang, F.; Liu, Y.; Zhang, C. Characterization of an intracellular aspartic protease (PsAPA) from Penicillium sp. XT7 and its application in collagen extraction. Food Chem. 2021, 345, 128834. [Google Scholar] [CrossRef]
- Li, J.; Wu, T.; Ma, N.; Wang, X.; Yang, J.; Li, J.; Zhang, H. Expression of acid protease from Aspergillus kawachii in Aspergillus niger. J. Northeast Agric. Univ. 2016, 47, 29–35. [Google Scholar] [CrossRef]
- da Silva, R.R.; Souto, T.B.; de Oliveira, T.B.; de Oliveira, L.C.G.; Karcher, D.; Juliano, M.A.; Juliano, L.; de Oliveira, A.H.C.; Rodrigues, A.; Rosa, J.C.; et al. Evaluation of the catalytic specificity, biochemical properties, and milk clotting abilities of an aspartic peptidase from Rhizomucor miehei. J. Ind. Microbiol. Biotechnol. 2016, 43, 1059–1069. [Google Scholar] [CrossRef] [Green Version]
- Guo, Y.; Tu, T.; Yuan, P.; Wang, Y.; Ren, Y.; Yao, B.; Luo, H. High-level expression and characterization of a novel aspartic protease from Talaromyces leycettanus JCM12802 and its potential application in juice clarification. Food Chem. 2019, 281, 197–203. [Google Scholar] [CrossRef]
- Purushothaman, K.; Bhat, S.K.; Singh, S.A.; Marathe, G.; Rao, A.R.G.A. Aspartic protease from Aspergillus niger: Molecular characterization and interaction with pepstatin A. Int. J. Biol. Macromol. 2019, 139, 199–212. [Google Scholar] [CrossRef]
- Preetha, S.; Boopathy, R. Purification and characterization of a milk clotting protease from Rhizomucor miehei. World J. Microbiol. Biotechnol. 1997, 13, 573–578. [Google Scholar] [CrossRef]
- Majumder, R.; Banik, S.P.; Khowala, S. Purification and characterisation of κ-casein specific milk-clotting metalloprotease from Termitomyces clypeatus MTCC 5091. Food Chem. 2015, 173, 441–448. [Google Scholar] [CrossRef]
- Theron, L.W.; Bely, M.; Divol, B. Characterisation of the enzymatic properties of MpAPr1, an aspartic protease secreted by the wine yeast Metschnikowia pulcherrima. J. Sci. Food Agric. 2017, 97, 3584–3593. [Google Scholar] [CrossRef]
- Vishwanatha, K.; Rao, A.G.A.; Singh, S.A. Characterisation of acid protease expressed from Aspergillus oryzae MTCC 5341. Food Chem. 2009, 114, 402–407. [Google Scholar] [CrossRef]
- Sun, Q.; Wang, X.-P.; Yan, Q.-J.; Chen, W.; Jiang, Z.-Q. Purification and Characterization of a Chymosin from Rhizopus microsporus var. rhizopodiformis. Appl. Biochem. Biotechnol. 2014, 174, 174–185. [Google Scholar] [CrossRef]
- Vishwanatha, K.S.; Rao, A.G.A.; Singh, S.A. Production and characterization of a milk-clotting enzyme from Aspergillus oryzae MTCC 5341. Appl. Microbiol. Biotechnol. 2009, 85, 1849–1859. [Google Scholar] [CrossRef]
- Zhao, X.; Cai, M.; Yang, Z.-J.; Luo, T.-Q.; Sarwar, A.; Megrous, S.; Aziz, T.; Yang, Z.-N. Purification and characterization of a novel milk-clotting enzyme produced by Bacillus amyloliquefaciens GSBa-1. Eur. Food Res. Technol. 2019, 245, 2447–2457. [Google Scholar] [CrossRef]
- Jin, S.; Pang, Q.; Yang, H.; Diao, X.; Shan, A.; Feng, X. Effects of dietary resveratrol supplementation on the chemical composition, oxidative stability and meat quality of ducks (Anas platyrhynchos). Food Chem. 2021, 363, 130263. [Google Scholar] [CrossRef]
- Yang, J.; Huang, J.; Dong, X.; Zhang, Y.; Zhou, X.; Huang, M.; Zhou, G. Purification and identification of antioxidant peptides from duck plasma proteins. Food Chem. 2020, 319, 126534. [Google Scholar] [CrossRef]
- Yang, J.; Huang, J.; Zhu, Z.; Huang, M. Investigation of optimal conditions for production of antioxidant peptides from duck blood plasma: Response surface methodology. Poult. Sci. 2020, 99, 7159–7168. [Google Scholar] [CrossRef]
- Abadía-García, L.; Castaño-Tostado, E.; Cardador-Martínez, A.; Martín-Del-Campo, S.T.; Amaya-Llano, S.L. Production of ACE Inhibitory Peptides from Whey Proteins Modified by High Intensity Ultrasound Using Bromelain. Foods 2021, 10, 2099. [Google Scholar] [CrossRef]
- Yu, Y.; Hu, J.; Bai, X.; Du, Y.; Lin, B. Preparation and function of oligopeptide-enriched hydrolysate from globin by pepsin. Process. Biochem. 2006, 41, 1589–1593. [Google Scholar] [CrossRef]
- Baba, W.N.; Baby, B.; Mudgil, P.; Gan, C.-Y.; Vijayan, R.; Maqsood, S. Pepsin generated camel whey protein hydrolysates with potential antihypertensive properties: Identification and molecular docking of antihypertensive peptides. LWT Food Sci. Technol. 2021, 143, 111135. [Google Scholar] [CrossRef]
- Li, P.; Jia, J.; Fang, M.; Zhang, L.; Guo, M.; Xie, J.; Xia, Y.; Zhou, L.; Wei, D. In vitro and in vivo ACE inhibitory of pistachio hydrolysates and in silico mechanism of identified peptide binding with ACE. Process. Biochem. 2014, 49, 898–904. [Google Scholar] [CrossRef]
Substrate | Specific Activity (U/mg) 2 | Relative Activity (%) |
---|---|---|
Casein | 3176.1 ± 67.1 | 100 |
Hemoglobin | 3011.1 ± 78.2 | 94.8 ± 2.5 |
Myoglobin | 2552.3 ± 68.8 | 80.4 ± 2.2 |
Bovine serum albumin | 2344.3 ± 79.7 | 73.8 ± 2.5 |
Skimmed milk | 1917.1 ± 84.7 | 60.4 ± 2.7 |
Egg albumin | 1393.5 ± 17.0 | 43.9 ± 0.5 |
Whey protein | 631.3 ± 81.0 | 19.9 ± 2.5 |
Lactoglobulin | 161.9 ± 148.2 | 5.1 ± 4.7 |
Start-End | Mr (expt) 1 | Mr (calc) 2 | Peptide Sequences 3 |
---|---|---|---|
22–32 | 1319.7829 | 1319.7853 | K.IAKYIPIQYVL.S |
33–63 | 3757.8904 | 3757.8932 | L.SRYPSYGLNYYQQKPVALINNQFLPYPYYAK.P |
64–79 | 1776.0013 | 1776.0046 | K.PAAVRSPAQILQWQVL.S |
80–105 | 3012.4690 | 3012.4811 | L.SNTVPAKSCQAQPTTMARHPHPHLSF.M |
106–148 | 4525.2573 | 4525.2633 | F.MAIPPKKNQDKTEIPTINTIASGEPTSTPTTEAVESTVATLED.S |
149–169 | 2196.1274 | 2196.1162 | D.SPEVIESPPEINTVQVTSTAV.- |
Hydrolysis Time (h) | Molecular Weight Distribution (%) | ACE-Inhibitory Rate (%) 2 | |||
---|---|---|---|---|---|
<1 kDa | 1–2 kDa | 2–5 kDa | >5 kDa | ||
0 | 16.8 | 2.9 | 13.5 | 66.8 | 8.6 ± 1.2 a |
2 | 71.9 | 13.5 | 10.1 | 4.5 | 71.9 ± 1.6 b |
4 | 79.8 | 12.0 | 7.3 | 0.9 | 79.2 ± 0.2 c |
6 | 84.1 | 10.8 | 5.1 | 0.0 | 85.1 ± 1.2d |
8 | 88.5 | 8.9 | 2.6 | 0.0 | 90.7 ± 1.4 e |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Wang, S.; Zhang, P.; Xue, Y.; Yan, Q.; Li, X.; Jiang, Z. Characterization of a Novel Aspartic Protease from Rhizomucor miehei Expressed in Aspergillus niger and Its Application in Production of ACE-Inhibitory Peptides. Foods 2021, 10, 2949. https://doi.org/10.3390/foods10122949
Wang S, Zhang P, Xue Y, Yan Q, Li X, Jiang Z. Characterization of a Novel Aspartic Protease from Rhizomucor miehei Expressed in Aspergillus niger and Its Application in Production of ACE-Inhibitory Peptides. Foods. 2021; 10(12):2949. https://doi.org/10.3390/foods10122949
Chicago/Turabian StyleWang, Shounan, Peng Zhang, Yibin Xue, Qiaojuan Yan, Xue Li, and Zhengqiang Jiang. 2021. "Characterization of a Novel Aspartic Protease from Rhizomucor miehei Expressed in Aspergillus niger and Its Application in Production of ACE-Inhibitory Peptides" Foods 10, no. 12: 2949. https://doi.org/10.3390/foods10122949
APA StyleWang, S., Zhang, P., Xue, Y., Yan, Q., Li, X., & Jiang, Z. (2021). Characterization of a Novel Aspartic Protease from Rhizomucor miehei Expressed in Aspergillus niger and Its Application in Production of ACE-Inhibitory Peptides. Foods, 10(12), 2949. https://doi.org/10.3390/foods10122949