Bacteriocins in Cancer Treatment: Mechanisms and Clinical Potentials
Abstract
1. Introduction
2. Bacteriocin
2.1. Classification of Bacteriocins
2.1.1. Class I Bacteriocins
2.1.2. Class II Bacteriocins
2.1.3. Class III Bacteriocins
3. Anticancer Mechanisms of Bacteriocins
3.1. Selective Membrane Destruction Mechanisms
3.1.1. Barrel-Stave Model
3.1.2. Carpet Model
3.1.3. Toroidal-Pore Model
3.1.4. Wedge-like Model
3.2. Non-Membrane Destruction Mechanisms
3.2.1. Induction of Apoptosis
3.2.2. Cell Cycle Arrest
3.2.3. Inhibition of Metastasis
4. Clinical Potential of Bacteriocins in Cancer Treatment
4.1. Bacteriocins Alone for Cancer Treatment in Clinical Study
4.2. Bacteriocins Combined with Anticancer Drugs for Cancer Treatment
5. Challenges and Ways Forward
6. Conclusions and Perspective
Author Contributions
Funding
Conflicts of Interest
Abbreviations
References
- Bray, F.; Laversanne, M.; Sung, H.; Ferlay, J.; Siegel, R.L.; Soerjomataram, I.; Jemal, A. Global Cancer Statistics 2022: GLOBOCAN Estimates of Incidence and Mortality Worldwide for 36 Cancers in 185 Countries. CA Cancer J. Clin. 2024, 74, 229–263. [Google Scholar] [CrossRef] [PubMed]
- Debela, D.T.; Muzazu, S.G.; Heraro, K.D.; Ndalama, M.T.; Mesele, B.W.; Haile, D.C.; Kitui, S.K.; Manyazewal, T. New Approaches and Procedures for Cancer Treatment: Current Perspectives. SAGE Open Med. 2021, 9, 20503121211034366. [Google Scholar] [CrossRef] [PubMed]
- Naghizadeh, S.; Mansoori, B.; Mohammadi, A.; Sakhinia, E.; Baradaran, B. Gene Silencing Strategies in Cancer Therapy: An Update for Drug Resistance. Curr. Med. Chem. 2019, 26, 6282–6303. [Google Scholar] [CrossRef] [PubMed]
- Bakare, O.O.; Gokul, A.; Wu, R.; Niekerk, L.-A.; Klein, A.; Keyster, M. Biomedical Relevance of Novel Anticancer Peptides in the Sensitive Treatment of Cancer. Biomolecules 2021, 11, 1120. [Google Scholar] [CrossRef] [PubMed]
- Dong, Z.; Zhang, X.; Zhang, Q.; Tangthianchaichana, J.; Guo, M.; Du, S.; Lu, Y. Anticancer Mechanisms and Potential Anticancer Applications of Antimicrobial Peptides and Their Nano Agents. Int. J. Nanomed. 2024, 19, 1017–1039. [Google Scholar] [CrossRef]
- Kordi, M.; Borzouyi, Z.; Chitsaz, S.; Asmaei, M.H.; Salami, R.; Tabarzad, M. Antimicrobial Peptides with Anticancer Activity: Today Status, Trends and Their Computational Design. Arch. Biochem. Biophys. 2023, 733, 109484. [Google Scholar] [CrossRef] [PubMed]
- Papo, N.; Shai, Y. Host Defense Peptides as New Weapons in Cancer Treatment. Cell. Mol. Life Sci. 2005, 62, 784–790. [Google Scholar] [CrossRef] [PubMed]
- Arunmanee, W.; Ecoy, G.A.U.; Khine, H.E.E.; Duangkaew, M.; Prompetchara, E.; Chanvorachote, P.; Chaotham, C. Colicin N Mediates Apoptosis and Suppresses Integrin-Modulated Survival in Human Lung Cancer Cells. Molecules 2020, 25, 816. [Google Scholar] [CrossRef]
- Paiva, A.D.; de Oliveira, M.D.; de Paula, S.O.; Baracat-Pereira, M.C.; Breukink, E.; Mantovani, H.C. Toxicity of Bovicin HC5 against Mammalian Cell Lines and the Role of Cholesterol in Bacteriocin Activity. Microbiology 2012, 158, 2851–2858. [Google Scholar] [CrossRef]
- Wang, H.; Jin, J.; Pang, X.; Bian, Z.; Zhu, J.; Hao, Y.; Zhang, H.; Xie, Y. Plantaricin BM-1 Decreases Viability of SW480 Human Colorectal Cancer Cells by Inducing Caspase-Dependent Apoptosis. Front. Microbiol. 2022, 13, 1103600. [Google Scholar] [CrossRef]
- He, J.-F.; Jin, D.-X.; Luo, X.-G.; Zhang, T.-C. LHH1, a Novel Antimicrobial Peptide with Anti-Cancer Cell Activity Identified from Lactobacillus Casei HZ1. AMB Express 2020, 10, 204. [Google Scholar] [CrossRef]
- Balcik-Ercin, P.; Sever, B. An Investigation of Bacteriocin Nisin Anti-Cancer Effects and FZD7 Protein Interactions in Liver Cancer Cells. Chem. Biol. Interact. 2022, 366, 110152. [Google Scholar] [CrossRef] [PubMed]
- Cornut, G.; Fortin, C.; Soulières, D. Antineoplastic Properties of Bacteriocins: Revisiting Potential Active Agents. Am. J. Clin. Oncol. 2008, 31, 399–404. [Google Scholar] [CrossRef] [PubMed]
- Kaur, S.; Kaur, S. Bacteriocins as Potential Anticancer Agents. Front. Pharmacol. 2015, 6, 272. [Google Scholar] [CrossRef] [PubMed]
- Garcia-Gutierrez, E.; Mayer, M.J.; Cotter, P.D.; Narbad, A. Gut Microbiota as a Source of Novel Antimicrobials. Gut Microbes 2018, 10, 1–21. [Google Scholar] [CrossRef] [PubMed]
- Darbandi, A.; Asadi, A.; Mahdizade Ari, M.; Ohadi, E.; Talebi, M.; Halaj Zadeh, M.; Darb Emamie, A.; Ghanavati, R.; Kakanj, M. Bacteriocins: Properties and Potential Use as Antimicrobials. J. Clin. Lab. Anal. 2021, 36, e24093. [Google Scholar] [CrossRef] [PubMed]
- Daba, G.M.; Elkhateeb, W.A. Ribosomally Synthesized Bacteriocins of Lactic Acid Bacteria: Simplicity yet Having Wide Potentials—A Review. Int. J. Biol. Macromol. 2024, 256, 128325. [Google Scholar] [CrossRef] [PubMed]
- Baindara, P.; Korpole, S.; Grover, V. Bacteriocins: Perspective for the Development of Novel Anticancer Drugs. Appl. Microbiol. Biotechnol. 2018, 102, 10393–10408. [Google Scholar] [CrossRef] [PubMed]
- Anjana, A.; Tiwari, S.K. Bacteriocin-Producing Probiotic Lactic Acid Bacteria in Controlling Dysbiosis of the Gut Microbiota. Front. Cell. Infect. Microbiol. 2022, 12, 851140. [Google Scholar] [CrossRef] [PubMed]
- Nes, I.F.; Diep, D.B.; Håvarstein, L.S.; Brurberg, M.B.; Eijsink, V.; Holo, H. Biosynthesis of Bacteriocins in Lactic Acid Bacteria. Antonie Van Leeuwenhoek 1996, 70, 113–128. [Google Scholar] [CrossRef]
- Klaenhammer, T.R. Genetics of Bacteriocins Produced by Lactic Acid Bacteria. FEMS Microbiol. Rev. 1993, 12, 39–85. [Google Scholar] [CrossRef] [PubMed]
- Wu, A.; Fu, Y.; Kong, L.; Shen, Q.; Liu, M.; Zeng, X.; Wu, Z.; Guo, Y.; Pan, D. Production of a Class IIb Bacteriocin with Broad-Spectrum Antimicrobial Activity in Lactiplantibacillus Plantarum RUB1. Probiotics Antimicrob. Proteins 2021, 13, 1820–1832. [Google Scholar] [CrossRef] [PubMed]
- Dubey, S.; Diep, D.B.; Evensen, Ø.; Munang’andu, H.M. Garvicin KS, a Broad-Spectrum Bacteriocin Protects Zebrafish Larvae against Lactococcus Garvieae Infection. Int. J. Mol. Sci. 2022, 23, 2833. [Google Scholar] [CrossRef] [PubMed]
- Juturu, V.; Wu, J.C. Microbial Production of Bacteriocins: Latest Research Development and Applications. Biotechnol. Adv. 2018, 36, 2187–2200. [Google Scholar] [CrossRef] [PubMed]
- Cui, Y.; Luo, L.; Wang, X.; Lu, Y.; Yi, Y.; Shan, Y.; Liu, B.; Zhou, Y.; Lü, X. Mining, Heterologous Expression, Purification, Antibactericidal Mechanism, and Application of Bacteriocins: A Review. Compr. Rev. Food Sci. Food Saf. 2021, 20, 863–899. [Google Scholar] [CrossRef] [PubMed]
- Lin, T.-Y.; Weibel, D.B. Organization and Function of Anionic Phospholipids in Bacteria. Appl. Microbiol. Biotechnol. 2016, 100, 4255–4267. [Google Scholar] [CrossRef]
- Zhang, Q.-Y.; Yan, Z.-B.; Meng, Y.-M.; Hong, X.-Y.; Shao, G.; Ma, J.-J.; Cheng, X.-R.; Liu, J.; Kang, J.; Fu, C.-Y. Antimicrobial Peptides: Mechanism of Action, Activity and Clinical Potential. Mil. Med. Res. 2021, 8, 48. [Google Scholar] [CrossRef] [PubMed]
- Molujin, A.M.; Abbasiliasi, S.; Nurdin, A.; Lee, P.-C.; Gansau, J.A.; Jawan, R. Bacteriocins as Potential Therapeutic Approaches in the Treatment of Various Cancers: A Review of In Vitro Studies. Cancers 2022, 14, 4758. [Google Scholar] [CrossRef]
- Magana, M.; Pushpanathan, M.; Santos, A.L.; Leanse, L.; Fernandez, M.; Ioannidis, A.; Giulianotti, M.A.; Apidianakis, Y.; Bradfute, S.; Ferguson, A.L.; et al. The Value of Antimicrobial Peptides in the Age of Resistance. Lancet Infect. Dis. 2020, 20, e216–e230. [Google Scholar] [CrossRef]
- Reuben, R.C.; Torres, C. Bacteriocins: Potentials and Prospects in Health and Agrifood Systems. Arch. Microbiol. 2024, 206, 233. [Google Scholar] [CrossRef]
- Radaic, A.; de Jesus, M.B.; Kapila, Y.L. Bacterial Anti-Microbial Peptides and Nano-Sized Drug Delivery Systems: The State of the Art toward Improved Bacteriocins. J. Control. Release 2020, 321, 100–118. [Google Scholar] [CrossRef] [PubMed]
- Shi, G.; Kang, X.; Dong, F.; Liu, Y.; Zhu, N.; Hu, Y.; Xu, H.; Lao, X.; Zheng, H. DRAMP 3.0: An Enhanced Comprehensive Data Repository of Antimicrobial Peptides. Nucleic Acids Res. 2022, 50, D488–D496. [Google Scholar] [CrossRef] [PubMed]
- Zacharof, M.P.; Lovitt, R.W. Bacteriocins Produced by Lactic Acid Bacteria a Review Article. APCBEE Procedia 2012, 2, 50–56. [Google Scholar] [CrossRef]
- Cotter, P.D.; Hill, C.; Ross, R.P. Bacteriocins: Developing Innate Immunity for Food. Nat. Rev. Microbiol. 2005, 3, 777–788. [Google Scholar] [CrossRef] [PubMed]
- Sahl, H.G.; Bierbaum, G. Lantibiotics: Biosynthesis and Biological Activities of Uniquely Modified Peptides from Gram-Positive Bacteria. Annu. Rev. Microbiol. 1998, 52, 41–79. [Google Scholar] [CrossRef] [PubMed]
- And, H.C.; Hoover, D.G. Bacteriocins and Their Food Applications. Compr. Rev. Food Sci. Food Saf. 2003, 2, 82–100. [Google Scholar] [CrossRef] [PubMed]
- Riedl, S.; Rinner, B.; Asslaber, M.; Schaider, H.; Walzer, S.; Novak, A.; Lohner, K.; Zweytick, D. In Search of a Novel Target—Phosphatidylserine Exposed by Non-Apoptotic Tumor Cells and Metastases of Malignancies with Poor Treatment Efficacy. Biochim. Biophys. Acta (BBA)—Biomembr. 2011, 1808, 2638–2645. [Google Scholar] [CrossRef]
- Kufe, D.W. Mucins in Cancer: Function, Prognosis and Therapy. Nat. Rev. Cancer 2009, 9, 874–885. [Google Scholar] [CrossRef] [PubMed]
- Groux-Degroote, S.; Guérardel, Y.; Delannoy, P. Gangliosides: Structures, Biosynthesis, Analysis, and Roles in Cancer. ChemBioChem 2017, 18, 1146–1154. [Google Scholar] [CrossRef]
- Vicente, C.M.; da Silva, D.A.; Sartorio, P.V.; Silva, T.D.; Saad, S.S.; Nader, H.B.; Forones, N.M.; Toma, L. Heparan Sulfate Proteoglycans in Human Colorectal Cancer. Anal. Cell. Pathol. 2018, 2018, 8389595. [Google Scholar] [CrossRef]
- Zalba, S.; ten Hagen, T.L.M. Cell Membrane Modulation as Adjuvant in Cancer Therapy. Cancer Treat. Rev. 2017, 52, 48–57. [Google Scholar] [CrossRef]
- Signati, L.; Allevi, R.; Piccotti, F.; Albasini, S.; Villani, L.; Sevieri, M.; Bonizzi, A.; Corsi, F.; Mazzucchelli, S. Ultrastructural Analysis of Breast Cancer Patient-Derived Organoids. Cancer Cell Int. 2021, 21, 423. [Google Scholar] [CrossRef] [PubMed]
- Zeisig, R.; Koklic, T.; Wiesner, B.; Fichtner, I.; Sentjurc, M. Increase in Fluidity in the Membrane of MT3 Breast Cancer Cells Correlates with Enhanced Cell Adhesion in Vitro and Increased Lung Metastasis in NOD/SCID Mice. Arch. Biochem. Biophys. 2007, 459, 98–106. [Google Scholar] [CrossRef]
- Ren, J.; Hamada, J.; Okada, F.; Takeichi, N.; Morikawa, K.; Hosokawa, M.; Kobayashi, H. Correlation between the Presence of Microvilli and the Growth or Metastatic Potential of Tumor Cells. Jpn. J. Cancer Res. 1990, 81, 920–926. [Google Scholar] [CrossRef] [PubMed]
- Aghamiri, S.; Zandsalimi, F.; Raee, P.; Abdollahifar, M.-A.; Tan, S.C.; Low, T.Y.; Najafi, S.; Ashrafizadeh, M.; Zarrabi, A.; Ghanbarian, H.; et al. Antimicrobial Peptides as Potential Therapeutics for Breast Cancer. Pharmacol. Res. 2021, 171, 105777. [Google Scholar] [CrossRef] [PubMed]
- Chan, S.C.; Hui, L.; Chen, H.M. Enhancement of the Cytolytic Effect of Anti-Bacterial Cecropin by the Microvilli of Cancer Cells. Anticancer. Res. 1998, 18, 4467–4474. [Google Scholar]
- Moll, G.N.; Konings, W.N.; Driessen, A.J. Bacteriocins: Mechanism of Membrane Insertion and Pore Formation. Antonie Van Leeuwenhoek 1999, 76, 185–198. [Google Scholar] [CrossRef]
- Yoneyama, F.; Imura, Y.; Ohno, K.; Zendo, T.; Nakayama, J.; Matsuzaki, K.; Sonomoto, K. Peptide-Lipid Huge Toroidal Pore, a New Antimicrobial Mechanism Mediated by a Lactococcal Bacteriocin, Lacticin Q. Antimicrob. Agents Chemother. 2009, 53, 3211–3217. [Google Scholar] [CrossRef]
- Tahara, T.; Kanatani, K. Isolation, Partial Characterization and Mode of Action of Acidocin J1229, a Bacteriocin Produced by Lactobacillus Acidophilus JCM 1229. J. Appl. Bacteriol. 1996, 81, 669–677. [Google Scholar] [CrossRef]
- Tahara, T.; Oshimura, M.; Umezawa, C.; Kanatani, K. Isolation, Partial Characterization, and Mode of Action of Acidocin J1132, a Two-Component Bacteriocin Produced by Lactobacillus Acidophilus JCM 1132. Appl. Environ. Microbiol. 1996, 62, 892–897. [Google Scholar] [CrossRef]
- Yeaman, M.R.; Yount, N.Y. Mechanisms of Antimicrobial Peptide Action and Resistance. Pharmacol. Rev. 2003, 55, 27–55. [Google Scholar] [CrossRef] [PubMed]
- Tripathi, A.K.; Vishwanatha, J.K. Role of Anti-Cancer Peptides as Immunomodulatory Agents: Potential and Design Strategy. Pharmaceutics 2022, 14, 2686. [Google Scholar] [CrossRef] [PubMed]
- Lopes, J.L.S.; Gómara, M.J.; Haro, I.; Tonarelli, G.; Beltramini, L.M. Contribution of the Tyr-1 in Plantaricin149a to Disrupt Phospholipid Model Membranes. Int. J. Mol. Sci. 2013, 14, 12313–12328. [Google Scholar] [CrossRef] [PubMed]
- Li, M.; Yoneyama, F.; Toshimitsu, N.; Zendo, T.; Nakayama, J.; Sonomoto, K. Lethal Hydroxyl Radical Accumulation by a Lactococcal Bacteriocin, Lacticin Q. Antimicrob. Agents Chemother. 2013, 57, 3897–3902. [Google Scholar] [CrossRef] [PubMed]
- Riedlová, K.; Dolejšová, T.; Fišer, R.; Cwiklik, L. H1 Helix of Colicin U Causes Phospholipid Membrane Permeation. Biochim. Biophys. Acta Biomembr. 2022, 1864, 183866. [Google Scholar] [CrossRef] [PubMed]
- Sobko, A.A.; Kotova, E.A.; Antonenko, Y.N.; Zakharov, S.D.; Cramer, W.A. Lipid Dependence of the Channel Properties of a Colicin E1-Lipid Toroidal Pore. J. Biol. Chem. 2006, 281, 14408–14416. [Google Scholar] [CrossRef] [PubMed]
- Driessen, A.J.; van den Hooven, H.W.; Kuiper, W.; van de Kamp, M.; Sahl, H.G.; Konings, R.N.; Konings, W.N. Mechanistic Studies of Lantibiotic-Induced Permeabilization of Phospholipid Vesicles. Biochemistry 1995, 34, 1606–1614. [Google Scholar] [CrossRef] [PubMed]
- Moll, G.N.; Roberts, G.C.; Konings, W.N.; Driessen, A.J. Mechanism of Lantibiotic-Induced Pore-Formation. Antonie Van Leeuwenhoek 1996, 69, 185–191. [Google Scholar] [CrossRef] [PubMed]
- Zhu, L.; Zeng, J.; Wang, C.; Wang, J. Structural Basis of Pore Formation in the Mannose Phosphotransferase System by Pediocin PA-1. Appl. Environ. Microbiol. 2022, 88, e0199221. [Google Scholar] [CrossRef]
- Mårtensson, C.U.; Doan, K.N.; Becker, T. Effects of Lipids on Mitochondrial Functions. Biochim. Biophys. Acta Mol. Cell Biol. Lipids 2017, 1862, 102–113. [Google Scholar] [CrossRef]
- Joo, N.E.; Ritchie, K.; Kamarajan, P.; Miao, D.; Kapila, Y.L. Nisin, an Apoptogenic Bacteriocin and Food Preservative, Attenuates HNSCC Tumorigenesis via CHAC1. Cancer Med. 2012, 1, 295–305. [Google Scholar] [CrossRef] [PubMed]
- Hetz, C.; Bono, M.R.; Barros, L.F.; Lagos, R. Microcin E492, a Channel-Forming Bacteriocin from Klebsiella Pneumoniae, Induces Apoptosis in Some Human Cell Lines. Proc. Natl. Acad. Sci. USA 2002, 99, 2696–2701. [Google Scholar] [CrossRef] [PubMed]
- Punj, V.; Bhattacharyya, S.; Saint-Dic, D.; Vasu, C.; Cunningham, E.A.; Graves, J.; Yamada, T.; Constantinou, A.I.; Christov, K.; White, B.; et al. Bacterial Cupredoxin Azurin as an Inducer of Apoptosis and Regression in Human Breast Cancer. Oncogene 2004, 23, 2367–2378. [Google Scholar] [CrossRef] [PubMed]
- Montalto, F.I.; De Amicis, F. Cyclin D1 in Cancer: A Molecular Connection for Cell Cycle Control, Adhesion and Invasion in Tumor and Stroma. Cells 2020, 9, 2648. [Google Scholar] [CrossRef] [PubMed]
- Hosseini, S.S.; Goudarzi, H.; Ghalavand, Z.; Hajikhani, B.; Rafeieiatani, Z.; Hakemi-Vala, M. Anti-Proliferative Effects of Cell Wall, Cytoplasmic Extract of Lactococcus Lactis and Nisin through down-Regulation of Cyclin D1 on SW480 Colorectal Cancer Cell Line. Iran. J. Microbiol. 2020, 12, 424–430. [Google Scholar] [CrossRef] [PubMed]
- Engeland, K. Cell Cycle Arrest through Indirect Transcriptional Repression by P53: I Have a DREAM. Cell Death Differ. 2018, 25, 114–132. [Google Scholar] [CrossRef] [PubMed]
- Yamada, T.; Goto, M.; Punj, V.; Zaborina, O.; Chen, M.L.; Kimbara, K.; Majumdar, D.; Cunningham, E.; Das Gupta, T.K.; Chakrabarty, A.M. Bacterial Redox Protein Azurin, Tumor Suppressor Protein P53, and Regression of Cancer. Proc. Natl. Acad. Sci. USA 2002, 99, 14098–14103. [Google Scholar] [CrossRef] [PubMed]
- Yamada, T.; Mehta, R.R.; Lekmine, F.; Christov, K.; King, M.L.; Majumdar, D.; Shilkaitis, A.; Green, A.; Bratescu, L.; Beattie, C.W.; et al. A Peptide Fragment of Azurin Induces a P53-Mediated Cell Cycle Arrest in Human Breast Cancer Cells. Mol. Cancer Ther. 2009, 8, 2947–2958. [Google Scholar] [CrossRef] [PubMed]
- Norouzi, Z.; Salimi, A.; Halabian, R.; Fahimi, H. Nisin, a Potent Bacteriocin and Anti-Bacterial Peptide, Attenuates Expression of Metastatic Genes in Colorectal Cancer Cell Lines. Microb. Pathog. 2018, 123, 183–189. [Google Scholar] [CrossRef]
- Das, S.; Amin, S.A.; Jha, T. Inhibitors of Gelatinases (MMP-2 and MMP-9) for the Management of Hematological Malignancies. Eur. J. Med. Chem. 2021, 223, 113623. [Google Scholar] [CrossRef]
- El-Sayed Ibrahim, N.; Morsy, H.; Abdelgwad, M. The Comparative Effect of Nisin and Thioridazine as Potential Anticancer Agents on Hepatocellular Carcinoma. Rep. Biochem. Mol. Biol. 2021, 9, 452–462. [Google Scholar] [CrossRef] [PubMed]
- Maher, S.; McClean, S. Investigation of the Cytotoxicity of Eukaryotic and Prokaryotic Antimicrobial Peptides in Intestinal Epithelial Cells in Vitro. Biochem. Pharmacol. 2006, 71, 1289–1298. [Google Scholar] [CrossRef] [PubMed]
- Begde, D.; Bundale, S.; Mashitha, P.; Rudra, J.; Nashikkar, N.; Upadhyay, A. Immunomodulatory Efficacy of Nisin—A Bacterial Lantibiotic Peptide. J. Pept. Sci. 2011, 17, 438–444. [Google Scholar] [CrossRef] [PubMed]
- Prince, A.; Tiwari, A.; Ror, P.; Sandhu, P.; Roy, J.; Jha, S.; Mallick, B.; Akhter, Y.; Saleem, M. Attenuation of Neuroblastoma Cell Growth by Nisin Is Mediated by Modulation of Phase Behavior and Enhanced Cell Membrane Fluidity. Phys. Chem. Chem. Phys. 2019, 21, 1980–1987. [Google Scholar] [CrossRef] [PubMed]
- Sadri, H.; Aghaei, M.; Akbari, V. Nisin Induces Apoptosis in Cervical Cancer Cells via Reactive Oxygen Species Generation and Mitochondrial Membrane Potential Changes. Biochem. Cell Biol. 2022, 100, 136–141. [Google Scholar] [CrossRef] [PubMed]
- Zainodini, N.; Hassanshahi, G.; Hajizadeh, M.; Khanamani Falahati-Pour, S.; Mahmoodi, M.; Mirzaei, M.R. Nisin Induces Cytotoxicity and Apoptosis in Human Asterocytoma Cell Line (SW1088). Asian Pac. J. Cancer Prev. 2018, 19, 2217–2222. [Google Scholar] [CrossRef] [PubMed]
- Kamarajan, P.; Hayami, T.; Matte, B.; Liu, Y.; Danciu, T.; Ramamoorthy, A.; Worden, F.; Kapila, S.; Kapila, Y. Nisin ZP, a Bacteriocin and Food Preservative, Inhibits Head and Neck Cancer Tumorigenesis and Prolongs Survival. PLoS ONE 2015, 10, e0131008. [Google Scholar] [CrossRef]
- Kamarajan, P.; Ateia, I.; Shin, J.M.; Fenno, J.C.; Le, C.; Zhan, L.; Chang, A.; Darveau, R.; Kapila, Y.L. Periodontal Pathogens Promote Cancer Aggressivity via TLR/MyD88 Triggered Activation of Integrin/FAK Signaling That Is Therapeutically Reversible by a Probiotic Bacteriocin. PLoS Pathog. 2020, 16, e1008881. [Google Scholar] [CrossRef] [PubMed]
- Lewies, A.; Wentzel, J.F.; Miller, H.C.; Du Plessis, L.H. The Antimicrobial Peptide Nisin Z Induces Selective Toxicity and Apoptotic Cell Death in Cultured Melanoma Cells. Biochimie 2018, 144, 28–40. [Google Scholar] [CrossRef]
- Patil, S.M.; Kunda, N.K. Nisin ZP, an Antimicrobial Peptide, Induces Cell Death and Inhibits Non-Small Cell Lung Cancer (NSCLC) Progression in Vitro in 2D and 3D Cell Culture. Pharm. Res. 2022, 39, 2859–2870. [Google Scholar] [CrossRef]
- Lee, D.G.; Hahm, K.-S.; Park, Y.; Kim, H.-Y.; Lee, W.; Lim, S.-C.; Seo, Y.-K.; Choi, C.-H. Functional and Structural Characteristics of Anticancer Peptide Pep27 Analogues. Cancer Cell Int. 2005, 5, 21. [Google Scholar] [CrossRef]
- Beaulieu, L. Production, Purification et Caracterisation de La Pediocine PA-1 Naturelle et de Ses Formes Recombinantes: Contribution a La Mise En Evidence d’une Nouvelle Activite Biologique. Ph.D. Thesis, Universite Laval, Québec, QC, Canada, 2004. (French and English Text). [Google Scholar]
- Villarante, K.I.; Elegado, F.B.; Iwatani, S.; Zendo, T.; Sonomoto, K.; de Guzman, E.E. Purification, Characterization and in Vitro Cytotoxicity of the Bacteriocin from Pediococcus Acidilactici K2a2-3 against Human Colon Adenocarcinoma (HT29) and Human Cervical Carcinoma (HeLa) Cells. World J. Microbiol. Biotechnol. 2011, 27, 975–980. [Google Scholar] [CrossRef]
- Kumar, B. In Vitro Cytotoxicity of Native and Rec-Pediocin CP2 Against Cancer Cell Lines: A Comparative Study. Pharm. Anal. Acta 2012, 3, 8. [Google Scholar] [CrossRef]
- De Giani, A.; Bovio, F.; Forcella, M.; Fusi, P.; Sello, G.; Di Gennaro, P. Identification of a Bacteriocin-like Compound from Lactobacillus Plantarum with Antimicrobial Activity and Effects on Normal and Cancerogenic Human Intestinal Cells. AMB Express 2019, 9, 88. [Google Scholar] [CrossRef] [PubMed]
- Zhao, H.; Sood, R.; Jutila, A.; Bose, S.; Fimland, G.; Nissen-Meyer, J.; Kinnunen, P.K.J. Interaction of the Antimicrobial Peptide Pheromone Plantaricin A with Model Membranes: Implications for a Novel Mechanism of Action. Biochim. Biophys. Acta 2006, 1758, 1461–1474. [Google Scholar] [CrossRef] [PubMed]
- Sand, S.L.; Oppegård, C.; Ohara, S.; Iijima, T.; Naderi, S.; Blomhoff, H.K.; Nissen-Meyer, J.; Sand, O. Plantaricin A, a Peptide Pheromone Produced by Lactobacillus Plantarum, Permeabilizes the Cell Membrane of Both Normal and Cancerous Lymphocytes and Neuronal Cells. Peptides 2010, 31, 1237–1244. [Google Scholar] [CrossRef] [PubMed]
- Baindara, P.; Gautam, A.; Raghava, G.P.S.; Korpole, S. Anticancer Properties of a Defensin like Class IId Bacteriocin Laterosporulin10. Sci. Rep. 2017, 7, 46541. [Google Scholar] [CrossRef] [PubMed]
- Ankaiah, D.; Esakkiraj, P.; Perumal, V.; Ayyanna, R.; Venkatesan, A. Probiotic Characterization of Enterococcus faecium Por1: Cloning, over Expression of Enterocin-A and Evaluation of Antibacterial, Anti-Cancer Properties. J. Funct. Foods 2017, 38, 280–292. [Google Scholar] [CrossRef]
- Ankaiah, D.; Palanichamy, E.; Antonyraj, C.B.; Ayyanna, R.; Perumal, V.; Ahamed, S.I.B.; Arul, V. Cloning, Overexpression, Purification of Bacteriocin Enterocin-B and Structural Analysis, Interaction Determination of Enterocin-A, B against Pathogenic Bacteria and Human Cancer Cells. Int. J. Biol. Macromol. 2018, 116, 502–512. [Google Scholar] [CrossRef] [PubMed]
- Varas, M.A.; Muñoz-Montecinos, C.; Kallens, V.; Simon, V.; Allende, M.L.; Marcoleta, A.E.; Lagos, R. Exploiting Zebrafish Xenografts for Testing the in Vivo Antitumorigenic Activity of Microcin E492 Against Human Colorectal Cancer Cells. Front. Microbiol. 2020, 11, 405. [Google Scholar] [CrossRef]
- Yang, D.-S.; Miao, X.-D.; Ye, Z.-M.; Feng, J.; Xu, R.-Z.; Huang, X.; Ge, F.-F. Bacterial Redox Protein Azurin Induce Apoptosis in Human Osteosarcoma U2OS Cells. Pharmacol. Res. 2005, 52, 413–421. [Google Scholar] [CrossRef]
- Kwan, J.M.; Fialho, A.M.; Kundu, M.; Thomas, J.; Hong, C.S.; Das Gupta, T.K.; Chakrabarty, A.M. Bacterial Proteins as Potential Drugs in the Treatment of Leukemia. Leuk. Res. 2009, 33, 1392–1399. [Google Scholar] [CrossRef] [PubMed]
- Mohamed, M.; Mostafa, S. Azurin as Antitumor Protein and Its Effect on the Cancer Cell Lines. Curr. Res. J. Biol. Sci. 2010, 2, 396–401. [Google Scholar]
- Cho, J.-H.; Lee, M.-H.; Cho, Y.-J.; Park, B.-S.; Kim, S.; Kim, G.-C. The Bacterial Protein Azurin Enhances Sensitivity of Oral Squamous Carcinoma Cells to Anticancer Drugs. Yonsei Med. J. 2011, 52, 773–778. [Google Scholar] [CrossRef]
- Chumchalová, J.; Smarda, J. Human Tumor Cells Are Selectively Inhibited by Colicins. Folia Microbiol. 2003, 48, 111–115. [Google Scholar] [CrossRef]
- Arunmanee, W.; Duangkaew, M.; Taweecheep, P.; Aphicho, K.; Lerdvorasap, P.; Pitchayakorn, J.; Intasuk, C.; Jiraratmetacon, R.; Syamsidi, A.; Chanvorachote, P.; et al. Resurfacing Receptor Binding Domain of Colicin N to Enhance Its Cytotoxic Effect on Human Lung Cancer Cells. Comput. Struct. Biotechnol. J. 2021, 19, 5225–5234. [Google Scholar] [CrossRef]
- Duangkaew, M.; Arunmanee, W. In Vitro Screening for Cytotoxic Effect of Pore Forming Colicin N and Its Domains on Human Cancer Cells. Trop. Life Sci. Res. 2022, 33, 163–177. [Google Scholar] [CrossRef]
- Abdi-Ali, A.; Worobec, E.A.; Deezagi, A.; Malekzadeh, F. Cytotoxic Effects of Pyocin S2 Produced by Pseudomonas Aeruginosa on the Growth of Three Human Cell Lines. Can. J. Microbiol. 2004, 50, 375–381. [Google Scholar] [CrossRef] [PubMed]
- Watanabe, T.; Saito, H. Cytotoxicity of Pyocin S2 to Tumor and Normal Cells and Its Interaction with Cell Surfaces. Biochim. Biophys. Acta 1980, 633, 77–86. [Google Scholar] [CrossRef]
- Chen, Y.-C.; Tsai, T.-L.; Ye, X.-H.; Lin, T.-H. Anti-Proliferative Effect on a Colon Adenocarcinoma Cell Line Exerted by a Membrane Disrupting Antimicrobial Peptide KL15. Cancer Biol. Ther. 2015, 16, 1172–1183. [Google Scholar] [CrossRef]
- Chen, Z.; Wang, L.; Liu, Y.; Han, P.; Hong, D.; Li, S.; Ma, A.; Jia, Y. Brevilaterin B from Brevibacillus Laterosporus Has Selective Antitumor Activity and Induces Apoptosis in Epidermal Cancer. World J. Microbiol. Biotechnol. 2022, 38, 201. [Google Scholar] [CrossRef] [PubMed]
- Chen, Z.; Wang, L.; Hong, D.; Liu, Y.; Han, P.; Li, S.; Jia, Y. Broad-Spectrum Cytotoxicity to Cancer Cells of Brevilaterin C from Brevibacillus Laterosporus and Its Specific Mechanism on Human Epidermal Cancer Cells. J. Cell. Biochem. 2022, 123, 1237–1246. [Google Scholar] [CrossRef] [PubMed]
- Yaghoubi, A.; Khazaei, M.; Avan, A.; Hasanian, S.M.; Cho, W.C.; Soleimanpour, S. P28 Bacterial Peptide, as an Anticancer Agent. Front. Oncol. 2020, 10, 1303. [Google Scholar] [CrossRef] [PubMed]
- Warso, M.A.; Richards, J.M.; Mehta, D.; Christov, K.; Schaeffer, C.; Rae Bressler, L.; Yamada, T.; Majumdar, D.; Kennedy, S.A.; Beattie, C.W.; et al. A First-in-Class, First-in-Human, Phase I Trial of P28, a Non-HDM2-Mediated Peptide Inhibitor of P53 Ubiquitination in Patients with Advanced Solid Tumours. Br. J. Cancer 2013, 108, 1061–1070. [Google Scholar] [CrossRef] [PubMed]
- Lulla, R.R.; Goldman, S.; Yamada, T.; Beattie, C.W.; Bressler, L.; Pacini, M.; Pollack, I.F.; Fisher, P.G.; Packer, R.J.; Dunkel, I.J.; et al. Phase I Trial of P28 (NSC745104), a Non-HDM2-Mediated Peptide Inhibitor of P53 Ubiquitination in Pediatric Patients with Recurrent or Progressive Central Nervous System Tumors: A Pediatric Brain Tumor Consortium Study. Neuro Oncol. 2016, 18, 1319–1325. [Google Scholar] [CrossRef] [PubMed]
- Chauhan, S.; Dhawan, D.K.; Saini, A.; Preet, S. Antimicrobial Peptides against Colorectal Cancer-a Focused Review. Pharmacol. Res. 2021, 167, 105529. [Google Scholar] [CrossRef] [PubMed]
- Preet, S.; Bharati, S.; Panjeta, A.; Tewari, R.; Rishi, P. Effect of Nisin and Doxorubicin on DMBA-Induced Skin Carcinogenesis--a Possible Adjunct Therapy. Tumour Biol. 2015, 36, 8301–8308. [Google Scholar] [CrossRef] [PubMed]
- Mohammadi, P.; Zangeneh, M.; Mohammadi-Motlagh, H.-R.; Khademi, F. The Antimicrobial Peptide, Nisin, Synergistically Enhances the Cytotoxic and Apoptotic Effects of Rituximab Treatment on Human Burkitt’s Lymphoma Cell Lines. Rep. Biochem. Mol. Biol. 2020, 9, 250–256. [Google Scholar] [CrossRef] [PubMed]
- Baxter, A.A.; Lay, F.T.; Poon, I.K.H.; Kvansakul, M.; Hulett, M.D. Tumor Cell Membrane-Targeting Cationic Antimicrobial Peptides: Novel Insights into Mechanisms of Action and Therapeutic Prospects. Cell. Mol. Life Sci. 2017, 74, 3809–3825. [Google Scholar] [CrossRef]
- Fathizadeh, H.; Saffari, M.; Esmaeili, D.; Moniri, R.; Kafil, H.S. Bacteriocins: New Potential Therapeutic Candidates in Cancer Therapy. Curr. Mol. Med. 2021, 21, 211–220. [Google Scholar] [CrossRef]
- Bengtsson, T.; Selegård, R.; Musa, A.; Hultenby, K.; Utterström, J.; Sivlér, P.; Skog, M.; Nayeri, F.; Hellmark, B.; Söderquist, B.; et al. Plantaricin NC8 Aβ Exerts Potent Antimicrobial Activity against Staphylococcus Spp. and Enhances the Effects of Antibiotics. Sci. Rep. 2020, 10, 3580. [Google Scholar] [CrossRef] [PubMed]
- Oppegård, C.; Rogne, P.; Kristiansen, P.E.; Nissen-Meyer, J. Structure Analysis of the Two-Peptide Bacteriocin Lactococcin G by Introducing D-Amino Acid Residues. Microbiology 2010, 156, 1883–1889. [Google Scholar] [CrossRef] [PubMed]
- Sánchez-Hidalgo, M.; Montalbán-López, M.; Cebrián, R.; Valdivia, E.; Martínez-Bueno, M.; Maqueda, M. AS-48 Bacteriocin: Close to Perfection. Cell. Mol. Life Sci. 2011, 68, 2845–2857. [Google Scholar] [CrossRef] [PubMed]
- O’Shea, E.F.; O’Connor, P.M.; Cotter, P.D.; Ross, R.P.; Hill, C. Synthesis of Trypsin-Resistant Variants of the Listeria-Active Bacteriocin Salivaricin P. Appl. Environ. Microbiol. 2010, 76, 5356–5362. [Google Scholar] [CrossRef] [PubMed]
- Fathizadeh, H.; Saffari, M.; Esmaeili, D.; Moniri, R.; Mahabadi, J.A. Anticancer Effect of Enterocin A-Colicin E1 Fusion Peptide on the Gastric Cancer Cell. Probiotics Antimicrob. Proteins 2021, 13, 1443–1451. [Google Scholar] [CrossRef] [PubMed]
- Haider, T.; Pandey, V.; Behera, C.; Kumar, P.; Gupta, P.N.; Soni, V. Nisin and Nisin-Loaded Nanoparticles: A Cytotoxicity Investigation. Drug Dev. Ind. Pharm. 2022, 48, 310–321. [Google Scholar] [CrossRef] [PubMed]
- Khazaei Monfared, Y.; Mahmoudian, M.; Cecone, C.; Caldera, F.; Zakeri-Milani, P.; Matencio, A.; Trotta, F. Stabilization and Anticancer Enhancing Activity of the Peptide Nisin by Cyclodextrin-Based Nanosponges against Colon and Breast Cancer Cells. Polymers 2022, 14, 594. [Google Scholar] [CrossRef]
- Hashad, R.A.; Singla, R.; Kaur Bhangu, S.; Jap, E.; Zhu, H.; Peleg, A.Y.; Blakeway, L.; Hagemeyer, C.E.; Cavalieri, F.; Ashokkumar, M.; et al. Chemoenzymatic Surface Decoration of Nisin-Shelled Nanoemulsions: Novel Targeted Drug-Nanocarriers for Cancer Applications. Ultrason. Sonochem. 2022, 90, 106183. [Google Scholar] [CrossRef]
Bacteriocin | Source | Uniprot ID/Sequence | Class | Size | Human Cancer Cell Line: IC50/Animal Model | Refs. |
---|---|---|---|---|---|---|
Nisin A | Lactococcus lactis | P13068/ ITSISLCTPGCKTGALMGCNMKTATCHCSIHVSK | I | 3.5 kDa | HNSCC cell lines (UM-SCC-17B, UM-SCC-14A and HSC-3)/oral cancer mouse model [in vivo]: nisin (200 mg/kg) reduced tumor volume colon cancer cell lines (LS180: 80–400 IU/mL, (SW48, HT-29: 89.9 µM, Caco-2: 115.0 µM): 350–800 IU/mL and SW480: 1000 µg/mL) breast adenocarcinoma cell line (MCF-7: 105.46 µM) liver hepatocellular carcinoma cell line (HepG2: 112.25 µM, (HuH-7 and SNU182): ≈96 µM) T cell leukemia cell line (Jurkat: 225 µM) astrocytoma cell line (SW1088: 50 µg/mL) neuroblastoma cell line (IMR-32: >25 µM) cervical cancer cell line (HeLa: 11.5 µM) ovarian carcinoma cell lines (OVCAR-3: 14.6 µM and SK-OV-3: 22.9 µM) | [9,12,61,65,69,72,73,74,75,76] |
Nisin Z | Lactococcus lactis SIK-83 | P29559/ ITSISLCTPGCKTGALMGCNMKTATCNCSIHVSK | I | 3.47 kDa | HNSCC cell lines (UM-SCC-17B, UM-SCC-14A and HSC-3)/oral cancer floor-of-mouth mouse model [in vivo]: nisin (400 and 800 mg/kg) reduced tumor volume lung carcinoma cell lines (A549: 132.4 µM and H1299: 137.3 µM) malignant melanoma cell line (A375: 188.5 µM) | [77,78,79,80] |
Bovicin HC5 | Streptococcus bovis HC5 | N.A./ VGXRYASXPGXSWKYVXFXXVK | I | 2.4 kDa | breast adenocarcinoma cell line (MCF-7: 279.39 µM) liver hepatocellular carcinoma cell line (HepG2: 289.30 µM) | [9] |
Pep27anal2 | Streptococcus pneumoniae | N.A./ MWKWFHNVLSWWWLLADKRPARDYNRK | I | 3.3 kDa | acute myelogenous leukemia cell line (AML-2: 29 µM) acute promyelocytic leukemia cell line (HL-60: 20 µM) T cell leukemia cell line (Jurkat: 23 µM) gastric cancer cell line (SNU-601: 25 µM) breast cancer cell line (MCF-7: <10 µM) | [81] |
Pediocin PA-1 | Pediococcus acidilactici PAC 1.0 | P29430 | II | 4.6 kDa | human lung carcinoma cell line (A-549: 1.66 µM) human colon adenocarcinoma cell line (DLD-1: 1.61 µM) | [82] |
Pediocin K2a2–3 | Pediococcus acidilactici K2a2–3 | N.A./IYYGNGPTRGIHSRSPQGGIATTWVWNNGAMAHATGGHQ_____ (five residues missing) | II | 4.6 kDa | colon adenocarcinoma cell line (HT-29): undialysed (1600 AU/mL): 55.0%; dialysed (800 AU/mL): 53.7% cervical carcinoma cell line (HeLa): undialysed (1600 AU/mL): 52.3% | [83] |
Pediocin CP2 | Pediococcus acidilactici CP2 MTCC5101 | N.A. | II | 4.6 kDa | hepatocarcinoma cell line (HepG2: <1 µg/mL) cervical adenocarcinoma cell line (HeLa: >1 µg/mL) mammary gland adenocarcinoma cell line (MCF-7: >1 µg/mL) | [84] |
Plantaricin BM-1 | Lactobacillus plantarum BM-1 | N.A. | II | 4.6 kDa | colorectal cancer cell lines (SW480: 757.9 µg/mL, Caco-2: 819.9 µg/mL, and HCT-116: 1578 µg/mL) | [10] |
Plantaricin P1053 | Lactobacillus plantarum strain PBS067 | N.A. | II | 1.05 kDa | colon cancer cell line (E705: >1 µg/mL) | [85] |
Plantaricin A | Lactobacillus plantarum C11 | P80214/KSSAYSLQMGATAIKQVKKLFKKWGW | II | 2.99 kDa | T cell leukemia cell line (Jurkat): 25 µM at 37 °C B cell precursor acute lymphoblastic leukemia cell line (Reh: 5–20 µM) | [86,87] |
Laterosporulin 10 | Brevibacillus sp. strain SKDU10 | N.A./ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | II | 5.6 kDa | cervical cancer cell line (HeLa): <10 µM embryonic kidney cancer cell line (HEK293T): <10 µM fibro-sarcoma cell line (HT1080): <10 µM lung carcinoma (H1299): <10 µM breast cancer cell line (MCF-7): <10 µM | [88] |
Enterocin A | Enterococcus faecium | C9BXY2/MKHLKILSIKETQLIYGGTTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGGAIPGKC | II | 7.24 kDa | colon cancer cell lines (HT-29: 50–120 µg/mL and Caco-2: 50–100 µg/mL) gastric cancer cell line (AGS: 50–100 µg/mL) cervical cancer cell line (HeLa: 25–100 µg/mL) | [89] |
Enterocin B | Enterococcus faecium | A3FEQ6/TNVKELSTKEMKQIIGGENDHRMPNELNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYS | II | 7.2 kDa | cervical cancer cell line (HeLa: >25 µg/mL) colon cancer cell line (HT-29: >25 µg/mL) gastric cancer cell line (AGS: >25 µg/mL) | [90] |
Microcin E492 | Klebsiella pneumoniae RYC492 | Q9Z4N4/GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPVLIGPSWNGSGSGYNSATSSSGSGS | II | 7.89 kDa | cervix carcinoma cell line (HeLa: >680 AU/mL) T cell leukemia cell line (Jurkat: <680 AU/mL) a variant of the human Burkitt lymphoma B cell line (RJ2.2.5: >680 AU/mL) colorectal adenocarcinoma cell lines (HT-29: 60 µg/mL and SW620: <60 µg/mL)/zebrafish larvae SW620 xenograft model [in vivo]: significantly reduced the tumor size | [62,91] |
Azurin | Pseudomonas aeruginosa | P00282 | III | 14 kDa | melanoma cell line (UISO-Mel-2: >800 µg/mL) human cancer xenotransplanted in nude mice [in vivo]: tumor volume was reduced by 59% in azurin-treated mice (0.5 mg) compared with controls breast cancer cell lines (MCF-7: 32 µM, MDD2: >60 µM, MDA-MB-157: 53 µM, and MDA-MB-231: >60 µM) nude mouse model with xenotransplanted MCF-7 cells [in vivo]: tumor volume was reduced by 85% in azurin-treated mice (1 mg) compared with controls osteosarcoma cell line (U2OS:114.54 mg/L) acute myeloid leukemia cell line (HL60: 2.5 µM) chronic myeloid leukemia cell line (K562: <2.5 µM) hepatocellular carcinoma cell line (HepG2: >8.0 µg/µL) colon carcinoma cell line (HCT-116: >10.0 µg/µL) oral squamous cell carcinoma cell line (YD-9: 200 µg/mL) | [63,67,92,93,94,95] |
Colicin A | Escherichia coli | Q47108 | III | 21.82 kDa | leiomyosarcoma cell line (SKUT-1: <105 AU) fibrosarcoma cell line (HS913T: 105 AU) breast carcinoma cell line (BT549: 105 AU) | [96] |
Colicin E1 | Escherichia coli | P02978 | III | 57 kDa | fibrosarcoma cell line (HS913T: >104 AU) | [96] |
Colicin N | Escherichia coli | P08083 | III | 42 kDa | lung cancer cell lines (H460: >15 µM, H292: >15 µM, H23: >15 µM, and A549: >42 µM) colon cancer cell lines (HCT-116 and HT-29): >42 µM breast cancer cell lines (MDA-MB-231: >42 µM) | [8,97,98] |
Pyocin S2 | Pseudomonas aeruginosa 42A | Q06584 | III | 73.8 kDa | hepatocellular carcinoma cell line (HepG2: 50 U/mL) multiple myeloma cell line (Im9: 25.5 U/mL) cervical cancer cell line (HeLa S3: At 400 units/mL, cells were inhibited after 2 days of culture) embryonal carcinoma of ovarium cell line (AS-II: At 400 units/mL, cells were inhibited after 4 days of culture) | [99,100] |
KL15 | Lactobacillus casei ATCC 334 | KRKLYKWFAHLIKGL | / | 1.9 kDa | colon adenocarcinoma cell lines (SW480 and Caco-2): 50 µg/mL or 26.3 µM | [101] |
Brevilaterin B | Brevibacillus laterosporus | Hmp-Aba-MOIVVKVLKYL-Valinol | / | 1.6 kDa | epidermal cancer cell line (A431: 2.75 µg/mL) colon cancer cell line (HCT-29: 1.40 µg/mL) renal cell carcinoma cell line (A-498: 2.33 µg/mL) gastric cancer cell lines (BGC-823: 5.68 µg/mL and SGC-7901: 5.73 µg/mL) | [102] |
Brevilaterin C | Brevibacillus laterosporus | Hmp-Aba-VOIVVKVLKYL-Valinol | / | 1.6 kDa | epidermal cancer cell line (A431: 3.81 µg/mL) colon cancer cell line (HCT-29: 2.21 µg/mL) non-small lung cancer cell line (A549: 4.19 µg/mL) renal cell carcinoma cell line (A-498: 4.16 µg/mL) gastric cancer cell lines (BGC-823: 5.44 µg/mL and SGC-7901: 5.69 µg/mL) | [103] |
LHH1 | Lactobacillus casei HZ1 | AFALIAGALYRIFHRR | / | 1.9 kDa | colon cancer cell line (HCT-116: 40.83 µM) nasopharyngeal carcinoma cell line (C666-1: 18.27 µM) gastric cancer cell line (MGC803: 31.55 µM) | [11] |
Bacteriocin | Identifier Number | Sponsor | Phase | Status | Cancer |
---|---|---|---|---|---|
Azurin-p28 | NCT00914914 | Dr. Tapas K. Das Gupta | I | completed | Solid tumor |
Azurin-p28 | NCT01975116 | Pediatric Brain Tumor Consortium | I | completed | CNS tumor |
Nisin ZP | NCT06097468 | University of California, San Francisco | I/II | recruiting | OCSCC |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Wang, Y.; Wang, Y.; Sun, T.; Xu, J. Bacteriocins in Cancer Treatment: Mechanisms and Clinical Potentials. Biomolecules 2024, 14, 831. https://doi.org/10.3390/biom14070831
Wang Y, Wang Y, Sun T, Xu J. Bacteriocins in Cancer Treatment: Mechanisms and Clinical Potentials. Biomolecules. 2024; 14(7):831. https://doi.org/10.3390/biom14070831
Chicago/Turabian StyleWang, Yiwen, Yue Wang, Tao Sun, and Junnan Xu. 2024. "Bacteriocins in Cancer Treatment: Mechanisms and Clinical Potentials" Biomolecules 14, no. 7: 831. https://doi.org/10.3390/biom14070831
APA StyleWang, Y., Wang, Y., Sun, T., & Xu, J. (2024). Bacteriocins in Cancer Treatment: Mechanisms and Clinical Potentials. Biomolecules, 14(7), 831. https://doi.org/10.3390/biom14070831