Next Article in Journal
Impact of Pus1 Pseudouridine Synthase on Specific Decoding Events in Saccharomyces cerevisiae
Next Article in Special Issue
Cell-Adhesion Properties of β-Subunits in the Regulation of Cardiomyocyte Sodium Channels
Previous Article in Journal
Expression of SCD and FADS2 Is Lower in the Necrotic Core and Growing Tumor Area than in the Peritumoral Area of Glioblastoma Multiforme
Previous Article in Special Issue
An Alternatively Translated Connexin 43 Isoform, GJA1-11k, Localizes to the Nucleus and Can Inhibit Cell Cycle Progression
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Assistance for Folding of Disease-Causing Plasma Membrane Proteins

by
Karina Juarez-Navarro
,
Victor M. Ayala-Garcia
,
Estela Ruiz-Baca
,
Ivan Meneses-Morales
,
Jose Luis Rios-Banuelos
and
Angelica Lopez-Rodriguez
*
Facultad de Ciencias Quimicas, Universidad Juarez del Estado de Durango, Durango C.P 34000, Mexico
*
Author to whom correspondence should be addressed.
Biomolecules 2020, 10(5), 728; https://doi.org/10.3390/biom10050728
Submission received: 9 February 2020 / Revised: 16 April 2020 / Accepted: 21 April 2020 / Published: 7 May 2020

Abstract

An extensive catalog of plasma membrane (PM) protein mutations related to phenotypic diseases is associated with incorrect protein folding and/or localization. These impairments, in addition to dysfunction, frequently promote protein aggregation, which can be detrimental to cells. Here, we review PM protein processing, from protein synthesis in the endoplasmic reticulum to delivery to the PM, stressing the main repercussions of processing failures and their physiological consequences in pathologies, and we summarize the recent proposed therapeutic strategies to rescue misassembled proteins through different types of chaperones and/or small molecule drugs that safeguard protein quality control and regulate proteostasis.

1. Introduction

Currently, we understand the plasma membrane (PM) not as a simple lipid bilayer protecting the cells or surrounding the cytoplasm but as a collection of stably folded membrane proteins (MPs) in an asymmetric arrangement. In the PM, peptides interact with the lipid bilayer hydrocarbon core, the bilayer interface, and water in a minimum free energy state, forming complex and dynamic protein–lipid structures that participate directly as messengers or regulators of many signal transduction cascades. Regulation of these complex structures is essential for life and health [1,2,3]. MPs are difficult to study in vitro for many reasons, such as their flexibility, instability, and relatively hydrophobic surface. Since the first MP structure was published in 1985 [4], our knowledge has increased slowly but steadily. However, many aspects of the cell membrane are incompletely understood, including its lipid–protein organization and its stability to allow substances that meet strict criteria to transit unaided or through protein transporters, maintaining the intracellular/extracellular balance of substances according to physiological conditions.
Understanding how PM proteins are regulated from their synthesis to their final localization could provide further insight into the mechanisms of certain cellular events, such as folding, molecular sorting, and intracellular transport, that take place in lipidic membranes after protein synthesis. A wide range of genetic diseases is related to MP misfolding. Because the mutant proteins are either retained/accumulated intracellularly or are dysfunctional at the PM, signaling cascades mediating various physiological processes are mainly affected. In this review, we focus on PM proteins, analyzing their synthesis, folding, and trafficking in addition to the mechanism allowing their expression and stability at the membrane, and highlighting approaches by which natural and synthetic chaperones can be used to rescue misfolded phenotypes as strategic therapies to treat misfolding-related diseases.

2. Membrane Proteins

The external boundary of the cell is the plasma membrane (PM), and organelles are delimited by intracellular membranes. Lipids are essential components of all cell membranes. The composition of lipids and MPs may differ substantially depending on the function, organelle type, cellular location, or tissue level with which they are associated [1,2,3]. In many cells, phospholipids (glycerophospholipids and sphingolipids) are the cellular building blocks, while non-phospholipids are important regulators of lipid organization [1]. Cholesterol is the most abundant non-phospholipid in mammalian biomembranes. In human brain cells, cholesterol is a major constituent; it is critical for brain development. Cholesterol depletion leads to central nervous system pathologies such as Huntington’s [5] and Alzheimer’s [6], among other diseases [7,8]. Lipid content of PM influences the ion channel electrostatic environment, leading to an indirect modulation of ionic current and charge movement by modifying the transmembrane. Different studies have experimentally demonstrated that voltage-gated potassium (Kv) channels are sensitive to cholesterol [7,8,9,10,11] and phospholipid content [12,13,14,15].
Indeed, lipid distribution is highly regulated and not random across different membranes as phosphoinositides (PIs) show a clear demarcation in the cell. The eight members of the mammalian PI family (PI, PI3P, PI4P, PI5P, PI(4,5)P2, PI(3,4)P2, PI(3,5)P2, and PI(3,4,5)P3) play critical roles in modulating biological processes, such as gene expression, signaling, and membrane and cytoskeletal responses, and in membrane trafficking, among others. Thus, whereas some members, such as PI3P and PI(3,5)P2, along with their effectors and specific phosphatases are mainly present at the early and late endosome, respectively [16], PI(4,5)P2 is essential for endocytosis, exocytosis, and the regulation, adhesion, and assembly of membrane proteins [17,18]. Because of the specific distribution of PI family members in the cell, it is reasonable to fulfill important roles for MP location and function. Recently, multiple roles of lipids in ion channels and transporter regulation have been demonstrated, highlighting the importance of lipid–protein interactions for the cell physiology [19,20].
The abundance of MPs in the cell is low compared to the total protein population; the proportion of putative MPs predicted from sequenced genomes is between 20% and 35% [21,22]. PM proteins carry out diverse functions such as transporting nutrients to cells, regulating the exchange of bioactive molecules and receiving chemical signals from the extracellular space, activating signaling pathways in response to different stimuli, allowing the translation of chemical signals into intracellular activity, enhancing intercellular interactions, and sometimes promoting cell anchoring in a particular location [23,24,25].
MPs are grouped into two broad categories based on the nature of their interactions: (1) Integral MPs, also called intrinsic proteins, are integrated into the membrane; many of them can span the entire lipid and include more than one linked transmembrane domain fully embedded in lipid bilayers (also called transmembrane proteins). Examples of integral MPs include aquaporins, ion channels, transporters, and pumps. (2) Peripheral MPs, or extrinsic proteins, are entirely outside the membrane, indirectly bound to it by weak molecular interactions (e.g., ionic, hydrogen, and/or Van der Waals bonds), with integral MPs or the polar head groups on lipids. These MPs include phospholipase C, alpha/beta hydrolase fold, annexins, and synapsin I [26,27,28].
The mechanisms governing the selection and localization of PM proteins are strongly controlled; MPs have additional sequences (e.g., stop–transfer sequence membrane-spanning regions, glycosylphosphatidylinositol (GPI) anchors) that allow their integration into endoplasmic reticulum (ER) membranes. As reticular membranes move to the Golgi apparatus and finally to the PM, transmembrane proteins, such as ion channels and transporters, remain integrated with the internal membranes and then associate with the external membrane or stay partially embedded in one leaflet of the bilayer [29,30,31,32]. Caveolins (Cavs) are a good example of integral proteins partially embedded in one leaflet of the bilayer. The amino and carboxy terminal domains of Cavs flank a central hydrophobic region; hence, the formation of a hairpin in the lipidic bilayer is suggested by the aminoacidic sequence of this protein. Cavs are essential proteins for the formation of PM invaginations called Caveolae (“little caves”). The co-translational ER membrane insertion of Cavs depends on the signal recognition sequence [33,34]. Cavs are exported in a vesicle-dependent manner from the ER to Golgi. After post-translational modifications, caveolae transport oligomeric Cavs embedded into cholesterol-rich membranes. At the cell surface, Cavs interact with protein adaptors (Cavins) to assist membrane curvature. The lipidome of caveolae depends on the cell type and physiological condition. Lipid–protein interaction in caveolae may influence protein conformation, protein interactions, or ligand affinity, affecting cascaded signal transduction and cell physiology [35].

Protein Biosynthesis

When mRNA reaches the cytosol, two ribosomal subunits associate with the initiation codon through eukaryotic initiation factors (eIFs) to integrate the translation initiation complex [36]. After the signal peptide denoting an MP is detected by the protein/RNA complex—called signal recognition particle (SRP)—the new protein will be inserted into the ER membrane, mediated in a co-translational or post-translational manner [37]. In general, all MPs are assembled in the ER, achieving their tertiary and quaternary structures.
In the co-translational pathway, many MPs and secretory proteins are formerly expressed as a pre-protein with an N-terminal topogenic sequence, which is a crucial signal peptide for protein localization and for protein insertion and orientation in cellular membranes. Commonly, 15 to 30 amino acids conform to the signal peptide; however, length can be up to 50 residues. This peptide sequence is typically cleaved off co-translationally [38]. Table 1 displays several signal sequences reported for proteins located in the ER and PM.
In general, even when sequence conservation among signal peptides is low, they have common secondary structural features, including a hydrophilic region at the N-terminal—which is frequently positively charged, a central hydrophobic domain, and a site for signal peptidase cleavage located in the C-terminal region; signal peptides can also display extended N-regions or hydrophobic regions [38,53].
After the signal peptide denoting an MP is detected by the SRP, it interacts with the SRP receptor in a GTP-dependent manner and undergoes several structural modifications. Then the SRP–ribosome complex docks to the translocon—a channel composed of proteins crossing the lipid bilayer to the ER lumen [10,17,18,19,20,21]—and translocation is resumed. the translocon is closed and the ribosome dissociates. The nascent protein is unloaded into the translocation channel (or translocon), GTP hydrolysis occurs, and the SRP receptor is free for another cycle [41]. Along with peptide translocation, signal peptide cleavage is mediated by the signal peptidase complex. Cleavage frequently occurs in a co-translational way [42,43,44], but it can also happen at some point between the early co-translational and late post-translational stages [45]. When translocation finishes, the translocon is closed and the ribosome dissociates.
When the ER protein in the lumen is translocated across the membrane, the protein is shifted laterally for anchoring within the phospholipid bilayer, allowing the protein to be integrated or assembled with other proteins into the ER membrane [54,55]. During translocation, enzymes (e.g., signal peptidases and oligosaccharyltransferase) can associate with the protein to cleave the signal peptide or N-glycosylate the translocating nascent chain [56,57].
In a conventional protein trafficking pathway after ER processing, vesicles favor the anterograde protein traffic toward the Golgi apparatus to further fuse transport vesicles with the target membrane, allowing protein insertion into the PM. Vesicular trafficking also occurs in an anterograde way to support PM protein quality control and cell integrity. A growing number of proteins have been associated with an unconventional protein trafficking pathway where proteins are delivered to the surface of the PM in an ER- or Golgi-independent manner. Exceptionally, most of the proteins following the unconventional trafficking pathway lack the classical N-terminal signal peptide, although if the signal peptide is recognized, proteins bypass the Golgi to reach the PM or be excreted [58].
Particularly, the C-tail anchored MPs—called tail-anchored (TA) proteins—constitute 3%–5% of the eukaryotic membrane proteome [37,59]; they lack the classical N-terminal signal for membrane insertion because they constitute a single stretch of hydrophobic amino acids where the membrane-interacting region is near the COOH terminus. After translation ends, a hydrophobic region is recognized and captured by specific cytosolic chaperones forming a pre-targeting complex that drives the opening of an ER membrane receptor, allowing TA protein insertion into the ER by a GTPase-dependent step [37,60,61]. TA proteins are found essentially in the intracellular membranes, carrying out various enzymatic and regulatory functions in the cellular metabolism, including apoptosis and protein quality control processes, besides protein localization and membrane traffic [62].

3. Membrane Protein Folding

In addition to the folding guided through the amino acid sequence, cytosolic regions may interact with intracellular proteins or chaperones for proper folding. Molecular chaperones are proteins that interact with a nascent protein to assist the stabilization of the native conformation, allowing the protein to remain in the intermediate states for longer during the folding process, but chaperones are frequently absent in the final functional structure [63]. The major ER-resident chaperones are proteins of the heat shock protein (Hsp) family [64], lectin chaperones, calnexin, and calreticulin [65].
Several Hsps are usually located in the ER; however, different types and levels of chaperone genes can be expressed under stress conditions or indifferent cellular stages [65,66,67,68,69,70].
In addition, chaperones assist the translocation machinery and play a role in the retrograde transport of aberrant proteins destined for proteasomal degradation [70,71], regulating the unfolded protein response (UPR) [72].
Along with an abundance of cytosolic and ER-specific molecular chaperones, the ER contains several classes of folding enzymes. Prolyl cis-trans isomerases, which via cis-trans isomerization of proline residues constrain the flexibility of the peptide backbone favoring the formation of disulfide bonds, catalyze co-translational and post-translational modifications important for protein folding [73,74,75]. Different kinds of chaperones are dissociated or associated with proteins throughout the protein maturation process [76,77].
Although an entire machinery of molecules participates in the protein folding process, misfolding sometimes happens despite the cell efforts to prevent it. Mutations and protein translation errors are frequently associated with protein misfolding. Nevertheless, different factors (e.g., age-related errors, exposure to environmental stress conditions, or lack of chaperone availability) can also induce aberrant folding [78]. To avoid misfolded protein aggregates, cells have developed sophisticated quality control mechanisms preventing dysfunctional proteins from reaching their destination. Control quality mechanisms are mediated by chaperone-dependent disaggregation and refolding systems and/or systems regulated through selective proteolysis. However, when a system fails, misfolded toxic aggregates lead to severe human diseases, such as neurodegenerative diseases (e.g., Alzheimer’s, Parkinson’s, Creutzfeldt–Jakob, and Huntington’s), diabetes, and cancer, among others [79,80,81].
The structural integrity of proteins must be constantly monitored by quality control mechanisms throughout their life—from translation in the ribosome to their arrival at the functional location in the cell. Once the proteins reach their final destination, a subsequent monitoring system ensures protein integrity; if at some point in their life cycle, proteins are recognized as terminally misfolded, they will be eliminated.
Proteins are synthesized on cytosolic ribosomes, but the ER is the main entry gate for secretory proteins expressed in intracellular organelles (including the ER), the PM, and cellular exterior. Hence, the ER features the first-line cellular quality control system (QCS) as it must ensure proper folding and assembly for proteins [63,82,83].

3.1. Quality Control Systems for Membrane Protein Folding

Cells have different QCSs to remove unfolded proteins. The UPR is a fundamental signaling pathway to keep cell homeostasis; through this pathway, unfolded proteins are exported from the ER and degraded in lysosomes, therefore increasing the ER folding capacity. When misfolded MPs are retained in the ER, the latter becomes stressed, and the UPR pathway is activated. The UPR comprises multiple strategies acting in parallel and/or in series to restore normal ER functioning [84].
In response to ER stress, major branches of the UPR are activated with the following aims: (1) increase the biosynthetic capacity—upregulate the expression of ER-resident chaperones—to prevent protein aggregation and facilitate correct protein folding; (2) control transcription, regulate mRNA abundance by stimulating or inhibiting transcription or by enhancing or compromising mRNA stability; (3) decrease the biosynthetic burden (attenuate translation) to reduce the transit of proteins through the ER, while the synthesis of membrane lipids increases the ER volume; (4) translocate misfolded proteins out of the ER; (5) remove misfolded proteins within the ER (by lysosomal/proteasomal degradation or ER autophagy) [85,86].
These branches include at least three mechanistically different components of the UPR: the RNA-dependent protein kinase-like ER kinase (PERK), activating transcription factor 6 (ATF6), and inositol-requiring ER-to-nucleus signal kinase 1 (IRE1). Coordinated actions of these proteins modulate gene expression, affecting the synthetic and secretory pathways, cell fate, and the metabolism of proteins, amino acids and lipids by activating specific transcription factors (e.g., ATF4, ATF6N, and X- box-binding protein 1 [XBP1], respectively) to lower ER stress [87]. A wide range of dysfunctions would otherwise be lethal if not for this intervention. When it becomes clear that a misfolded protein cannot be properly refolded, cellular stress persists, and the UPR negatively impacts the health of the cell and induces apoptosis [88,89,90]. As part of the UPR response, the transmembrane protein kinase PERK inhibits the translation of new proteins. After sensing ER stress, oligomerization of the luminal domain (N-terminal) of PERK facilitates autophosphorylation. After PERK is processed, it phosphorylates the α subunit of eukaryotic initiation factor 2 (eIF2α), which induces a transient attenuation of protein translation along with the activation of stress-responsive transcription factors to stimulate the expression of chaperones, oxidative response genes and autophagy/apoptosis genes, among other UPR-related proteins [53,54,55,91,92].
IRE-1 represents the most conserved signaling pathway. Through this pathway, chaperone expression is increased to modulate the ER-associated degradation (ERAD) pathway, responsible for a common process that clears the ER from potentially harmful species. ERAD machinery drives the retrotranslocation of misfolded proteins to the cytosol, where ubiquitin/proteasome proteolysis occurs [78,89]. ATF6 and IRE-1 interaction regulate the quantitative and qualitative expression of XBP1 to compensate for unfolded protein accumulation. After the UPR response is activated, ATF6 is transported to Golgi, where it is further enzymatically cleaved. The released fragment acts as a transcription factor that regulates the expression of proteins such as IRE1 and BiP chaperone [93,94].
Unfolded proteins stuck in the ER are eventually degraded; therefore, they must be retranslocated into the cytosol. Proteins require a signal, like ubiquitination, to be recognized for degradation, thus ensuring their delivery to the proteasome. However, a peptide signal for degradation is unclear. Experimental evidence shows that some molecular chaperones or protein disulfide isomerase homologs can associate with degradation substrates to prevent aggregation and escort selected polypeptides from the ER to the proteasome or lysosomes [95]. After retrotranslocation, several ubiquitin-binding proteins guide degradation substrates to the proteasome [96]. Even when glycosylation and protein degradation are evidently associated, it is less clear how non-glycosylated proteins are recognized for degradation. As the efficiency of binding through the calnexin/calreticulin cycle is dependent upon the oligosaccharide structure, proteins that are not properly glycosylated may activate a degradation pathway known as enhancing α-mannosidase-like protein (EDEM) [97]. Since the membrane protein degradation mechanism is not yet understood, it may start at the protein soluble parts after dislocation from the retrotranslocon or through a direct protein excision from the lipidic membrane. Analysis of MP degradation fate demonstrated that undegraded molecules accumulate in the cytoplasm when proteasome function is compromised, suggesting that transmembrane segments might be solubilized from the ER membrane before proteasome-mediated degradation [98].
Along with protein degradation mediated by proteasomes or lysosomes, ER autophagy (ER-phagy) can occur as an alternative to de-stress ER, removing aberrant portions of the ER containing abnormal proteins [99,100]. ER stress-mediated autophagy is a cellular catabolic process in which misfolded proteins, protein aggregates, and damaged ER regions are transported to the lysosome for degradation. Lysosomal degradation is induced by a set of hydrolases working in an acidic environment; afterwards, building blocks are recycled by the cell. The mechanisms by which MPs are tagged for lysosomal degradation are known when the translocation of cytosolic proteins is associated with a specific degradation signal (the KFERQ sequence motif) [101].
Evidently, the UPR response affects not only ER-related proteins but also genes associated with different cellular processes, including metabolism and inflammation; thus, gene regulation cannot always be explained through a canonical mechanism that only considers ER factors directly affecting protein processing [102,103]. UPR transcriptional output can be supported by parallel non-canonical stress-sensing mechanisms that may modulate the canonical mechanism. The translation of proteins that are not related to ER function may be implicated, as well as the self-association of proteins creating stress-specific scaffolds integrated by a multimeric protein complex. ER stress can also induce transcriptional cascades, expanding the expression of UPR gene regulatory networks and regulatory complexes not expressed constitutively. For example, the association of PERK and IRE-1 may create stress-specific scaffolds, inducing splicing mechanisms on XBP1 protein expression and affecting the transcriptional regulation [104]. IRE-1 can also recruit the TNF receptor-associated factor 2 (TRAF2), inducing activation kinases (e.g., IKK, JNK, ASK1, p38 MAPK, and ERK) that are important to determine the cell´s fate (survival/apoptosis) [105]. Another emerging point of regulation is related to microRNAs, the short (∼22 nt), single-stranded RNAs binding to complementary mRNAs to inhibit protein translation [106]. In general, the expansion of UPR signals impact cell fate.
To prevent issues related to the quality control of protein folding, the cell developed QCSs beyond ER checkpoints; for instance, in the Golgi apparatus, Rer1 and ERp44 proteins recognize immature proteins and facilitate their retrograde trafficking to the ER [107,108]. After passing the Golgi QCS, MPs embedded into transport vesicles can continue towards their functional locations. PMs also seem to have their own QCSs, including endocytic adaptors and ubiquitination systems, to monitor the MP structural integrity [109].
Therefore, intracellular trafficking is highly regulated, even when proteins may have particular motifs for exportation. If a QCS detects structural frustration indicating misfolding [110], proteins will be stuck in traffic. Misfolded proteins can undergo a refolding process, although proteins unable to fold may induce ER or mitochondrial stress, activating the degradation pathway to release the stress. After passing the QCS at the ER and Golgi, protein composition at the PM represents a complicated balance of membrane delivery, endocytosis, and recycling mechanisms [82] (Figure 1).
Long- and short-distance communication can take multiple vesicular forms, generally created through a membrane budding and pinching off mechanism. For MPs, vesicular transport is a milestone to safeguard proper folding and integrity while trafficking to the final destination. After ER processing, proteins are transported by coated vesicles (60–90 nm in diameter). The coat is a protein complex integrated by four subunits: Sec23/24-Sar1 selects cargo while Sec13/31 deforms the membrane to induce the budding. Some of the proteins incorporated into the vesicles can act as receptors for soluble proteins, thus favoring their packaging. After the vesicle buds from ER, translocation to the Golgi apparatus occurs, allowing post-translational modifications [111,112,113].
All cells contain a subset of membranous vesicular/tubular carriers formed by a direct budding of membranes. Vesicles are responsible for several cellular processes involving intracellular trafficking, including endocytosis and exocytosis. Primary endocytic vesicles can fuse with early endosomes to continue toward the protein maturation process—via a constitutive recycling pathway—or to prepare them for transportation to lysosomes [114]. Vesicles can be classified into three groups based on size and biogenesis: Apoptotic bodies released as an apoptotic response (800–5000 nm in diameter), ectosomes released directly from the PM (100–1000 nm in diameter), and exosomes originated from the inward budding of endosomes into multivesicular bodies (late endosomes; 30–100 nm in diameter) [115]. Despite the vesicular origin and size, there is still no reliable way to distinguish between ectosomes and exosomes, and the function may be quite analog. Particularly, some of the exosomes carry cargo molecules directly into the lysosomal compartment for degradation. Exosomes also form intraluminal vesicles to transport molecules (e.g., proteins, RNA [116,117] or Hsp chaperones [118]), which along with the cargo of extracellular vesicles may affect organelle function or modulate recipient cell function, thus contributing to the molecular intercellular transmission [119]. The recognition and packaging of cargo proteins result from multiple cooperative interactions between accessory proteins and lipids. Distinct ER-to-Golgi forward-trafficking signals have been identified on cargo or cargo receptor proteins. In potassium channels (Kir 1.1 and Kir2.1), the export signaling motif is not required for channel folding, assembly, or gating, but it is crucial for ER export [120].

3.2. Membrane Protein Modifications

After the new proteins are correctly folded and assembled in the ER, they travel towards the Golgi apparatus into transport vesicles, where they usually undergo different types of post-translational processing; however, protein modifications occurring co-translationally in the ER or post-transductionally in the Golgi apparatus also play an integral and crucial role in protein trafficking and function [112].
Some protein modifications, such as glycosylation, can reduce protein dynamics by increasing stability and favoring protein trafficking. N-glycosylation is the most common process to add sugar moieties to proteins. Glycosylation often starts while MP is translocated into the ER, and a preassembled polymannose oligosaccharide is transferred to the luminal N-aminoacidic residue of the classic motif including asparagine-X-serine/threonine(N-X-S/T) as a consensus sequence. Once in the Golgi, some enzymatic reactions can add sugar moieties or just modify the preexisting glycan tree complexity [121,122,123].
Phosphorylation is the enzymatic transference of phosphate from the ATP molecule on the side chains of serine, threonine, or tyrosine residues. Phosphorylation can occur co- or post-translationally in a reversible process affecting a wide variety of processes, including protein trafficking, clustering, conformation, and protein–protein interactions [124]. There are a few well-studied phosphorylation-induced trafficking examples. For instance, serotonin transporter (SERT) trafficking can be regulated when serine and threonine phosphorylation favors the recruitment of membrane skeleton adaptor protein Hic-5, inducing the actin-dependent endocytosis [125,126,127]. Exceptionally, phosphorylation at tyrosine residue in Kv1.3 triggers opposite effects depending on the protein life-stage, inducing either protein surface targeting or endocytosis of the channel [128].
The formation of reactive oxygen and nitrogen species (ROS/RNS) normally induces the post-translational oxidative modification of proteins, usually affecting cysteine residues due to their highly reactive thiol group. ROS/RNS can affect the thiol group of cysteine residues. In the mammalian proteome, two amino acids contain sulfur residues: cysteine and methionine. Particularly, the thiol group of cysteine enables multiple oxidation states allowing redox modifications that contribute to the signaling cascade specificity [129]. Many types of cysteine oxidative modifications can be reversed depending on the physiological condition of the cell [130]; protein modification through cysteine residues senses and transduces signaling cascades and regulates biological outcomes. Post-translational modifications like phosphorylation, glycosylation, and ubiquitination can combine with redox regulation to control cellular physiology. Even though many redox mechanisms affecting PM protein trafficking are still unknown, these mechanisms are interesting and promising, especially to understand the progression of many pathologies such as cancer and cardiovascular diseases [131].
At least six types of lipids, including fatty acids, sterols, isoprenoids, GPI anchors, and lipid-derived electrophiles, can attach to the cysteine, serine, or lysine residues of proteins. The covalent but reversible attachment of fatty acid with cysteines via a thioester linkage is called S-acylation, whereas the covalent interaction between lipids and proteins is called protein lipidation. This process occurs co- or post-translationally, and its deregulation has been linked to different diseases, including metabolic diseases, neurological disorders, and cancers [132]. Reversibility of protein lipidation allows multiple regulatory scenarios during protein lifetime. In most cases, the acyl chain attached to the protein is unknown; however, there is some experimental evidence showing that palmitoylation or myristoylation can modulate the trafficking of some potassium channels [133,134,135]. So far, covalently bound proteins-cholesterols are uncommon except in Hedgehog proteins, Smoothened, and Hh pathway co-receptor [132]. Protein phospholipid modification is also rare; to date, the only known example is the autophagy-related protein Atg8/LC3 [136,137].
Ubiquitination is a physiologically common interaction among proteins that describes the covalent attachment of ubiquitin to Lys residue in a target protein. Ubiquitination complexity is related to degradation, particularly in the ubiquitin–proteasome and autophagy–lysosome pathways. Alterations in the ubiquitin system lead to the development of many diseases [138].

3.3. Membrane Protein Expression and Stability

In general, protein misfolding can generate two different protein phenotypes (Figure 2): (1) Mislocalized proteins, which commonly induce cellular stress due to improper degradation [139] or structural alterations that establish novel toxic functions, sometimes inducing ER and mitochondrial stress leading to apoptosis [139,140,141] or amyloid accumulation [142,143,144,145,146,147,148,149], or (2) dysfunctional proteins due to an increased (overexpressed) or decreased (underexpressed) amount of protein reaching the PM. This phenotype occasionally disrupts protein stability at the PM (rendering proteins unstable) because of increased turnover via endocytic and recycling mechanisms; in addition, misfolded proteins that reach the PM frequently exhibit altered (atypical) functionality, such as underexpression, overexpression, or complete loss of function [150,151]. In some cases, the functionality of misfolded proteins is lost because of their mislocalization rather than the loss of the intrinsic ability of the mutant receptor to interact with its ligands or effectors.
The native forms of most proteins are in a maximum stable thermodynamic state [152]. However, many proteins are metastable, meaning that thermodynamic stability can also be achieved by using alternative folding pathways, thus inducing the formation of inactive conformations; this mechanism is crucial for regulating the biological function of proteins [152,153,154,155,156,157]. Therefore, under mild destabilizing conditions, proteins have an inherent tendency to misfold and aggregate and, hence, lose functionality. Protein levels are thus tightly regulated intracellularly and extracellularly; however, under some circumstances, such as aging, mutation, and environmental stress [158,159,160], misfolded proteins can have inappropriately exposed hydrophobic surfaces that are normally buried in the interior of the protein, leading to nonnative conformations that can interact with each other to form aggregates [161].

4. Physiological Consequences of Protein Misfolding

4.1. Effects on Membranes

The arrangement of amino acids and the exposure of hydrophobic residues are important factors affecting the ability of a protein to interact with a lipid membrane and can induce membrane fusion and destabilization. Several studies have shown that specific lipids (also called “lipochaperones”) can perform a chaperone-like function in insertion and folding, guiding the assembly of MPs [161,162]. Changes in the cell membrane affected by misfolded proteins can vary depending on the nature of the proteins and the type of lipids involved. Some proteins, particularly those characterized by electrostatic interactions, merely disrupt the membrane by the binding of positively charged amino acid residues to negative or polar lipid head groups. Such disturbances are likely reversible and short-term for some proteins [163,164,165]. In addition to electrostatic disturbance, the insertion of misfolded protein can affect membranes in several ways:
(A) Vesicle formation. The exit signals that direct proteins out of the ER for transport to the Golgi apparatus and beyond are poorly understood. Signal-dependent transport is mediated by the recognition of discrete export signals on the cargo molecule by specific receptors concentrated at specific vesicle binding sites. Thus, to be exported from the ER to the functional location, proteins must be properly folded and completely assembled, while misfolded proteins will remain in the ER bound to chaperone proteins, which may obscure the exit signals or anchor the proteins to the ER, disturbing MP trafficking into vesicles [166,167,168,169].
(B) Loss of membrane integrity. Different lipid compositions can alter the bilayer’s natural thickness. To shield hydrophobic surfaces from the aqueous environment, some membrane tension can be induced if the hydrophobic surface of an MP is thicker or thinner than the hydrocarbon core of the bilayer [170,171]. The arrangement of hydrophobic amino acid residues in a protein is fundamental to favor protein–lipid interactions, and misfolding may affect the shape or thickness of the membrane around the protein [172].
(C) Formation of pathologic ion channels. To minimize exposure of the hydrophobic regions to the aqueous medium, a hydrophobic protein may change its structural conformation to act as a bridge, allowing specific lipid interactions in the membranes and thus increasing the likelihood of ion channel formation, regardless of the native protein’s secondary structure [173].

4.2. Effect on Protein Structure and Assembly

The composition and spatial arrangement of the subunits integrating functional proteins are a prerequisite for protein function and trafficking to the cell membrane [31,171]. The assembly of diverse proteins to perform a specific function is possible depending upon cell type-specific subunit expression, as subunit assembly can be controlled in a developmentally regulated manner or in response to cellular activity. Protein assembly relies on subunit stability in the ER, intersubunit affinities, and potential subunit diffusion within the ER membrane. The homomeric structure is the simplest type of protein assembly; it can be integrated by self-assembly of repeated copies of the same subunit or formed from heteromeric complexes made of multiple distinct protein subunits [174]. Incompletely assembled complexes are usually selectively retained. The association of two or more polypeptide chains to form nonfunctional structures is defined as misassembly and is usually, by definition, a consequence of misfolding [175].
Misfolding and misassembly typically occur in the ER but can also affect other organelles, for example, (1) defective peroxisomal assembly is associated with inherited human diseases (commonly called peroxisomal biogenesis disorders), such as the severe cerebrohepatorenal Zellweger syndrome (ZS). PBDs are mainly caused by mutations in PEX genes codifying for peroxins, proteins responsible for normal peroxisome assembly and functions [176,177]. (2) Some transport vesicles carry cargo molecules transporting misassembled proteins to the Golgi apparatus or beyond. Proteins retained in the Golgi apparatus can also be targeted by lysosomes for degradation, suggesting that additional quality control checkpoints could act in this compartment [178,179]. (3) Misassembled proteins can be correctly targeted for degradation and transported out of the ER. When the degradation machinery fails, misassembled proteins accumulate in the cytosol as aggresomes [180].
Even when the loss of proteostasis underlies aging and neurodegeneration characterized by the accumulation of protein aggregates and mitochondrial dysfunction, the relationships among these negative factors are unclear. Evidence suggests that some cytosolic proteins susceptible to aggregation are imported to the mitochondria, which seems to act as a guardian of cytosolic proteostasis [181].
Conformational changes in the structure of a mutated protein lead to the formation of a partially folded intermediate. Intermediate states in protein folding naturally occur even in wild-type proteins. Folding/unfolding transitions thermodynamically and kinetically follow multiple discrete steps that can sometimes provide a starting point for aggregation [182]. When protein monomer aggregates produce fibrillar structures rich in β-strand conformations, the formed structures are usually called amyloid aggregates. Amyloidogenic proteins have been related to normal physiological functions such as bacterial biofilm formation or regulation of synthesis and storage of melanin in human. Amyloid aggregates are frequently related to neurodegenerative diseases that include Alzheimer’s disease, Parkinson’s disease, various tauopathies, and other human disorders [183]. Although there is no clear evidence that PM protein can form amyloid aggregates, experimental evidence shows pore formation in the bilayer due to the amyloid aggregate–lipid interaction [184,185,186], toxically affecting membrane permeabilization and ion homeostasis. In some cases, misfolded proteins and their aggregates can be re-solubilized and re-folded by protein chaperones or degraded by the ubiquitin–proteasome pathway [187]. Scientists are starting to understand the molecular mechanisms underlying the development of misfolding diseases. Mutations affecting the activity of chaperones to prevent protein misfolding, along with the production of harmful proteins and the formation of misfolded protein aggregates, may induce the toxicity associated with these pathological disorders [188,189].
The idea that misfolded proteins can be rescued comes true because several strategies, including chaperone overexpression or using proteasome inhibitors, facilitate the biogenesis and surface expression of these wasteful proteins, indicating that they were viable folding intermediates able to integrate into functional pools [190].

5. Aid for Misfolded Proteins

In 1978, Ronald Laskey and his colleagues were the first to describe a chaperone protein necessary for nucleosome assembly (nucleoplasmin) [191]. Chaperones can be expressed either in different regions or in a tissue-specific manner, and the target proteins binding to chaperones are usually termed clients [192]. Even when the protein structure is determined through the amino acid sequence, chaperones are essential regulators stabilizing protein structure and participating in the folding and assembly processes. Chaperones can bind to nascent or unfolded proteins to stabilize their structure and prevent the formation of aggregates within the cell [193,194,195]. To date, different kinds of proteins and small molecules that can be used physiologically to facilitate protein folding and assembly have been identified. Chaperones are formally classified as molecular, chemical, and pharmacological chaperones according to their origin [196,197].

5.1. Molecular Chaperones Associated with Plasma Membrane Protein Biogenesis

Molecular chaperones are a family of proteins that can recognize conflicts among paired-contact interactions in proteins, where the implicated amino acids cannot reach a minimal free energy state while folding (i.e., a frustrated structural state) [198]. Most of these chaperones were discovered as proteins expressed in response to temperature changes or environmental stresses and were named heat shock proteins (Hsp) [199].
Chaperones can work as holdases (holding a partial folding state of a protein), foldases (assisting protein folding in an ATP-dependent manner), or unfoldases (unfolding transiently unfolded intermediates to allow protein refolding) [200,201]. The mechanism by which chaperones recognize and assist their client proteins is still not clear as most chaperones are promiscuous molecules. Although some interactions can be regulated in an ATP-dependent manner, others cannot, suggesting that the molecular mechanism of chaperones may not be unique.
Studies have demonstrated the interaction of chaperones with polypeptides during folding—through hydrophobic amino acid residues—to avoid aggregate formation and stabilize the structure [202,203]; however, the way chaperones interact with native folded proteins is not clear. A computational high-throughput analysis of the Hsp90 client (an ATP-dependent chaperone) failed to identify a consensus motif allowing interaction [204]. Recently, researchers solved the interaction of bacterial chaperones (e.g., ATP-independent holdases Spy, SurA, and Skp, and the ATP-dependent chaperone GroEL) with clients, demonstrating that chaperone–client interaction occurs regardless of sequence motif or local structure, but binding happens locally through an entropy-based mechanism when a protein surface is frustrated [205,206] and unable to achieve a minimum energy structural state [207,208]. Researchers have suggested several transient local interactions with some segments of the client during folding to reach a minimally frustrated conformation [198].
Hsp function is crucial because these proteins promote cell stability under stress or pathological conditions. Cells would suffer irreversible damage or even cell death without Hsps [209]. Twenty different protein families exhibit chaperone activity. These proteins are classified by their molecular weight and offer different alternatives for correct folding. To date, just a few molecular chaperones have been associated with PM biogenesis.

5.1.1. Hsp70

Binding immunoglobulin protein (BiP), a member of the heat shock protein 70 (Hsp70) family, has been found in the ER lumen, where it plays a role in the recognition of misfolded MPs. Hsp70 folding is assisted by other chaperones such as Hsp90 and Hsp40, DNAJA1, and DNAJB1. Hsp70 unfolds proteins through ATP hydrolysis, inducing the cyclic binding and releasing of hydrophobic amino acids [210,211].
The balance between ER export and retention mediated through Hsp70–Hsp90 cytosolic chaperone systems [189,212] has been evident in the trafficking of mutant ion channels with impaired traffic, such as voltage-gated delayed rectifier potassium channel, hERG (human ether-a-go-go-related gene), which is related to congenital long QT syndrome type 2 (LQT2) [213], and cystic fibrosis transmembrane conductance regulator (CFTR), a chloride channel that plays an important role in the maintenance of ion balance. CFTR favors epithelial surface hydration prominently in the lung airways and pancreas, and its dysfunction is implicated in cystic fibrosis [189,214].
In vitro co-expression of Hsp70 or Hsc70 (heat shock cognate protein, a constitutively expressed member of the Hsp70 family) with mutant hERG or voltage-sensitive potassium channel Kv1.5 prolonged the channel lifetime and increased functionality at the cell surface, decreasing its ubiquitination [215]. However, overexpression of Hsp70 with the co-chaperone DNAJB1 or Hsp73 only induced modest traffic and stabilization improvement of the deletion of phenylalanine at position 508) in the CFTR channel (ΔF508-CFTR) [216,217]. Additionally, Hsc70 and one of its co-chaperones, DNAJA1, are more associated with ΔF508-CFTR than with CFTR wild-type, suggesting that chaperones engage in a mutant channel trying to refold it [218]. Mixed tetrameric channels integrated by acid-sensing ion channel subunits (ASIC1 or ASIC2) together with subunits forming an epithelial sodium channel (ENaCα or ENaCγ) are thought to form the active ASIC channels at the glioma cell surface [219,220]. Hsc70 was found to associate with ASIC2 in glioma cells [221]. Knocking down this chaperone reduced the channel activity but increased the cell surface expression and inhibited glioma cell migration [219].
Thus, these chaperones promote protein damage recovery and improve cell viability. From another functional perspective, overexpression of Hsp70 also suppresses phenotypes related to protein aggregation in models of Alzheimer’s disease [222] and Parkinson’s disease [223,224,225].

5.1.2. Hsp90

The family of Hsp90 chaperones comprises critically conserved proteins that are major molecular chaperones within eukaryotic cells. Hsp90 proteins are important for cellular stabilization processes involving signal transduction, cellular trafficking, chromatin remodeling, cell growth, differentiation, and reproduction [226,227,228,229,230]. Hsp90 interacts with specific proteins through an ATP-dependent cycle, guaranteeing folding, transport, and/or assembly of the client into multiprotein complexes [231,232]. In addition to assisting in the folding of nascent proteins, Hsp90 chaperones promote protein refolding and aberrant protein degradation, possibly indicating that Hsp90 proteins can adapt their conformation to match every client or that they recognize different clients in different conformations [233,234,235,236].
Hsp90 client proteins include transcription factors (e.g., HIF1α, ATF3, and p53), steroid hormone receptors (e.g., estrogen, glucocorticoid, and progesterone receptors), and kinases (e.g., EGFR, B-raf, and SRC), among other proteins. Many of these client proteins are commonly overexpressed and/or frequently mutated in cancer cells [237,238,239].
Early studies identified Hsp90 in complexes with hERG or CFTR channels. Hsp90 inhibition impaired hERG trafficking, but the effect on CFTR remains unknown [240].
Hsp90β overexpression restored PM expression of the mutated voltage-gated potassium channel (KCNQ4) related to autosomal dominant deafness type 2A and increased the activity of the WT channel, but not the activity of WT and mutant (W276S) mixed channels, suggesting that chaperone affinity is affected due to the mutation [241].
Since Hsp90 regulates the stability of oncoproteins important in tumor development and progression, in addition to controlling other pathological oligomeric aggregates causing neurodegenerative diseases, Hsp90 inhibitors have been suggested as a potential therapy for misfolding-related diseases [242,243].
Under proteotoxic stress conditions, or when cellular protein degradation is overwhelmed, misfolded MPs can become stuck and intracellularly form aggresomes [244], which should be eventually cleared through autophagy over kinetically controlled chaperone-assisted folding and degradation systems [244,245], including a group of molecular chaperones working together with other molecules with chaperone activity (e.g., calnexin and a protein disulfide isomerase that catalyzes the formation of disulfide bonds, allowing proteins to fold) [246,247,248,249].
How misassembled transmembrane domains are recognized is not clearly understood. However, because protein maturation is a complex procedure, it is expected that a recently proposed conformational frustration state recognized by chaperones [198,207,208] may consider intrinsic structural properties of the misfolded proteins [89,250]; for instance, single amino acid mutations within protein domains could potentially disrupt native helical packing interactions inducing solvation of TM segments that are naturally hydrophobic [251,252], thus prompting the formation of different protein contacts or interactions affecting their structure.
BiP activity was experimentally evidenced for two proteins needing a β subunit to stabilize their membrane location: the Na+/K+ ATPase [251,253,254] and the single-pass TM α subunit of the αβ T-cell receptor (αβTCR) [255]. For both proteins, the lack of a β subunit left some residues of the α subunit out of the membrane, thus favoring protein interaction with BiP—targeting proteins for degradation—and reducing the probability of exporting immature proteins.

5.1.3. Co-Chaperones Cooperating in Membrane Protein Folding

Cooperation between molecular chaperones to control protein synthesis and degradation is crucial for cell maintenance. The physiological role of chaperones is evident because proteins are not always able to attain their correct conformation spontaneously, and some factors, such as age, disease, or cellular stress, may also influence protein folding, thus affecting the balance of protein ‘‘rescue’’ or protein degradation. Many co-chaperones have been reported to regulate chaperone activity related to degradation. Particularly, a highly conserved cytoplasmic protein called CHIP (carboxyl terminus of Hsc70 interacting protein) was identified during protein screening, in addition to the tetratricopeptide repeat (TPR) [256], a very conserved domain in several co-chaperones. TRP allows CHIP interaction with Hsp70, Hsc70, or Hsp90 to induce client substrate ubiquitylation and proteasome degradation because CHIP works as a ubiquitin ligase [257].
Some studies showed that CHIP-dependent polyubiquitination serves as a sorting signal for internalization and lysosomal degradation of the MP, including mutants from dopamine receptor D4.4, vasopressin V2 receptor (V2R), CFTR and G-protein coupled receptors (GPCRs) [258]. Later on, a supportive study showed that in vitro co-expression of CHIP with voltage-gated potassium channel Kv1.5 increased channel ubiquitination and decreased the protein level, while CHIP suppression increased channel expression [259].
Many mutations in genes encoding structural proteins may not influence protein functionality but may still cause some diseases by either arresting mutant proteins intracellularly or preventing the cellular trafficking machinery from transporting the mutant protein to an appropriate subcellular location to avoid protein misfolding and aggregate formation in the first step of the pathological cascade. Considering that chaperones are essential to many physiological processes by preventing protein misfolding and aggregation, several strategies based on their buffering capacity are rapidly emerging as promising treatments for misfolding-related diseases [196,197].
The ability to restore the biosynthesis of misfolded proteins has been demonstrated through different strategies. For instance, ΔF508-CFTR channel is a classic example of a mutation causing a misfolding disease. Nevertheless, crystal structures and biophysical studies comparing WT and mutant CFTR domains suggest only local structural changes due to the amino acidic deletion [260,261]. Several studies have demonstrated that F508 deletion induces ER retention, proteolytic degradation, and absent Cl- conductance. The ability of CFTR to traffic to the PM at 37 and <30 °C was evaluated, and the lower temperature was found to favor PM localization and function [262]. Many other chaperones have been evaluated as potent modulators of several misfolding diseases.

5.2. Chemical Chaperones

Some small organic molecules helping to maintain proper proteostasis in stressful environments are considered chemical chaperones because they enhance the folding and/or stability of proteins. These molecules can be present in a diverse range of organisms or tissues under denaturing conditions [263] and are potentially helpful in treating conformational diseases. Nonspecific interactions with unrelated proteins make them not specific for a therapeutic target. Some examples of these compounds are polyols, such as glycerol, dimethyl sulfoxide (DMSO), trimethylamine (trimethylamine N-oxide [TMAO]) and amino acid derivatives, 4-phenylbutyric acid (4PBA), membrane-permeable forms of promiscuous enzyme antagonists, ligands, and substrates. Thus far, the mechanism by which chemical chaperones modulate folding energy landscapes is not clearly understood [264], but these chaperones stabilize misfolded proteins, thus decreasing the formation of protein aggregates, preventing unnecessary interactions with other proteins and altering the activity of other chaperones such that proteins are transported to their final destination with increased efficiency. Chemical chaperones of the polyol TMAO and 4PBA groups act on multiple proteins, whereas antagonists, ligands, and substrates affect specific proteins (and are commonly called pharmacological chaperones) [265].
Chemical chaperones can be classified into two groups: osmolytes and hydrophobic compounds. Even when they lack specificity, these molecules usually have an effect only at high concentrations and are thus frequently rejected as therapeutic agents even when they rescue the misfolded protein state in vitro [190,261]. De novo design of chemical chaperones with increased activity and specificity is desirable to ameliorate protein misfolding and aggregation in different contexts.
Osmolytes: The group of osmolyte chaperones comprises low molecular weight compounds, including free amino acids and amino acid derivatives (glycine, taurine, and β-alanine). Other osmolyte compounds are polyols, such as glycerol and sucrose, and methylamines, particularly TMAO. Osmolyte chaperones are crucial for organisms exposed to stressful conditions such as fluctuating salinity, desiccation, or extreme temperatures [266]. These types of chaperones increase protein stability without disrupting protein function. Polyols protect cells against extreme conditions such as increased temperature or dehydration. Amino acids preserve proteins in high-salinity environments, and methylamines protect cells against the denaturing effect of urea [266,267].
Although osmolyte chaperones have effects on different kinds of proteins and under diverse conditions, they share the function of stabilizing protein structure by modifying the solvent properties. Osmolyte chaperone solvation decreases water activity around each polypeptide, forcing partially exposed hydrophobic patches to reach the most stable conformation and facilitate protein folding [268,269,270].
Several studies have shown that small organic compounds which stabilize PM protein [98] can rescue protein folding defects by increasing traffic and function at the PM for selective mutants on the cystic fibrosis-related CFTR chloride channel [98,271], aquaporin-2 water channel (AQP2), and V2R associated with nephrogenic diabetes insipidus (NDI) [272,273]. Some of the mutants in these studies were also tested with either TMAO, DMSO, or glycerol, showing different rescuing effects. TMAO showed a lower ability to rescue MPs, which may be due to an enhanced hydration potential that affects the reagent permeability on lipidic membranes or the stability of hydrophobic regions on the MP [274,275].
Hydrophobic compounds: Several molecules have been classified as hydrophobic chaperones, including (4PBA) and bile acids (e.g., oxysterol, an oxygenated isoform of cholesterol).
4PBA is capable of restoring the cell surface expression of mislocated mutants on bile salt export pump (BSEP), which is related to an inherited autosomal recessive liver disease called progressive familial intrahepatic cholestasis type 2 (PFIC2) that leads to cirrhosis and death before adulthood [276]. In a recent study testing a multidrug regimen of 4PBA mixed with anticonvulsants oxcarbazepine and maralixibat, PFIC2 symptoms were controlled in two siblings with partial loss of BSEP activity [277]. 4PBA has also been tested with the mutant channel Δ508-CFTR-inducing cell surface expression [278], and some clinical trials using this chemical chaperone in cystic fibrosis patients have demonstrated an improvement in CFTR function in the nasal epithelia [279].
For cyclic nucleotide-gated channels related to retinopathies, reduced degradation and/or promoted PM localization of defective subunits was shown using chemical chaperones such as 4PBA or the bile acid component tauroursodeoxycholic acid (TUDCA) [280].
The general mechanism of action proposed for hydrophobic chaperones is based on the interaction between the chaperone’s hydrophobic regions and the exposed hydrophobic segments of the unfolded protein. However, even though 4PBA and bile acids can reduce aggregate accumulation in vivo and in vitro and revert ER stress, these molecules may be more complex in the action mechanism influencing different levels of regulation [196].

5.3. Pharmacological Chaperones

Pharmacological chaperones, also known as pharmacoperones, are lipophilic compounds stabilizing protein conformation to prevent degradation and promote proper trafficking to their functional site of action in the cell. These molecules represent one of the most promising therapeutic strategies to treat misfolding-related diseases [281]. Unlike chemical chaperones, these low molecular weight compounds bind selectively to proteins, stabilizing the protein structure and restoring protein localization and function. Enzymes, agonists, antagonists, and some synthetic compounds are examples of pharmacoperones [282].
Antagonists used as chaperones should ideally provide an effective rescue response at the lowest concentration, without losing the ability to dissociate from the rescued protein to facilitate the endogenous ligand binding [283]. Antagonists are highly efficacious in rescuing mislocated mutant proteins by preventing agonist or substrate access [284,285,286]; however, antagonists of high affinity for receptors and ion channels may yield nonfunctional channels expressed at the PM, as was shown for the rescued ATP-sensitive potassium channels (KATP) treated with sulfonylureas [287].
Agonist molecules were identified as pharmacoperones when SR49059, a small, cell-permeable molecule formerly developed as a vasopressin antagonist, was able to rescue the function of ER-retained V2 vasopressin receptor (V2R) mutants [288,289]. The experiments clearly showed significantly improved kidney function in NDI patients [289]. Rhodopsin-like G-protein-coupled MC4R (melanocortin 4 receptor), which causes severe early-onset morbid obesity in humans, exemplifies misfolded and intracellularly retained proteins rescued using antagonists [290].
Channel blockers also represent an alternative to modulate protein folding and trafficking; cisapride, E-4031, and the non-specific antiarrhythmic drug quinidine have experimentally rescued mutant hERG leading to LQT2. However, using channel blocker as a pharmacological strategy is still controversial as blocking ion flow can affect K+ flux and cell homeostasis, leading to a prolonged QT interval and increased risk of developing arrhythmia [291,292,293].
The dissociation rate is not essential for using an agonist as a chaperone [294,295]. Mislocation of mutant MPs has been rescued using agonists. Defective trafficking of misfolded mutant CNG channels has been successfully rescued using a cell-permeable cyclic nucleotide agonist [280]. High-affinity non-peptide agonists were able to selectively rescue PM expression and function of misfolded arginine-vasopressin receptor 2 (AVPR2) mutants associated with NDI [296]. Some mutants in the calcium-sensing receptor (CaSR) leading to familial hypocalciuric hypercalcemia and neonatal hyperparathyroidism can also be rescued using membrane-permeant allosteric agonists to recover protein functionality [190,295].
In addition to functioning as cell proteostasis modulators modifying the cell proteome and increasing MP maturation, pharmacological chaperones can also act as correctors and potentiators. In fact, for the CFTR mutant channel, it has been tested that some compounds, such as corr-4a and VRT-532, interact directly with the misfolded protein to correct the biosynthetic pathway and enhance trafficking and channel function [297]. VX-809 (Lumacaftor) is a corrector tested by itself or in combination with other molecules [298] in patients with cystic fibrosis and is a potential treatment for other pathologies associated with misfolding and misrouted proteins, as has been proved to Stargardt disease, which invariably ends in legal blindness (visual acuity of 20/200 or less [299]) [298]. Among other correctors or pharmacoperones, Lumacaftor represents hope to set up therapeutic strategies for misfolding diseases [300,301].
Assistance to stabilize protein folding can be analyzed in vivo or in vitro, as proteins can naturally interact with many compounds intracellularly. Proteins can be assisted by chemical chaperones, which helps scientists to better understand how proteins are properly folded in vitro and thus find more suitable and specific compounds (or pharmacological chaperones) to develop a therapeutic strategy for misfolding diseases.
Table 2 summarizes the misfolded PM proteins related to pathologies and the therapeutic approaches used; molecular, chemical, and pharmacological chaperones are widely regarded as a promising therapeutic strategy for these pathologies.

6. Conclusions

MP localization is critical for normal cell physiology. The correct routing of proteins is as important as the genetic machinery for protein expression. Protein trafficking, moreover, is not a simple or unidirectional process. Naturally, trafficking assistance from the ER to the plasma membrane involves many proteins and factors as protein carriers or chaperones of molecular cargo, and, as a response to misfolding, chaperones may also mask harmful modifications in the folding energy landscape. However, when protein folding proceeds incorrectly, many diseases can arise; a wide range of diseases result when protein misfolding induces intracellular retention of MPs. Misassembled proteins that reach the membrane can also lead to disease due to dysfunctionality.
Currently, specific therapies for conformational diseases are lacking because of a gap in the understanding of the mechanisms by which the natural conformation of proteins is altered into many misfolded pathological forms. However, encouragingly, an extensive and concerted effort is already underway to combat misfolding diseases. The discovery of compounds with therapeutic chaperone ability is customarily initiated through high-throughput screening of libraries, including natural or synthesized compounds, searching for stabilizing binders using in silico, in vitro, in vivo, or cell-based approaches. As we continue increasing knowledge of disease mechanisms, we also continue to discover molecules that could interact with PM proteins, mimicking the effect of natural chaperones that correct misfolding.

Author Contributions

K.J.-N. and A.L.-R. conceptualized the idea and wrote the original draf; V.M.A.-G., E.R.-B., I.M.-M., J.L.R.-B. made substantial contributions to conception, design, and/or acquisition of data; A.L.-R. prepared the figures. Funding acquisition by A.L.-R. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by UJED-CONACYT-CB-2015-01-259091. K.J.-N., and J.L.R.-B., were supported by CONACYT 637362 and 638336, respectively.

Acknowledgments

The authors would like to thank the support of UJED-CONACYT-CB-2015-01-259091. K.J.-N. and J.L.R.-B. were supported by CONACYT 637362 and 638336, respectively. We give special thanks to Ataulfo Martínez-Torres, Jessica, G.; Norris, Hugo, R. Masse-Torres, and Valeria Amaya-Galnarez for reading and commenting on this manuscript and to the members of the NFMyC lab, Adriana, R., Angeles, A., Sofía, N., and Yuvia, C., for contributing with comments, data, and discussions.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Muro, E.; Atilla-Gokcumen, G.E.; Eggert, U.S. Lipids in cell biology: How can we understand them better? Mol. Biol. Cell 2014, 25, 1819–1823. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  2. O’Brien, J.S. Cell membranes—Composition: Structure: Function. J. Theor. Biol. 1967, 15, 307–324. [Google Scholar] [CrossRef] [Scilit]
  3. Engelman, D.M. Membranes are more mosaic than fluid. Nature 2005, 438, 578–580. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  4. Deisenhofer, J.; Epp, O.; Miki, K.; Huber, R.; Michel, H. Structure of the protein subunits in the photosynthetic reaction centre of Rhodopseudomonas viridis at 3Å resolution. Nature 1985, 318, 618–624. [Google Scholar] [CrossRef] [Scilit]
  5. Block, R.C.; Dorsey, E.R.; Beck, C.A.; Brenna, J.T.; Shoulson, I. Altered cholesterol and fatty acid metabolism in Huntington disease. J. Clin. Lipidol. 2010, 4, 17–23. [Google Scholar] [CrossRef] [Scilit]
  6. Di Paolo, G.; Kim, T.-W. Linking lipids to Alzheimer’s disease: Cholesterol and beyond. Nat. Rev. Neurosci. 2011, 12, 284–296. [Google Scholar] [CrossRef] [Scilit]
  7. Lee, S.; Zheng, H.; Shi, L.; Jiang, Q.-X. Reconstitution of a Kv channel into lipid membranes for structural and functional studies. J. Vis. Exp. 2013, e50436. [Google Scholar] [CrossRef] [Scilit]
  8. Jiang, Q.-X. Cholesterol-dependent gating effects on ion channels. Adv. Exp. Med. Biol. 2019, 1115, 167–190. [Google Scholar] [CrossRef] [Scilit]
  9. Finol-Urdaneta, R.K.; McArthur, J.R.; Juranka, P.F.; French, R.J.; Morris, C.E. Modulation of KvAP unitary conductance and gating by 1-alkanols and other surface active agents. Biophys. J. 2010, 98, 762–772. [Google Scholar] [CrossRef] [Scilit]
  10. Balijepalli, R.C.; Delisle, B.P.; Balijepalli, S.Y.; Foell, J.D.; Slind, J.K.; Kamp, T.J.; January, C.T. Kv11.1 (ERG1) K+ channels localize in cholesterol and sphingolipid enriched membranes and are modulated by membrane cholesterol. Channels 2007, 1, 263–272. [Google Scholar] [CrossRef] [Scilit]
  11. Abi-Char, J.; Maguy, A.; Coulombe, A.; Balse, E.; Ratajczak, P.; Samuel, J.-L.; Nattel, S.; Hatem, S.N. Membrane cholesterol modulates Kv1.5 potassium channel distribution and function in rat cardiomyocytes. J. Physiol. 2007, 582, 1205–1217. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  12. Poveda, J.A.; Giudici, A.M.; Renart, M.L.; Millet, O.; Morales, A.; González-Ros, J.M.; Oakes, V.; Furini, S.; Domene, C. Modulation of the potassium channel KcsA by anionic phospholipids: Role of arginines at the non-annular lipid binding sites. Biochim. Biophys. Acta Biomembr. 2019, 1861, 183029. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  13. Milescu, M.; Vobecky, J.; Roh, S.H.; Kim, S.H.; Jung, H.J.; Kim, J., II; Swartz, K.J. Tarantula toxins interact with voltage sensors within lipid membranes. J. Gen. Physiol. 2007, 130, 497–511. [Google Scholar] [CrossRef] [Scilit]
  14. Kim, R.Y.; Pless, S.A.; Kurata, H.T. PIP2 mediates functional coupling and pharmacology of neuronal KCNQ channels. Proc. Natl. Acad. Sci. USA 2017, 114, E9702–E9711. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  15. Delgado-Ramírez, M.; López-Izquierdo, A.; Rodríguez-Menchaca, A.A. Dual regulation of hEAG1 channels by phosphatidylinositol 4,5-bisphosphate. Biochem. Biophys. Res. Commun. 2018, 503, 2531–2535. [Google Scholar] [CrossRef] [Scilit]
  16. Bissig, C.; Gruenberg, J. Lipid sorting and multivesicular endosome biogenesis. Cold Spring Harb. Perspect. Biol. 2013, 5, a016816. [Google Scholar] [CrossRef] [Scilit]
  17. Huang, C.-L. Complex roles of PIP2 in the regulation of ion channels and transporters. Am. J. Physiol. Renal Physiol. 2007, 293, F1761–F1765. [Google Scholar] [CrossRef] [Scilit]
  18. Thapa, N.; Sun, Y.; Schramp, M.; Choi, S.; Ling, K.; Anderson, R.A. Phosphoinositide signaling regulates the exocyst complex and polarized integrin trafficking in directionally migrating cells. Dev. Cell 2012, 22, 116–130. [Google Scholar] [CrossRef] [Scilit]
  19. Hernández-Araiza, I.; Morales-Lázaro, S.L.; Canul-Sánchez, J.A.; Islas, L.D.; Rosenbaum, T. Role of lysophosphatidic acid in ion channel function and disease. J. Neurophysiol. 2018, 120, 1198–1211. [Google Scholar] [CrossRef] [Scilit]
  20. Bukiya, A.N.; Dopico, A.M. Regulation of BK Channel activity by cholesterol and its derivatives. Adv. Exp. Med. Biol. 2019, 1115, 53–75. [Google Scholar] [CrossRef] [Scilit]
  21. Stevens, T.J.; Arkin, I.T. Do more complex organisms have a greater proportion of membrane proteins in their genomes? Proteins 2000, 39, 417–420. [Google Scholar] [CrossRef] [Scilit]
  22. von Heijne, G.; Gavel, Y. Topogenic signals in integral membrane proteins. Eur. J. Biochem. 1988, 174, 671–678. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Haynes, C.M.; Petrova, K.; Benedetti, C.; Yang, Y.; Ron, D. ClpP Mediates activation of a mitochondrial unfolded protein response in C. elegans. Dev. Cell 2007, 13, 467–480. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Ron, D.; Walter, P. Signal integration in the endoplasmic reticulum unfolded protein response. Nat. Rev. Mol. Cell Biol. 2007, 8, 519–529. [Google Scholar] [CrossRef] [Scilit]
  25. Sardiello, M.; Palmieri, M.; di Ronza, A.; Medina, D.L.; Valenza, M.; Gennarino, V.A.; Di Malta, C.; Donaudy, F.; Embrione, V.; Polishchuk, R.S.; et al. A gene network regulating lysosomal biogenesis and function. Science 2009, 325, 473–477. [Google Scholar] [CrossRef] [Scilit]
  26. Johnson, A.E.; van Waes, M.A. The Translocon: A Dynamic gateway at the ER membrane. Annu. Rev. Cell Dev. Biol. 1999, 15, 799–842. [Google Scholar] [CrossRef] [Scilit]
  27. Stefani, M.; Rigacci, S. Protein folding and aggregation into amyloid: The interference by natural phenolic compounds. Int. J. Mol. Sci. 2013, 14, 12411–12457. [Google Scholar] [CrossRef] [Scilit]
  28. Singer, S.J. The Structure and insertion of integral proteins in membranes. Annu. Rev. Cell Biol. 1990, 6, 247–296. [Google Scholar] [CrossRef]
  29. Sabatini, D.D.; Kreibich, G.; Morimoto, T.; Adesnik, M. Mechanisms for the incorporation of proteins in membranes and organelles. J. Cell Biol. 1982, 92, 1–22. [Google Scholar] [CrossRef] [Scilit]
  30. Blobel, G. Protein Targeting (Nobel Lecture). ChemBioChem 2000, 1, 86–102. [Google Scholar] [CrossRef]
  31. Peer, W.A. Plasma Membrane Protein Trafficking BT—The Plant Plasma Membrane; Murphy, A.S., Schulz, B., Peer, W., Eds.; Springer: Berlin/Heidelberg, Germany, 2011; pp. 31–56. ISBN 978-3-642-13431-9. [Google Scholar]
  32. Morozova, D.; Guigas, G.; Weiss, M. Dynamic structure formation of peripheral membrane proteins. PLoS Comput. Biol. 2011, 7, e1002067. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Hayer, A.; Stoeber, M.; Bissig, C.; Helenius, A. Biogenesis of caveolae: Stepwise assembly of large caveolin and cavin complexes. Traffic 2010, 11, 361–382. [Google Scholar] [CrossRef] [Scilit]
  34. Monier, S.; Dietzen, D.J.; Hastings, W.R.; Lublin, D.M.; Kurzchalia, T. V Oligomerization of VIP21-caveolin in vitro is stabilized by long chain fatty acylation or cholesterol. FEBS Lett. 1996, 388, 143–149. [Google Scholar] [CrossRef] [Scilit]
  35. Busija, A.R.; Patel, H.H.; Insel, P.A. Caveolins and cavins in the trafficking, maturation, and degradation of caveolae: Implications for cell physiology. Am. J. Physiol. Cell Physiol. 2017, 312, C459–C477. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Pestova, T.V.; Kolupaeva, V.G.; Lomakin, I.B.; Pilipenko, E.V.; Shatsky, I.N.; Agol, V.I.; Hellen, C.U. Molecular mechanisms of translation initiation in eukaryotes. Proc. Natl. Acad. Sci. USA 2001, 98, 7029–7036. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Hegde, R.S.; Keenan, R.J. Tail-anchored membrane protein insertion into the endoplasmic reticulum. Nat. Rev. Mol. Cell Biol. 2011, 12, 787–798. [Google Scholar] [CrossRef] [Scilit]
  38. Kapp, K.; Schrempf, S.; Lemberg, M.; Dobberstein, B. Post-targeting functions of signal peptides. In Protein Transport into the Endoplasmic Reticulum; Landes Bioscience: Austin, TX, USA, 2000. [Google Scholar]
  39. Liu, X.; Zheng, X.F.S. Endoplasmic reticulum and golgi localization sequences for mammalian target of rapamycin. Mol. Biol. Cell 2007, 18, 1073–1082. [Google Scholar] [CrossRef] [Scilit]
  40. Frangioni, J.V.; Beahm, P.H.; Shifrin, V.; Jost, C.A.; Neel, B.G. The nontransmembrane tyrosine phosphatase PTP-1B localizes to the endoplasmic reticulum via its 35 amino acid C-terminal sequence. Cell 1992, 68, 545–560. [Google Scholar] [CrossRef] [Scilit]
  41. Pottekat, A.; Menon, A.K. Subcellular localization and targeting of N-acetylglucosaminyl phosphatidylinositol de-N-acetylase, the second enzyme in the glycosylphosphatidylinositol biosynthetic pathway. J. Biol. Chem. 2004, 279, 15743–15751. [Google Scholar] [CrossRef] [Scilit]
  42. Ercan, E.; Momburg, F.; Engel, U.; Temmerman, K.; Nickel, W.; Seedorf, M. A conserved, lipid-mediated sorting mechanism of yeast Ist2 and mammalian STIM proteins to the peripheral ER. Traffic 2009, 10, 1802–1818. [Google Scholar] [CrossRef] [Scilit]
  43. Sun, Q.; Ju, T.; Cummings, R.D. The transmembrane domain of the molecular chaperone Cosmc directs its localization to the endoplasmic reticulum. J. Biol. Chem. 2011, 286, 11529–11542. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Haugsten, E.M.; Malecki, J.; Bjørklund, S.M.S.; Olsnes, S.; Wesche, J. Ubiquitination of fibroblast growth factor receptor 1 is required for its intracellular sorting but not for its endocytosis. Mol. Biol. Cell 2008, 19, 3390–3403. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. Watanabe, K.; Nagaoka, T.; Strizzi, L.; Mancino, M.; Gonzales, M.; Bianco, C.; Salomon, D.S. Characterization of the glycosylphosphatidylinositol-anchor signal sequence of human Cryptic with a hydrophilic extension. Biochim. Biophys. Acta 2008, 1778, 2671–2681. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Lanza, F.; De La Salle, C.; Baas, M.-J.; Schwartz, A.; Boval, B.; Cazenave, J.-P.; Caen, J.P. A Leu7Pro mutation in the signal peptide of platelet glycoprotein (GP)IX in a case of Bernard-Soulier syndrome abolishes surface expression of the GPIb-V-IX complex. Br. J. Haematol. 2002, 118, 260–266. [Google Scholar] [CrossRef] [Scilit]
  47. Luo, W.; Marsh-Armstrong, N.; Rattner, A.; Nathans, J. An outer segment localization signal at the C terminus of the photoreceptor-specific retinol dehydrogenase. J. Neurosci. 2004, 24, 2623–2632. [Google Scholar] [CrossRef] [Scilit]
  48. Klapisz, E.; Ziari, M.; Wendum, D.; Koumanov, K.; Brachet-Ducos, C.; Olivier, J.L.; Béréziat, G.; Trugnan, G.; Masliah, J. N-terminal and C-terminal plasma membrane anchoring modulate differently agonist-induced activation of cytosolic phospholipase A2. Eur. J. Biochem. 1999, 265, 957–966. [Google Scholar] [CrossRef] [Scilit]
  49. Zlatkine, P.; Mehul, B.; Magee, A.I. Retargeting of cytosolic proteins to the plasma membrane by the Lck protein tyrosine kinase dual acylation motif. J. Cell Sci. 1997, 110 Pt 5, 673–679. [Google Scholar]
  50. Beau, I.; Groyer-Picard, M.-T.; Desroches, A.; Condamine, E.; Leprince, J.; Tomé, J.-P.; Dessen, P.; Vaudry, H.; Misrahi, M. The basolateral sorting signals of the thyrotropin and luteinizing hormone receptors: An unusual family of signals sharing an unusual distal intracellular localization, but unrelated in their structures. Mol. Endocrinol. 2004, 18, 733–746. [Google Scholar] [CrossRef] [Scilit]
  51. Nadler, L.S.; Kumar, G.; Nathanson, N.M. Identification of a basolateral sorting signal for the M3 muscarinic acetylcholine receptor in Madin-Darby canine kidney cells. J. Biol. Chem. 2001, 276, 10539–10547. [Google Scholar] [CrossRef] [Scilit]
  52. Iverson, H.A.; Fox, D., 3rd; Nadler, L.S.; Klevit, R.E.; Nathanson, N.M. Identification and structural determination of the M(3) muscarinic acetylcholine receptor basolateral sorting signal. J. Biol. Chem. 2005, 280, 24568–24575. [Google Scholar] [CrossRef] [Scilit]
  53. King, B.R.; Guda, C. ngLOC: An n-gram-based Bayesian method for estimating the subcellular proteomes of eukaryotes. Genome Biol. 2007, 8, R68. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Blobel, G. Intracellular protein topogenesis. Proc. Natl. Acad. Sci. USA 1980, 77, 1496–1500. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  55. Balogh, I.; Maráz, A. Presence of STA gene sequences in brewer’s yeast genome. Lett. Appl. Microbiol. 2018, 22, 400–404. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  56. Lamriben, L.; Graham, J.B.; Adams, B.M.; Hebert, D.N. N-Glycan-based ER molecular chaperone and protein quality control system: The calnexin binding cycle. Traffic 2016, 17, 308–326. [Google Scholar] [CrossRef] [Scilit]
  57. Saraogi, I.; Shan, S. Molecular mechanism of co-translational protein targeting by the signal recognition particle. Traffic 2011, 12, 535–542. [Google Scholar] [CrossRef] [Scilit]
  58. Reindl, M.; Hänsch, S.; Weidtkamp-Peters, S.; Schipper, K. A Potential lock-type mechanism for unconventional secretion in fungi. Int. J. Mol. Sci. 2019, 20, 460. [Google Scholar] [CrossRef] [Scilit]
  59. Chartron, J.W.; Gonzalez, G.M.; Clemons Jr, W.M. A structural model of the Sgt2 protein and its interactions with chaperones and the Get4/Get5 complex. J. Biol. Chem. 2011, 286, 34325–34334. [Google Scholar] [CrossRef] [Scilit]
  60. Grudnik, P.; Bange, G.; Sinning, I. Protein targeting by the signal recognition particle. Biol. Chem. 2009, 390, 775–782. [Google Scholar] [CrossRef] [Scilit]
  61. Keenan, R.J.; Freymann, D.M.; Stroud, R.M.; Walter, P. The signal recognition particle. Annu. Rev. Biochem. 2001, 70, 755–775. [Google Scholar] [CrossRef] [Scilit]
  62. Borgese, N.; Colombo, S.; Pedrazzini, E. The tale of tail-anchored proteins: Coming from the cytosol and looking for a membrane. J. Cell Biol. 2003, 161, 1013–1019. [Google Scholar] [CrossRef] [Scilit]
  63. Hartl, F.U.; Hayer-Hartl, M. Converging concepts of protein folding in vitro and in vivo. Nat. Struct. Mol. Biol. 2009, 16, 574. [Google Scholar] [CrossRef] [Scilit]
  64. Marzec, M.; Eletto, D.; Argon, Y. GRP94: An HSP90-like protein specialized for protein folding and quality control in the endoplasmic reticulum. Biochim. Biophys. Acta 2012, 1823, 774–787. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  65. Tannous, A.; Pisoni, G.B.; Hebert, D.N.; Molinari, M. N-linked sugar-regulated protein folding and quality control in the ER. Semin. Cell Dev. Biol. 2015, 41, 79–89. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  66. Simons, J.F.; Ferro-Novick, S.; Rose, M.D.; Helenius, A. BiP/Kar2p serves as a molecular chaperone during carboxypeptidase Y folding in yeast. J. Cell Biol. 1995, 130, 41–49. [Google Scholar] [CrossRef] [Scilit]
  67. Hurtley, S.M.; Bole, D.G.; Hoover-Litty, H.; Helenius, A.; Copeland, C.S. Interactions of misfolded influenza virus hemagglutinin with binding protein (BiP). J. Cell Biol. 1989, 108, 2117–2126. [Google Scholar] [CrossRef] [Scilit]
  68. Machamer, C.E.; Doms, R.W.; Bole, D.G.; Helenius, A.; Rose, J.K. Heavy chain binding protein recognizes incompletely disulfide-bonded forms of vesicular stomatitis virus G protein. J. Biol. Chem. 1990, 265, 6879–6883. [Google Scholar]
  69. Marquardt, T.; Helenius, A. Misfolding and aggregation of newly synthesized proteins in the endoplasmic reticulum. J. Cell Biol. 1992, 117, 505–513. [Google Scholar] [CrossRef] [Scilit]
  70. Singh, I.; Doms, R.W.; Wagner, K.R.; Helenius, A. Intracellular transport of soluble and membrane-bound glycoproteins: Folding, assembly and secretion of anchor-free influenza hemagglutinin. EMBO J. 1990, 9, 631–639. [Google Scholar] [CrossRef] [Scilit]
  71. Hammond, C.; Helenius, A. Quality control in the secretory pathway: Retention of a misfolded viral membrane glycoprotein involves cycling between the ER, intermediate compartment, and golgi apparatus. J. Cell Biol. 1994, 126, 41–52. [Google Scholar] [CrossRef] [Scilit]
  72. Pincus, D.; Chevalier, M.W.; Aragón, T.; van Anken, E.; Vidal, S.E.; El-Samad, H.; Walter, P. BiP binding to the ER-stress sensor Ire1 tunes the homeostatic behavior of the unfolded protein response. PLoS Biol. 2010, 8, e1000415. [Google Scholar] [CrossRef] [Scilit]
  73. Schönbrunner, E.R.; Schmid, F.X. Peptidyl-prolyl cis-trans isomerase improves the efficiency of protein disulfide isomerase as a catalyst of protein folding. Proc. Natl. Acad. Sci. USA 1992, 89, 4510–4513. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  74. Cheng, H.N.; Bovey, F.A. Cis-Trans equilibrium and kinetic studies of acetyl-L-proline and glycyl-L-proline. Biopolymers 2018, 16, 1465–1472. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  75. Horibe, T.; Yosho, C.; Okada, S.; Tsukamoto, M.; Nagai, H.; Hagiwara, Y.; Tujimoto, Y.; Kikuchi, M. The chaperone activity of protein disulfide isomerase is affected by cyclophilin B and cyclosporin a In vitro. J. Biochem. 2002, 132, 401–407. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  76. Curran, J.; Mohler, P.J. Alternative paradigms for ion channelopathies: Disorders of ion channel membrane trafficking and posttranslational modification. Annu. Rev. Physiol. 2015, 77, 505–524. [Google Scholar] [CrossRef] [Scilit]
  77. Shao, S.; Hegde, R.S. Membrane protein insertion at the endoplasmic reticulum. Annu. Rev. Cell Dev. Biol. 2011, 27, 25–56. [Google Scholar] [CrossRef] [Scilit]
  78. Berner, N.; Reutter, K.-R.; Wolf, D.H. Protein quality control of the endoplasmic reticulum and ubiquitin-proteasome-triggered degradation of aberrant proteins: Yeast pioneers the path. Annu. Rev. Biochem. 2018, 87, 751–782. [Google Scholar] [CrossRef] [Scilit]
  79. Powers, E.T.; Morimoto, R.I.; Dillin, A.; Kelly, J.W.; Balch, W.E. Biological and chemical approaches to diseases of proteostasis deficiency. Annu. Rev. Biochem. 2009, 78, 959–991. [Google Scholar] [CrossRef] [Scilit]
  80. Labbadia, J.; Morimoto, R.I. The biology of proteostasis in aging and disease. Annu. Rev. Biochem. 2015, 84, 435–464. [Google Scholar] [CrossRef] [Scilit]
  81. Walker, L.C. Proteopathic strains and the heterogeneity of neurodegenerative diseases. Annu. Rev. Genet. 2016, 50, 329–346. [Google Scholar] [CrossRef] [Scilit]
  82. Aguzzi, A.; O’Connor, T. Protein aggregation diseases: Pathogenicity and therapeutic perspectives. Nat. Rev. Drug Discov. 2010, 9, 237. [Google Scholar] [CrossRef] [Scilit]
  83. Stefani, M.; Dobson, C.M. Protein aggregation and aggregate toxicity: New insights into protein folding, misfolding diseases and biological evolution. J. Mol. Med. 2003, 81, 678–699. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  84. Walter, P.; Ron, D. The unfolded protein response: From stress pathway to homeostatic regulation. Science 2011, 334, 1081–1086. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  85. Bravo, R.; Parra, V.; Gatica, D.; Rodriguez, A.E.; Torrealba, N.; Paredes, F.; Wang, Z.V.; Zorzano, A.; Hill, J.A.; Jaimovich, E.; et al. Endoplasmic reticulum and the unfolded protein response: Dynamics and metabolic integration. Int. Rev. Cell Mol. Biol. 2013, 301, 215–290. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  86. Thibault, G.; Ismail, N.; Ng, D.T.W. The unfolded protein response supports cellular robustness as a broad-spectrum compensatory pathway. Proc. Natl. Acad. Sci. USA 2011, 108, 20597–20602. [Google Scholar] [CrossRef] [Scilit]
  87. Kopp, M.C.; Larburu, N.; Durairaj, V.; Adams, C.J.; Ali, M.M.U. UPR proteins IRE1 and PERK switch BiP from chaperone to ER stress sensor. Nat. Struct. Mol. Biol. 2019, 26, 1053–1062. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  88. Nedelsky, N.B.; Todd, P.K.; Taylor, J.P. Autophagy and the ubiquitin-proteasome system: Collaborators in neuroprotection. Biochim. Biophys. Acta 2008, 1782, 691–699. [Google Scholar] [CrossRef] [Scilit]
  89. Smith, M.H.; Ploegh, H.L.; Weissman, J.S. Road to ruin: Targeting proteins for degradation in the endoplasmic reticulum. Science 2011, 334, 1086–1090. [Google Scholar] [CrossRef] [Scilit]
  90. Varshavsky, A. The ubiquitin system, an immense realm. Annu. Rev. Biochem. 2012, 81, 167–176. [Google Scholar] [CrossRef] [Scilit]
  91. Romine, I.C.; Wiseman, R.L. PERK Signaling regulates extracellular proteostasis of an amyloidogenic protein during endoplasmic reticulum stress. Sci. Rep. 2019, 9, 410. [Google Scholar] [CrossRef] [Scilit]
  92. Lu, P.D.; Harding, H.P.; Ron, D. Translation reinitiation at alternative open reading frames regulates gene expression in an integrated stress response. J. Cell Biol. 2004, 167, 27–33. [Google Scholar] [CrossRef] [Scilit]
  93. Walter, F.; O’Brien, A.; Concannon, C.G.; Düssmann, H.; Prehn, J.H.M. ER stress signaling has an activating transcription factor 6α (ATF6)-dependent “off-switch”. J. Biol. Chem. 2018, 293, 18270–18284. [Google Scholar] [CrossRef] [Scilit]
  94. Lee, K.; Tirasophon, W.; Shen, X.; Michalak, M.; Prywes, R.; Okada, T.; Yoshida, H.; Mori, K.; Kaufman, R.J. IRE1-mediated unconventional mRNA splicing and S2P-mediated ATF6 cleavage merge to regulate XBP1 in signaling the unfolded protein response. Genes Dev. 2002, 16, 452–466. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  95. Nishikawa, S.I.; Fewell, S.W.; Kato, Y.; Brodsky, J.L.; Endo, T. Molecular chaperones in the yeast endoplasmic reticulum maintain the solubility of proteins for retrotranslocation and degradation. J. Cell Biol. 2001, 153, 1061–1070. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  96. Elsasser, S.; Finley, D. Delivery of ubiquitinated substrates to protein-unfolding machines. Nat. Cell Biol. 2005, 7, 742–749. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  97. Jakob, C.A.; Burda, P.; Roth, J.; Aebi, M. Degradation of misfolded endoplasmic reticulum glycoproteins in Saccharomyces cerevisiae is determined by a specific oligosaccharide structure. J. Cell Biol. 1998, 142, 1223–1233. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  98. Sato, S.; Ward, C.L.; Krouse, M.E.; Wine, J.J.; Kopito, R.R. Glycerol reverses the misfolding phenotype of the most common cystic fibrosis mutation. J. Biol. Chem. 1996, 271, 635–638. [Google Scholar] [CrossRef] [Scilit]
  99. Wilkinson, S. ER-phagy: Shaping up and destressing the endoplasmic reticulum. FEBS J. 2019, 286, 2645–2663. [Google Scholar] [CrossRef] [Scilit]
  100. Jain, B.P. An overview of unfolded protein response signaling and its role in cancer. Cancer Biother. Radiopharm. 2017, 32, 275–281. [Google Scholar] [CrossRef] [Scilit]
  101. Kaushik, S.; Cuervo, A.M. Chaperone-mediated autophagy: A unique way to enter the lysosome world. Trends Cell Biol. 2012, 22, 407–417. [Google Scholar] [CrossRef] [Scilit]
  102. Fu, S.; Watkins, S.M.; Hotamisligil, G.S. The role of endoplasmic reticulum in hepatic lipid homeostasis and stress signaling. Cell Metab. 2012, 15, 623–634. [Google Scholar] [CrossRef] [Scilit]
  103. Garg, A.D.; Kaczmarek, A.; Krysko, O.; Vandenabeele, P.; Krysko, D.V.; Agostinis, P. ER stress-induced inflammation: Does it aid or impede disease progression? Trends Mol. Med. 2012, 18, 589–598. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  104. Li, H.; Korennykh, A.V.; Behrman, S.L.; Walter, P. Mammalian endoplasmic reticulum stress sensor IRE1 signals by dynamic clustering. Proc. Natl. Acad. Sci. USA 2010, 107, 16113–16118. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  105. Urano, F.; Wang, X.; Bertolotti, A.; Zhang, Y.; Chung, P.; Harding, H.P.; Ron, D. Coupling of stress in the ER to activation of JNK protein kinases by transmembrane protein kinase IRE1. Science 2000, 287, 664. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  106. Valencia-Sanchez, M.A.; Liu, J.; Hannon, G.J.; Parker, R. Control of translation and mRNA degradation by miRNAs and siRNAs. Genes Dev. 2006, 20, 515–524. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  107. Hara, T.; Hashimoto, Y.; Akuzawa, T.; Hirai, R.; Kobayashi, H.; Sato, K. Rer1 and calnexin regulate endoplasmic reticulum retention of a peripheral myelin protein 22 mutant that causes type 1A Charcot-Marie-Tooth disease. Sci. Rep. 2014, 4, 6992. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  108. Briant, K.; Johnson, N.; Swanton, E. Transmembrane domain quality control systems operate at the endoplasmic reticulum and Golgi apparatus. PLoS ONE 2017, 12, e0173924. [Google Scholar] [CrossRef] [Scilit]
  109. Okiyoneda, T.; Veit, G.; Sakai, R.; Aki, M.; Fujihara, T.; Higashi, M.; Susuki-Miyata, S.; Miyata, M.; Fukuda, N.; Yoshida, A.; et al. Chaperone-independent peripheral quality control of CFTR by RFFL E3 Ligase. Dev. Cell 2018, 44, 694–708.e7. [Google Scholar] [CrossRef] [Scilit]
  110. Tzivoni, D.; Gavish, A.; Zin, D.; Gottlieb, S.; Moriel, M.; Keren, A.; Banai, S.; Stern, S. Prognostic significance of ischemic episodes in patients with previous myocardial infarction. Am. J. Cardiol. 1988, 62, 661–664. [Google Scholar] [CrossRef] [Scilit]
  111. Fath, S.; Mancias, J.D.; Bi, X.; Goldberg, J. Structure and organization of coat proteins in the COPII cage. Cell 2007, 129, 1325–1336. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  112. Li, J.; Ahat, E.; Wang, Y. Golgi structure and function in health, stress, and diseases. Results Probl. Cell Differ. 2019, 67, 441–485. [Google Scholar] [CrossRef] [Scilit]
  113. McCaughey, J.; Stephens, D.J. COPII-dependent ER export in animal cells: Adaptation and control for diverse cargo. Histochem. Cell Biol. 2018, 150, 119–131. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  114. Huotari, J.; Helenius, A. Endosome maturation. EMBO J. 2011, 30, 3481–3500. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  115. Cocucci, E.; Meldolesi, J. Ectosomes and exosomes: Shedding the confusion between extracellular vesicles. Trends Cell Biol. 2015, 25, 364–372. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  116. Pegtel, D.M.; Cosmopoulos, K.; Thorley-Lawson, D.A.; van Eijndhoven, M.A.J.; Hopmans, E.S.; Lindenberg, J.L.; de Gruijl, T.D.; Würdinger, T.; Middeldorp, J.M. Functional delivery of viral miRNAs via exosomes. Proc. Natl. Acad. Sci. USA 2010, 107, 6328–6333. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  117. Valadi, H.; Ekström, K.; Bossios, A.; Sjöstrand, M.; Lee, J.J.; Lötvall, J.O. Exosome-mediated transfer of mRNAs and microRNAs is a novel mechanism of genetic exchange between cells. Nat. Cell Biol. 2007, 9, 654–659. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  118. Takeuchi, T.; Suzuki, M.; Fujikake, N.; Popiel, H.A.; Kikuchi, H.; Futaki, S.; Wada, K.; Nagai, Y. Intercellular chaperone transmission via exosomes contributes to maintenance of protein homeostasis at the organismal level. Proc. Natl. Acad. Sci. USA 2015, 112, E2497–E2506. [Google Scholar] [CrossRef] [Scilit]
  119. Li, X.; Corbett, A.L.; Taatizadeh, E.; Tasnim, N.; Little, J.P.; Garnis, C.; Daugaard, M.; Guns, E.; Hoorfar, M.; Li, I.T.S. Challenges and opportunities in exosome research-Perspectives from biology, engineering, and cancer therapy. APL Bioeng. 2019, 3, 11503. [Google Scholar] [CrossRef] [Scilit]
  120. Ma, D.; Zerangue, N.; Lin, Y.-F.; Collins, A.; Yu, M.; Jan, Y.N.; Jan, L.Y. Role of ER export signals in controlling surface potassium channel numbers. Science 2001, 291, 316–319. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  121. Petrecca, K.; Atanasiu, R.; Akhavan, A.; Shrier, A. N-linked glycosylation sites determine HERG channel surface membrane expression. J. Physiol. 1999, 515 Pt 1, 41–48. [Google Scholar] [CrossRef] [Scilit]
  122. Watanabe, I.; Wang, H.-G.; Sutachan, J.J.; Zhu, J.; Recio-Pinto, E.; Thornhill, W.B. Glycosylation affects rat Kv1.1 potassium channel gating by a combined surface potential and cooperative subunit interaction mechanism. J. Physiol. 2003, 550, 51–66. [Google Scholar] [CrossRef] [Scilit]
  123. Lopez-Rodriguez, A.; Holmgren, M. Restoration of proper trafficking to the cell surface for membrane proteins harboring cysteine mutations. PLoS ONE 2012, 7, e47693. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  124. Misonou, H.; Mohapatra, D.P.; Park, E.W.; Leung, V.; Zhen, D.; Misonou, K.; Anderson, A.E.; Trimmer, J.S. Regulation of ion channel localization and phosphorylation by neuronal activity. Nat. Neurosci. 2004, 7, 711–718. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  125. Carneiro, A.M.; Ingram, S.L.; Beaulieu, J.-M.; Sweeney, A.; Amara, S.G.; Thomas, S.M.; Caron, M.G.; Torres, G.E. The multiple LIM domain-containing adaptor protein Hic-5 synaptically colocalizes and interacts with the dopamine transporter. J. Neurosci. 2002, 22, 7045–7054. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  126. Carneiro, A.M.D.; Blakely, R.D. Serotonin-, protein kinase C-, and Hic-5-associated redistribution of the platelet serotonin transporter. J. Biol. Chem. 2006, 281, 24769–24780. [Google Scholar] [CrossRef] [Scilit]
  127. Offringa, R.; Huang, F. Phosphorylation-dependent trafficking of plasma membrane proteins in animal and plant cells. J. Integr. Plant Biol. 2013, 55, 789–808. [Google Scholar] [CrossRef] [Scilit]
  128. Martínez-Mármol, R.; Comes, N.; Styrczewska, K.; Pérez-Verdaguer, M.; Vicente, R.; Pujadas, L.; Soriano, E.; Sorkin, A.; Felipe, A. Unconventional EGF-induced ERK1/2-mediated Kv1.3 endocytosis. Cell. Mol. Life Sci. 2016, 73, 1515–1528. [Google Scholar] [CrossRef] [Scilit]
  129. Wang, Y.; Yang, J.; Yi, J. Redox sensing by proteins: Oxidative modifications on cysteines and the consequent events. Antioxid. Redox Signal. 2012, 16, 649–657. [Google Scholar] [CrossRef] [Scilit]
  130. Bindoli, A.; Fukuto, J.M.; Forman, H.J. Thiol chemistry in peroxidase catalysis and redox signaling. Antioxid. Redox Signal. 2008, 10, 1549–1564. [Google Scholar] [CrossRef] [Scilit]
  131. Bogeski, I.; Niemeyer, B.A. Redox regulation of ion channels. Antioxid. Redox Signal. 2014, 21, 859–862. [Google Scholar] [CrossRef] [Scilit]
  132. Chen, B.; Sun, Y.; Niu, J.; Jarugumilli, G.K.; Wu, X. Protein lipidation in cell signaling and diseases: Function, regulation, and therapeutic opportunities. Cell Chem. Biol. 2018, 25, 817–831. [Google Scholar] [CrossRef] [Scilit]
  133. Jeffries, O.; Geiger, N.; Rowe, I.C.M.; Tian, L.; McClafferty, H.; Chen, L.; Bi, D.; Knaus, H.G.; Ruth, P.; Shipston, M.J. Palmitoylation of the S0-S1 linker regulates cell surface expression of voltage- and calcium-activated potassium (BK) channels. J. Biol. Chem. 2010, 285, 33307–33314. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  134. Tian, L.; McClafferty, H.; Knaus, H.-G.; Ruth, P.; Shipston, M.J. Distinct acyl protein transferases and thioesterases control surface expression of calcium-activated potassium channels. J. Biol. Chem. 2012, 287, 14718–14725. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  135. Alioua, A.; Li, M.; Wu, Y.; Stefani, E.; Toro, L. Unconventional myristoylation of large-conductance Ca2+-activated K+ channel (Slo1) via serine/threonine residues regulates channel surface expression. Proc. Natl. Acad. Sci. USA 2011, 108, 10744–10749. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  136. Mizushima, N.; Komatsu, M. Autophagy: Renovation of cells and tissues. Cell 2011, 147, 728–741. [Google Scholar] [CrossRef] [Scilit]
  137. Johansen, T.; Lamark, T. Selective autophagy: ATG8 family proteins, LIR motifs and cargo receptors. J. Mol. Biol. 2020, 432, 80–103. [Google Scholar] [CrossRef] [Scilit]
  138. Popovic, D.; Vucic, D.; Dikic, I. Ubiquitination in disease pathogenesis and treatment. Nat. Med. 2014, 20, 1242–1253. [Google Scholar] [CrossRef] [Scilit]
  139. Herskowitz, I. Functional inactivation of genes by dominant negative mutations. Nature 1987, 329, 219–222. [Google Scholar] [CrossRef] [Scilit]
  140. Fornace, A.J., Jr.; Nebert, D.W.; Hollander, M.C.; Luethy, J.D.; Papathanasiou, M.; Fargnoli, J.; Holbrook, N.J. Mammalian genes coordinately regulated by growth arrest signals and DNA-damaging agents. Mol. Cell. Biol. 1989, 9, 4196–4203. [Google Scholar] [CrossRef] [Scilit]
  141. Schmitt-Ney, M.; Habener, J.F. CHOP/GADD153 gene expression response to cellular stresses inhibited by prior exposure to ultraviolet light wavelength band C (UVC). Inhibitory sequence mediating the UVC response localized to exon 1. J. Biol. Chem. 2000, 275, 40839–40845. [Google Scholar] [CrossRef] [Scilit]
  142. Spear, E.; Ng, D.T. The unfolded protein response: No longer just a special teams player. Traffic 2001, 2, 515–523. [Google Scholar] [CrossRef] [Scilit]
  143. Vembar, S.S.; Brodsky, J.L. One step at a time: Endoplasmic reticulum-associated degradation. Nat. Rev. Mol. Cell Biol. 2008, 9, 944–957. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  144. Marciniak, S.J.; Ron, D. Endoplasmic reticulum stress signaling in disease. Physiol. Rev. 2006, 86, 1133–1149. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  145. Uehara, T.; Nakamura, T.; Yao, D.; Shi, Z.-Q.; Gu, Z.; Ma, Y.; Masliah, E.; Nomura, Y.; Lipton, S.A. S-Nitrosylated protein-disulphide isomerase links protein misfolding to neurodegeneration. Nature 2006, 441, 513. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  146. Zhang, K.; Kaufman, R.J. The unfolded protein response. A stress signaling pathway critical for health and disease. Neurology 2006, 66, S102–S109. [Google Scholar] [CrossRef] [Scilit]
  147. Otsu, M.; Sitia, R. Diseases originating from altered protein quality control in the endoplasmic reticulum. Curr. Med. Chem. 2007, 14, 1639–1652. [Google Scholar] [CrossRef] [Scilit]
  148. Valastyan, J.S.; Lindquist, S. Mechanisms of protein-folding diseases at a glance. Dis. Model. Mech. 2014, 7, 9–14. [Google Scholar] [CrossRef] [Scilit]
  149. Foufelle, F.; Ferré, P. Unfolded protein response: Its role in physiology and physiopathology TT - La réponse UPR: Son rôle physiologique et physiopathologique. Med. Sci. 2007, 23, 291–296. [Google Scholar] [CrossRef] [Scilit]
  150. Menzies, F.M.; Moreau, K.; Rubinsztein, D.C. Protein misfolding disorders and macroautophagy. Curr. Opin. Cell Biol. 2011, 23, 190–197. [Google Scholar] [CrossRef] [Scilit]
  151. Wang, S.; Kaufman, R.J. The impact of the unfolded protein response on human disease. J. Cell Biol. 2012, 197, 857–867. [Google Scholar] [CrossRef] [Scilit]
  152. Anfinsen, C.B. Principles that govern the folding of protein chains. Science 1973, 181, 223–230. [Google Scholar] [CrossRef] [Scilit]
  153. Lee, C.; Ham, S. Characterizing amyloid-beta protein misfolding from molecular dynamics simulations with explicit water. J. Comput. Chem. 2011, 32, 349–355. [Google Scholar] [CrossRef] [Scilit]
  154. Huber, R.; Carrell, R.W. Implications of the three-dimensional structure of alpha 1-antitrypsin for structure and function of serpins. Biochemistry 1989, 28, 8951–8966. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  155. Carr, C.M.; Chaudhry, C.; Kim, P.S. Influenza hemagglutinin is spring-loaded by a metastable native conformation. Proc. Natl. Acad. Sci. USA 1997, 94, 14306–14313. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  156. Bullough, P.A.; Hughson, F.M.; Skehel, J.J.; Wiley, D.C. Structure of influenza haemagglutinin at the pH of membrane fusion. Nature 1994, 371, 37–43. [Google Scholar] [CrossRef] [Scilit]
  157. Orosz, A.; Wisniewski, J.; Wu, C. Regulation of Drosophila heat shock factor trimerization: Global sequence requirements and independence of nuclear localization. Mol. Cell. Biol. 1996, 16, 7018–7030. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  158. Hipp, M.S.; Park, S.-H.; Hartl, F.U. Proteostasis impairment in protein-misfolding and -aggregation diseases. Trends Cell Biol. 2014, 24, 506–514. [Google Scholar] [CrossRef] [Scilit]
  159. Siddiqui, M.H.; Al-Khaishany, M.Y.; Al-Qutami, M.A.; Al-Whaibi, M.H.; Grover, A.; Ali, H.M.; Al-Wahibi, M.S. Morphological and physiological characterization of different genotypes of faba bean under heat stress. Saudi J. Biol. Sci. 2015, 22, 656–663. [Google Scholar] [CrossRef] [Scilit]
  160. Currais, A.; Fischer, W.; Maher, P.; Schubert, D. Intraneuronal protein aggregation as a trigger for inflammation and neurodegeneration in the aging brain. FASEB J. 2017, 31, 5–10. [Google Scholar] [CrossRef] [Scilit]
  161. Tuite, M.F.; Melki, R. Protein misfolding and aggregation in ageing and disease: Molecular processes and therapeutic perspectives. Prion 2007, 1, 116–120. [Google Scholar] [CrossRef] [Scilit]
  162. Dowhan, W. Molecular basis for membrane phospholipid diversity: Why are there so many lipids? Annu. Rev. Biochem. 1997, 66, 199–232. [Google Scholar] [CrossRef] [Scilit]
  163. Sanders, C.R.; Nagy, J.K. Misfolding of membrane proteins in health and disease: The lady or the tiger? Curr. Opin. Struct. Biol. 2000, 10, 438–442. [Google Scholar] [CrossRef] [Scilit]
  164. Sarnataro, D.; Campana, V.; Paladino, S.; Stornaiuolo, M.; Nitsch, L.; Zurzolo, C. PrP(C) association with lipid rafts in the early secretory pathway stabilizes its cellular conformation. Mol. Biol. Cell 2004, 15, 4031–4042. [Google Scholar] [CrossRef] [Scilit]
  165. Campana, V.; Sarnataro, D.; Fasano, C.; Casanova, P.; Paladino, S.; Zurzolo, C. Detergent-resistant membrane domains but not the proteasome are involved in the misfolding of a PrP mutant retained in the endoplasmic reticulum. J. Cell Sci. 2006, 119, 433–442. [Google Scholar] [CrossRef] [Scilit]
  166. Wieland, F.T.; Gleason, M.L.; Serafini, T.A.; Rothman, J.E. The rate of bulk flow from the endoplasmic reticulum to the cell surface. Cell 1987, 50, 289–300. [Google Scholar] [CrossRef] [Scilit]
  167. Mizuno, M.; Singer, S.J. A soluble secretory protein is first concentrated in the endoplasmic reticulum before transfer to the Golgi apparatus. Proc. Natl. Acad. Sci. USA 1993, 90, 5732–5736. [Google Scholar] [CrossRef] [Scilit]
  168. Nishimura, N.; Balch, W.E. A di-acidic signal required for selective export from the endoplasmic reticulum. Science 1997, 277, 556–558. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  169. Martínez-Menárguez, J.A.; Geuze, H.J.; Slot, J.W.; Klumperman, J. Vesicular tubular clusters between the ER and Golgi mediate concentration of soluble secretory proteins by exclusion from COPI-coated vesicles. Cell 1999, 98, 81–90. [Google Scholar] [CrossRef] [Scilit]
  170. Bowie, J.U. Solving the membrane protein folding problem. Nature 2005, 438, 581–589. [Google Scholar] [CrossRef] [Scilit]
  171. Powl, A.M.; East, J.M.; Lee, A.G. Lipid−protein interactions studied by introduction of a tryptophan residue:  the mechanosensitive channel MscL. Biochemistry 2003, 42, 14306–14317. [Google Scholar] [CrossRef] [Scilit]
  172. Hong, H. Role of lipids in folding, misfolding and function of integral membrane proteins. Adv. Exp. Med. Biol. 2015, 855, 1–31. [Google Scholar] [CrossRef] [Scilit]
  173. Soto, C.; Pritzkow, S. Protein misfolding, aggregation, and conformational strains in neurodegenerative diseases. Nat. Neurosci. 2018, 21, 1332–1340. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  174. Marsh, J.A.; Hernández, H.; Hall, Z.; Ahnert, S.E.; Perica, T.; Robinson, C.V.; Teichmann, S.A. Protein complexes are under evolutionary selection to assemble via ordered pathways. Cell 2013, 153, 461–470. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  175. Ng, D.P.; Poulsen, B.E.; Deber, C.M. Membrane protein misassembly in disease. Biochim. Biophys. Acta 2012, 1818, 1115–1122. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  176. Braverman, N.E.; D’Agostino, M.D.; Maclean, G.E. Peroxisome biogenesis disorders: Biological, clinical and pathophysiological perspectives. Dev. Disabil. Res. Rev. 2013, 17, 187–196. [Google Scholar] [CrossRef] [Scilit]
  177. Farré, J.-C.; Mahalingam, S.S.; Proietto, M.; Subramani, S. Peroxisome biogenesis, membrane contact sites, and quality control. EMBO Rep. 2019, 20, e46864. [Google Scholar] [CrossRef] [Scilit]
  178. Chu, C.Y.; King, J.; Berrini, M.; Rumley, A.C.; Apaja, P.M.; Lukacs, G.L.; Alexander, R.T.; Cordat, E. Degradation mechanism of a Golgi-retained distal renal tubular acidosis mutant of the kidney anion exchanger 1 in renal cells. Am. J. Physiol. Cell Physiol. 2014, 307, C296–C307. [Google Scholar] [CrossRef] [Scilit]
  179. Cordat, E.; Kittanakom, S.; Yenchitsomanus, P.-T.; Li, J.; Du, K.; Lukacs, G.L.; Reithmeier, R.A.F. Dominant and recessive distal renal tubular acidosis mutations of kidney anion exchanger 1 induce distinct trafficking defects in MDCK cells. Traffic 2006, 7, 117–128. [Google Scholar] [CrossRef] [Scilit]
  180. Kopito, R.R.; Sitia, R. Aggresomes and Russell bodies. Symptoms of cellular indigestion? EMBO Rep. 2000, 1, 225–231. [Google Scholar] [CrossRef] [Scilit]
  181. Ruan, L.; Zhou, C.; Jin, E.; Kucharavy, A.; Zhang, Y.; Wen, Z.; Florens, L.; Li, R. Cytosolic proteostasis through importing of misfolded proteins into mitochondria. Nature 2017, 543, 443–446. [Google Scholar] [CrossRef] [Scilit]
  182. Leidenheimer, N.J. Cognate ligand chaperoning: A novel mechanism for the post-translational regulation of neurotransmitter receptor biogenesis. Front. Cell. Neurosci. 2017, 11, 245. [Google Scholar] [CrossRef] [Scilit]
  183. Sipe, J.D.; Benson, M.D.; Buxbaum, J.N.; Ikeda, S.-I.; Merlini, G.; Saraiva, M.J.M.; Westermark, P. Amyloid fibril proteins and amyloidosis: Chemical identification and clinical classification International Society of Amyloidosis 2016 Nomenclature Guidelines. Amyloid 2016, 23, 209–213. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  184. de Coninck, D.; Schmidt, T.H.; Schloetel, J.-G.; Lang, T. Packing density of the amyloid precursor protein in the cell membrane. Biophys. J. 2018, 114, 1128–1141. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  185. Fabiani, C.; Antollini, S.S. Alzheimer’s disease as a membrane disorder: Spatial cross-talk among beta-amyloid peptides, nicotinic acetylcholine receptors and lipid rafts. Front. Cell. Neurosci. 2019, 13, 309. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  186. Kollmer, M.; Meinhardt, K.; Haupt, C.; Liberta, F.; Wulff, M.; Linder, J.; Handl, L.; Heinrich, L.; Loos, C.; Schmidt, M.; et al. Electron tomography reveals the fibril structure and lipid interactions in amyloid deposits. Proc. Natl. Acad. Sci. USA 2016, 113, 5604–5609. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  187. Glover, J.R.; Lindquist, S. Hsp104, Hsp70, and Hsp40: A novel chaperone system that rescues previously aggregated proteins. Cell 1998, 94, 73–82. [Google Scholar] [CrossRef] [Scilit]
  188. Mas, G.; Hiller, S. Conformational plasticity of molecular chaperones involved in periplasmic and outer membrane protein folding. FEMS Microbiol. Lett. 2018, 365, fny121. [Google Scholar] [CrossRef] [Scilit]
  189. Hartl, F.U.; Bracher, A.; Hayer-Hartl, M. Molecular chaperones in protein folding and proteostasis. Nature 2011, 475, 324. [Google Scholar] [CrossRef] [Scilit]
  190. Hou, Z.-S.; Ulloa-Aguirre, A.; Tao, Y.-X. Pharmacoperone drugs: Targeting misfolded proteins causing lysosomal storage-, ion channels-, and G protein-coupled receptors-associated conformational disorders. Expert Rev. Clin. Pharmacol. 2018, 11, 611–624. [Google Scholar] [CrossRef] [Scilit]
  191. Laskey, R.A.; Honda, B.M.; Mills, A.D.; Finch, J.T. Nucleosomes are assembled by an acidic protein which binds histones and transfers them to DNA. Nature 1978, 275, 416. [Google Scholar] [CrossRef] [Scilit]
  192. Wayne, N.; Mishra, P.; Bolon, D.N. Hsp90 and client protein maturation. Methods Mol. Biol. 2011, 787, 33–44. [Google Scholar] [CrossRef] [Scilit]
  193. Frydman, J.; Nimmesgern, E.; Ohtsuka, K.; Hartl, F.U. Folding of nascent polypeptide chains in a high molecular mass assembly with molecular chaperones. Nature 1994, 370, 111–117. [Google Scholar] [CrossRef] [Scilit]
  194. Ellis, R.J.; Hemmingsen, S.M. Molecular chaperones: Proteins essential for the biogenesis of some macromolecular structures. Trends Biochem. Sci. 1989, 14, 339–342. [Google Scholar] [CrossRef] [Scilit]
  195. Jacob, P.; Hirt, H.; Bendahmane, A. The heat-shock protein/chaperone network and multiple stress resistance. Plant Biotechnol. J. 2017, 15, 405–414. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  196. Cortez, L.; Sim, V. The therapeutic potential of chemical chaperones in protein folding diseases. Prion 2014, 8, 197–202. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  197. Morello, J.P.; Salahpour, A.; Laperrière, A.; Bernier, V.; Arthus, M.F.; Lonergan, M.; Petäjä-Repo, U.; Angers, S.; Morin, D.; Bichet, D.G.; et al. Pharmacological chaperones rescue cell-surface expression and function of misfolded V2 vasopressin receptor mutants. J. Clin. Investig. 2000, 105, 887–895. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  198. He, L.; Hiller, S. Frustrated interfaces facilitate dynamic interactions between native client proteins and holdase chaperones. Chembiochem 2019, 20, 2803–2806. [Google Scholar] [CrossRef] [Scilit]
  199. Akerfelt, M.; Morimoto, R.; Sistonen, L. Heat shock factors: Integrators of cell stress, development and lifespan. Nat. Rev. Mol. Cell Biol. 2010, 11, 545–555. [Google Scholar] [CrossRef] [Scilit]
  200. Hoffmann, J.H.; Linke, K.; Graf, P.C.F.; Lilie, H.; Jakob, U. Identification of a redox-regulated chaperone network. EMBO J. 2004, 23, 160–168. [Google Scholar] [CrossRef] [Scilit]
  201. Mattoo, R.U.H.; Goloubinoff, P. Molecular chaperones are nanomachines that catalytically unfold misfolded and alternatively folded proteins. Cell. Mol. Life Sci. 2014, 71, 3311–3325. [Google Scholar] [CrossRef] [Scilit]
  202. Kaiser, C.M.; Chang, H.C.; Agashe, V.R.; Lakshmipathy, S.K.; Etchells, S.A.; Hayer-Hartl, M.; Hartl, F.U.; Barral, J.M. Real-time observation of trigger factor function on translating ribosomes. Nature 2006, 444, 455–460. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  203. Dobson, C.M. Principles of protein folding, misfolding and aggregation. Semin. Cell Dev. Biol. 2004, 15, 3–16. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  204. Taipale, M.; Krykbaeva, I.; Koeva, M.; Kayatekin, C.; Westover, K.D.; Karras, G.I.; Lindquist, S. Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition. Cell 2012, 150, 987–1001. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  205. Vannimenus, J.; Toulouse, G. Theory of the frustration effect. II. Ising spins on a square lattice. J. Phys. C Solid State Phys. 1977, 10, L537–L542. [Google Scholar] [CrossRef] [Scilit]
  206. Ferreiro, D.U.; Komives, E.A.; Wolynes, P.G. Frustration, function and folding. Curr. Opin. Struct. Biol. 2018, 48, 68–73. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  207. He, L.; Sharpe, T.; Mazur, A.; Hiller, S. A molecular mechanism of chaperone-client recognition. Sci. Adv. 2016, 2, e1601625. [Google Scholar] [CrossRef] [Scilit]
  208. Wälti, M.A.; Libich, D.S.; Clore, G.M. Extensive sampling of the cavity of the GroEL nanomachine by protein substrates probed by paramagnetic relaxation enhancement. J. Phys. Chem. Lett. 2018, 9, 3368–3371. [Google Scholar] [CrossRef] [Scilit]
  209. Gething, M.-J.; Sambrook, J. Protein folding in the cell. Nature 1992, 357, 57–59. [Google Scholar] [CrossRef] [Scilit]
  210. Mayer, M.P.; Bukau, B. Hsp70 chaperones: Cellular functions and molecular mechanism. Cell. Mol. Life Sci. 2005, 62, 670–684. [Google Scholar] [CrossRef] [Scilit]
  211. Radons, J. The human HSP70 family of chaperones: Where do we stand? Cell Stress Chaperones 2016, 21, 379–404. [Google Scholar] [CrossRef] [Scilit]
  212. Kampinga, H.H.; Craig, E.A. The HSP70 chaperone machinery: J proteins as drivers of functional specificity. Nat. Rev. Mol. Cell Biol. 2010, 11, 579–592. [Google Scholar] [CrossRef] [Scilit]
  213. Sanguinetti, M.C.; Tristani-Firouzi, M. hERG potassium channels and cardiac arrhythmia. Nature 2006, 440, 463–469. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  214. Goldberg, A.L. Protein degradation and protection against misfolded or damaged proteins. Nature 2003, 426, 895–899. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  215. Hirota, Y.; Kurata, Y.; Kato, M.; Notsu, T.; Koshida, S.; Inoue, T.; Kawata, Y.; Miake, J.; Bahrudin, U.; Li, P.; et al. Functional stabilization of Kv1.5 protein by Hsp70 in mammalian cell lines. Biochem. Biophys. Res. Commun. 2008, 372, 469–474. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  216. Choo-Kang, L.R.; Zeitlin, P.L. Induction of HSP70 promotes DeltaF508 CFTR trafficking. Am. J. Physiol. Lung Cell. Mol. Physiol. 2001, 281, L58–L68. [Google Scholar] [CrossRef] [Scilit]
  217. Farinha, C.M.; Nogueira, P.; Mendes, F.; Penque, D.; Amaral, M.D. The human DnaJ homologue (Hdj)-1/heat-shock protein (Hsp) 40 co-chaperone is required for the in vivo stabilization of the cystic fibrosis transmembrane conductance regulator by Hsp70. Biochem. J. 2002, 366, 797–806. [Google Scholar] [CrossRef] [Scilit]
  218. Meacham, G.C.; Lu, Z.; King, S.; Sorscher, E.; Tousson, A.; Cyr, D.M. The Hdj-2/Hsc70 chaperone pair facilitates early steps in CFTR biogenesis. EMBO J. 1999, 18, 1492–1505. [Google Scholar] [CrossRef] [Scilit]
  219. Vila-Carriles, W.H.; Zhou, Z.-H.; Bubien, J.K.; Fuller, C.M.; Benos, D.J. Participation of the chaperone Hsc70 in the trafficking and functional expression of ASIC2 in glioma cells. J. Biol. Chem. 2007, 282, 34381–34391. [Google Scholar] [CrossRef] [Scilit]
  220. Kapoor, N.; Lee, W.; Clark, E.; Bartoszewski, R.; McNicholas, C.M.; Latham, C.B.; Bebok, Z.; Parpura, V.; Fuller, C.M.; Palmer, C.A.; et al. Interaction of ASIC1 and ENaC subunits in human glioma cells and rat astrocytes. Am. J. Physiol. Cell Physiol. 2011, 300, C1246–C1259. [Google Scholar] [CrossRef] [Scilit]
  221. Goldfarb, S.B.; Kashlan, O.B.; Watkins, J.N.; Suaud, L.; Yan, W.; Kleyman, T.R.; Rubenstein, R.C. Differential effects of Hsc70 and Hsp70 on the intracellular trafficking and functional expression of epithelial sodium channels. Proc. Natl. Acad. Sci. USA 2006, 103, 5817–5822. [Google Scholar] [CrossRef] [Scilit]
  222. Evans, C.G.; Wisén, S.; Gestwicki, J.E. Heat shock proteins 70 and 90 inhibit early stages of amyloid β-(1–42) aggregation in vitro. J. Biol. Chem. 2006, 281, 33182–33191. [Google Scholar] [CrossRef] [Scilit]
  223. Moloney, T.C.; Hyland, R.; O’Toole, D.; Paucard, A.; Kirik, D.; O’Doherty, A.; Gorman, A.M.; Dowd, E. Heat shock protein 70 reduces α-synuclein-induced predegenerative neuronal dystrophy in the α-synuclein viral gene transfer rat model of Parkinson’s disease. CNS Neurosci. Ther. 2013, 20, 50–58. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  224. Dedmon, M.M.; Christodoulou, J.; Wilson, M.R.; Dobson, C.M. Heat shock protein 70 inhibits α-synuclein fibril formation via preferential binding to prefibrillar species. J. Biol. Chem. 2005, 280, 14733–14740. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  225. Flower, T.R.; Chesnokova, L.S.; Froelich, C.A.; Dixon, C.; Witt, S.N. Heat shock prevents alpha-synuclein-induced apoptosis in a yeast model of parkinson’s disease. J. Mol. Biol. 2005, 351, 1081–1100. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  226. Prodromou, C. The “active life” of Hsp90 complexes. Biochim. Biophys. Acta Mol. Cell Res. 2012, 1823, 614–623. [Google Scholar] [CrossRef] [Scilit]
  227. Karagöz, G.E.; Rüdiger, S.G.D. Hsp90 interaction with clients. Trends Biochem. Sci. 2015, 40, 117–125. [Google Scholar] [CrossRef] [Scilit]
  228. Taipale, M.; Jarosz, D.F.; Lindquist, S. Hsp90 at the hub of protein homeostasis: Emerging mechanistic insights. Nat. Rev. Mol. Cell Biol. 2010, 11, 515–528. [Google Scholar] [CrossRef] [Scilit]
  229. Boulon, S.; Bertrand, E.; Pradet-Balade, B. Hsp90 and the R2TP co-chaperone complex: Building multi-protein machineries essential for cell growth and gene expression. RNA Biol. 2012, 9, 148–155. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  230. Kadota, Y.; Shirasu, K.; Guerois, R. NLR sensors meet at the SGT1-HSP90 crossroad. Trends Biochem. Sci. 2010, 35, 199–207. [Google Scholar] [CrossRef] [Scilit]
  231. Pearl, L.H.; Prodromou, C.; Workman, P. The Hsp90 molecular chaperone: An open and shut case for treatment. Biochem. J. 2008, 410, 439–453. [Google Scholar] [CrossRef] [Scilit]
  232. Wegele, H.; Müller, L.; Buchner, J. Hsp70 and Hsp90—A Relay Team for Protein Folding BT- Reviews of Physiology, Biochemistry and Pharmacology; Springer: Berlin/Heidelberg, Germany, 2004; pp. 1–44. ISBN 978-3-540-44423-7. [Google Scholar]
  233. Jakob, U.; Lilie, H.; Meyer, I.; Buchner, J. Transient interaction of Hsp90 with early unfolding intermediates of citrate synthase: Implications for heat shock in vivo. J. Biol. Chem. 1995, 270, 7288–7294. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  234. McLaughlin, S.H.; Smith, H.W.; Jackson, S.E. Stimulation of the weak ATPase activity of human Hsp90 by a client protein. J. Mol. Biol. 2002, 315, 787–798. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  235. Krukenberg, K.A.; Street, T.O.; Lavery, L.A.; Agard, D.A. Conformational dynamics of the molecular chaperone Hsp90. Q. Rev. Biophys. 2011, 44, 229–255. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  236. González-del Pozo, M.; Borrego, S.; Barragán, I.; Pieras, J.I.; Santoyo, J.; Matamala, N.; Naranjo, B.; Dopazo, J.; Antiñolo, G. Mutation screening of multiple genes in Spanish patients with autosomal recessive retinitis pigmentosa by targeted resequencing. PLoS ONE 2011, 6. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  237. Young, J.C.; Agashe, V.R.; Siegers, K.; Hartl, F.U. Pathways of chaperone-mediated protein folding in the cytosol. Nat. Rev. Mol. Cell Biol. 2004, 5, 781–791. [Google Scholar] [CrossRef] [Scilit]
  238. Takayama, S.; Reed, J.C.; Homma, S. Heat-shock proteins as regulators of apoptosis. Oncogene 2003, 22, 9041–9047. [Google Scholar] [CrossRef] [Scilit]
  239. Wiech, H.; Buchner, J.; Zimmermann, R.; Jakob, U. Hsp90 chaperones protein folding in vitro. Nature 1992, 358, 169–170. [Google Scholar] [CrossRef] [Scilit]
  240. Ficker, E.; Dennis, A.T.; Wang, L.; Brown, A.M. Role of the cytosolic chaperones Hsp70 and Hsp90 in maturation of the cardiac potassium channel HERG. Circ. Res. 2003, 92, e87–e100. [Google Scholar] [CrossRef] [Scilit]
  241. Gao, Y.; Yechikov, S.; Vazquez, A.E.; Chen, D.; Nie, L. Distinct roles of molecular chaperones HSP90α and HSP90β in the biogenesis of KCNQ4 channels. PLoS ONE 2013, 8, e57282. [Google Scholar] [CrossRef] [Scilit]
  242. Chen, X.; Liu, P.; Wang, Q.; Li, Y.; Fu, L.; Fu, H.; Zhu, J.; Chen, Z.; Zhu, W.; Xie, C.; et al. DCZ3112, a novel Hsp90 inhibitor, exerts potent antitumor activity against HER2-positive breast cancer through disruption of Hsp90-Cdc37 interaction. Cancer Lett. 2018, 434, 70–80. [Google Scholar] [CrossRef] [Scilit]
  243. Shelton, L.B.; Koren 3rd, J.; Blair, L.J. Imbalances in the Hsp90 Chaperone Machinery: Implications for Tauopathies. Front. Neurosci. 2017, 11, 724. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  244. Kopito, R.R. Aggresomes, inclusion bodies and protein aggregation. Trends Cell Biol. 2000, 10, 524–530. [Google Scholar] [CrossRef] [Scilit]
  245. Garcia-Mata, R.; Gao, Y.-S.; Sztul, E. Hassles with taking out the garbage: Aggravating aggresomes. Traffic 2002, 3, 388–396. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  246. Wilkinson, B.; Gilbert, H.F. Protein disulfide isomerase. Biochim. Biophys. Acta 2004, 1699, 35–44. [Google Scholar] [CrossRef]
  247. Brehme, M.; Voisine, C.; Rolland, T.; Wachi, S.; Soper, J.H.; Zhu, Y.; Orton, K.; Villella, A.; Garza, D.; Vidal, M.; et al. A chaperome subnetwork safeguards proteostasis in aging and neurodegenerative disease. Cell Rep. 2014, 9, 1135–1150. [Google Scholar] [CrossRef] [Scilit]
  248. Gruber, C.W.; Cemazar, M.; Heras, B.; Martin, J.L.; Craik, D.J. Protein disulfide isomerase: The structure of oxidative folding. Trends Biochem. Sci. 2006, 31, 455–464. [Google Scholar] [CrossRef] [Scilit]
  249. Galligan, J.J.; Petersen, D.R. The human protein disulfide isomerase gene family. Hum. Genomics 2012, 6, 6. [Google Scholar] [CrossRef] [Scilit]
  250. Guna, A.; Hegde, R.S. Transmembrane domain recognition during membrane protein biogenesis and quality control. Curr. Biol. 2018, 28, R498–R511. [Google Scholar] [CrossRef] [Scilit]
  251. Heyden, M.; Freites, J.A.; Ulmschneider, M.B.; White, S.H.; Tobias, D.J. Assembly and stability of α-helical membrane proteins. Soft Matter 2012, 8, 7742–7752. [Google Scholar] [CrossRef] [Scilit]
  252. Cymer, F.; von Heijne, G.; White, S.H. Mechanisms of integral membrane protein insertion and folding. J. Mol. Biol. 2015, 427, 999–1022. [Google Scholar] [CrossRef] [Scilit]
  253. Béguin, P.; Hasler, U.; Beggah, A.; Horisberger, J.D.; Geering, K. Membrane integration of Na,K-ATPase alpha-subunits and beta-subunit assembly. J. Biol. Chem. 1998, 273, 24921–24931. [Google Scholar] [CrossRef] [Scilit]
  254. Béguin, P.; Hasler, U.; Staub, O.; Geering, K. Endoplasmic reticulum quality control of oligomeric membrane proteins: Topogenic determinants involved in the degradation of the unassembled Na,K-ATPase alpha subunit and in its stabilization by beta subunit assembly. Mol. Biol. Cell 2000, 11, 1657–1672. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  255. Feige, M.J.; Hendershot, L.M. Quality control of integral membrane proteins by assembly-dependent membrane integration. Mol. Cell 2013, 51, 297–309. [Google Scholar] [CrossRef] [Scilit]
  256. Lamb, J.R.; Tugendreich, S.; Hieter, P. Tetratrico peptide repeat interactions: To TPR or not to TPR? Trends Biochem. Sci. 1995, 20, 257–259. [Google Scholar] [CrossRef] [Scilit]
  257. McDonough, H.; Patterson, C. CHIP: A link between the chaperone and proteasome systems. Cell Stress Chaperones 2003, 8, 303–308. [Google Scholar] [CrossRef] [Scilit]
  258. Apaja, P.M.; Xu, H.; Lukacs, G.L. Quality control for unfolded proteins at the plasma membrane. J. Cell Biol. 2010, 191, 553–570. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  259. Li, P.; Kurata, Y.; Maharani, N.; Mahati, E.; Higaki, K.; Hasegawa, A.; Shirayoshi, Y.; Yoshida, A.; Kondo, T.; Kurozawa, Y.; et al. E3 ligase CHIP and Hsc70 regulate Kv1.5 protein expression and function in mammalian cells. J. Mol. Cell. Cardiol. 2015, 86, 138–146. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  260. Denning, G.M.; Anderson, M.P.; Amara, J.F.; Marshall, J.; Smith, A.E.; Welsh, M.J. Processing of mutant cystic fibrosis transmembrane conductance regulator is temperature-sensitive. Nature 1992, 358, 761. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  261. Lampel, A.; Bram, Y.; Levy-Sakin, M.; Bacharach, E.; Gazit, E. The Effect of chemical chaperones on the assembly and stability of HIV-1 capsid protein. PLoS ONE 2013, 8, 25–29. [Google Scholar] [CrossRef] [Scilit]
  262. Dandage, R.; Bandyopadhyay, A.; Jayaraj, G.G.; Saxena, K.; Dalal, V.; Das, A.; Chakraborty, K. Classification of chemical chaperones based on their effect on protein folding landscapes. ACS Chem. Biol. 2015, 10, 813–820. [Google Scholar] [CrossRef] [Scilit]
  263. Perlmutter, D.H. Chemical chaperones: A pharmacological strategy for disorders of protein folding and trafficking. Pediatr. Res. 2002, 52, 832–836. [Google Scholar] [CrossRef]
  264. Yancey, P.; Clark, M.; Hand, S.; Bowlus, R.; Somero, G. Living with water stress: Evolution of osmolyte systems. Science 1982, 217, 1214–1222. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  265. Wlodarczyk, S.R.; Custódio, D.; Pessoa Jr, A.; Monteiro, G. Influence and effect of osmolytes in biopharmaceutical formulations. Eur. J. Pharm. Biopharm. 2018, 131, 92–98. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  266. Lin, T.Y.; Timasheff, S.N. Why do some organisms use a urea-methylamine mixture as osmolyte? Thermodynamic compensation of urea and trimethylamine N-oxide interactions with protein. Biochemistry 1994, 33, 12695–12701. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  267. Baskakov, I.; Bolen, D.W. Forcing thermodynamically unfolded proteins to fold. J. Biol. Chem. 1998, 273, 4831–4834. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  268. Street, T.O.; Bolen, D.W.; Rose, G.D. A molecular mechanism for osmolyte-induced protein stability. Proc. Natl. Acad. Sci. USA 2006, 103, 13997–14002. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  269. Fischer, H.; Fukuda, N.; Barbry, P.; Illek, B.; Sartori, C.; Matthay, M.A. Partial restoration of defective chloride conductance in DeltaF508 CF mice by trimethylamine oxide. Am. J. Physiol. Lung Cell. Mol. Physiol. 2001, 281, L52–L57. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  270. Deen, P.M.; Marr, N.; Kamsteeg, E.J.; van Balkom, B.W. Nephrogenic diabetes insipidus. Curr. Opin. Nephrol. Hypertens. 2000, 9, 591–595. [Google Scholar] [CrossRef] [Scilit]
  271. Langley, J.M.; Balfe, J.W.; Selander, T.; Ray, P.N.; Clarke, J.T. Autosomal recessive inheritance of vasopressin-resistant diabetes insipidus. Am. J. Med. Genet. 1991, 38, 90–94. [Google Scholar] [CrossRef] [Scilit]
  272. Tamarappoo, B.K.; Yang, B.; Verkman, A.S. Misfolding of mutant aquaporin-2 water channels in nephrogenic siabetes insipidus. J. Biol. Chem. 1999, 274, 34825–34831. [Google Scholar] [CrossRef] [Scilit]
  273. Tamarappoo, B.K.; Verkman, A.S. Defective aquaporin-2 trafficking in nephrogenic diabetes insipidus and correction by chemical chaperones. J. Clin. Investig. 1998, 101, 2257–2267. [Google Scholar] [CrossRef] [Scilit]
  274. Hayashi, H.; Sugiyama, Y. 4-phenylbutyrate enhances the cell surface expression and the transport capacity of wild-type and mutated bile salt export pumps. Hepatology 2007, 45, 1506–1516. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  275. Malatack, J.J.; Doyle, D. A Drug regimen for progressive familial cholestasis Type 2. Pediatrics 2018, 141, e20163877. [Google Scholar] [CrossRef] [Scilit]
  276. Rubenstein, R.C.; Egan, M.E.; Zeitlin, P.L. In vitro pharmacologic restoration of CFTR-mediated chloride transport with sodium 4-phenylbutyrate in cystic fibrosis epithelial cells containing delta F508-CFTR. J. Clin. Investig. 1997, 100, 2457–2465. [Google Scholar] [CrossRef] [Scilit]
  277. Rubenstein, R.C.; Zeitlin, P.L. A pilot clinical trial of oral sodium 4-phenylbutyrate (Buphenyl) in deltaF508-homozygous cystic fibrosis patients: Partial restoration of nasal epithelial CFTR function. Am. J. Respir. Crit. Care Med. 1998, 157, 484–490. [Google Scholar] [CrossRef] [Scilit]
  278. Duricka, D.L.; Brown, R.L.; Varnum, M.D. Defective trafficking of cone photoreceptor CNG channels induces the unfolded protein response and ER-stress-associated cell death. Biochem. J. 2012, 441, 685–696. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  279. Ulloa-Aguirre, A.; Zarinan, T.; Conn, P.M. Pharmacoperones: Targeting therapeutics toward diseases caused by protein misfolding. Rev. Investig. Clin. 2015, 67, 15–19. [Google Scholar] [PubMed]
  280. Bernier, V.; Lagacé, M.; Bichet, D.G.; Bouvier, M. Pharmacological chaperones: Potential treatment for conformational diseases. Trends Endocrinol. Metab. 2004, 15, 222–228. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  281. Janovick, J.A.; Goulet, M.; Bush, E.; Greer, J.; Wettlaufer, D.G.; Conn, P.M. Structure-activity relations of successful pharmacologic chaperones for rescue of naturally occurring and manufactured mutants of the gonadotropin-releasing hormone receptor. J. Pharmacol. Exp. Ther. 2003, 305, 608–614. [Google Scholar] [CrossRef] [Scilit]
  282. Hawtin, S.R. Pharmacological chaperone activity of SR49059 to functionally recover misfolded mutations of the vasopressin V1a receptor. J. Biol. Chem. 2006, 281, 14604–14614. [Google Scholar] [CrossRef] [Scilit]
  283. Fan, J.-Q. A contradictory treatment for lysosomal storage disorders: Inhibitors enhance mutant enzyme activity. Trends Pharmacol. Sci. 2003, 24, 355–360. [Google Scholar] [CrossRef] [Scilit]
  284. Ishii, S. Pharmacological chaperone therapy for Fabry disease. Proc. Jpn. Acad. Ser. B. Phys. Biol. Sci. 2012, 88, 18–30. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  285. Yan, F.; Lin, C.-W.; Weisiger, E.; Cartier, E.A.; Taschenberger, G.; Shyng, S.-L. Sulfonylureas correct trafficking defects of ATP-sensitive potassium channels caused by mutations in the sulfonylurea receptor. J. Biol. Chem. 2004, 279, 11096–11105. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  286. Bernier, V.; Lagacé, M.; Lonergan, M.; Arthus, M.-F.; Bichet, D.G.; Bouvier, M. Functional rescue of the constitutively internalized V2 vasopressin receptor mutant R137H by the pharmacological chaperone action of SR49059. Mol. Endocrinol. 2004, 18, 2074–2084. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  287. Bernier, V.; Morello, J.-P.; Zarruk, A.; Debrand, N.; Salahpour, A.; Lonergan, M.; Arthus, M.-F.; Laperrière, A.; Brouard, R.; Bouvier, M.; et al. Pharmacologic chaperones as a potential treatment for X-linked nephrogenic diabetes insipidus. J. Am. Soc. Nephrol. 2006, 17, 232–243. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  288. Wang, X.-H.; Wang, H.-M.; Zhao, B.-L.; Yu, P.; Fan, Z.-C. Rescue of defective MC4R cell-surface expression and signaling by a novel pharmacoperone Ipsen 17. J. Mol. Endocrinol. 2014, 53, 17–29. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  289. Smith, J.L.; Reloj, A.R.; Nataraj, P.S.; Bartos, D.C.; Schroder, E.A.; Moss, A.J.; Ohno, S.; Horie, M.; Anderson, C.L.; January, C.T.; et al. Pharmacological correction of long QT-linked mutations in KCNH2 (hERG) increases the trafficking of Kv11.1 channels stored in the transitional endoplasmic reticulum. Am. J. Physiol. Cell Physiol. 2013, 305, C919–C930. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  290. Delisle, B.P.; Anderson, C.L.; Balijepalli, R.C.; Anson, B.D.; Kamp, T.J.; January, C.T. Thapsigargin selectively rescues the trafficking defective LQT2 channels G601S and F805C. J. Biol. Chem. 2003, 278, 35749–35754. [Google Scholar] [CrossRef] [Scilit]
  291. Ficker, E.; Obejero-Paz, C.A.; Zhao, S.; Brown, A.M. The binding site for channel blockers that rescue misprocessed human long QT syndrome type 2 ether-a-gogo-related gene (HERG) mutations. J. Biol. Chem. 2002, 277, 4989–4998. [Google Scholar] [CrossRef] [Scilit]
  292. Los, E.L.; Deen, P.M.T.; Robben, J.H. Potential of nonpeptide (ant)agonists to rescue vasopressin V2 receptor mutants for the treatment of X-linked nephrogenic diabetes insipidus. J. Neuroendocrinol. 2010, 22, 393–399. [Google Scholar] [CrossRef] [Scilit]
  293. Robben, J.H.; Kortenoeven, M.L.A.; Sze, M.; Yae, C.; Milligan, G.; Oorschot, V.M.; Klumperman, J.; Knoers, N.V.A.M.; Deen, P.M.T. Intracellular activation of vasopressin V2 receptor mutants in nephrogenic diabetes insipidus by nonpeptide agonists. Proc. Natl. Acad. Sci. USA 2009, 106, 12195–12200. [Google Scholar] [CrossRef] [Scilit]
  294. Jean-Alphonse, F.; Perkovska, S.; Frantz, M.-C.; Durroux, T.; Méjean, C.; Morin, D.; Loison, S.; Bonnet, D.; Hibert, M.; Mouillac, B.; et al. Biased agonist pharmacochaperones of the AVP V2 receptor may treat congenital nephrogenic diabetes insipidus. J. Am. Soc. Nephrol. 2009, 20, 2190–2203. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  295. White, E.; McKenna, J.; Cavanaugh, A.; Breitwieser, G.E. Pharmacochaperone-mediated rescue of calcium-sensing receptor loss-of-function mutants. Mol. Endocrinol. 2009, 23, 1115–1123. [Google Scholar] [CrossRef] [Scilit]
  296. Caldwell, R.A.; Grove, D.E.; Houck, S.A.; Cyr, D.M. Increased folding and channel activity of a rare cystic fibrosis mutant with CFTR modulators. Am. J. Physiol. Lung Cell. Mol. Physiol. 2011, 301, L346–L352. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  297. Deeks, E.D. Lumacaftor/Ivacaftor: A review in cystic fibrosis. Drugs 2016, 76, 1191–1201. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  298. Liu, Q.; Sabirzhanova, I.; Bergbower, E.A.S.; Yanda, M.; Guggino, W.G.; Cebotaru, L. The CFTR Corrector, VX-809 (Lumacaftor), Rescues ABCA4 trafficking mutants: A potential treatment for Stargardt disease. Cell. Physiol. Biochem. 2019, 53, 400–412. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  299. Steele, M.; Seiple, W.H.; Carr, R.E.; Klug, R. The clinical utility of visual-evoked potential acuity testing. Am. J. Ophthalmol. 1989, 108, 572–577. [Google Scholar] [CrossRef] [Scilit]
  300. Ruffin, M.; Roussel, L.; Maillé, É.; Rousseau, S.; Brochiero, E. Vx-809/Vx-770 treatment reduces inflammatory response to Pseudomonas aeruginosa in primary differentiated cystic fibrosis bronchial epithelial cells. Am. J. Physiol. Lung Cell. Mol. Physiol. 2018, 314, L635–L641. [Google Scholar] [CrossRef] [Scilit]
  301. Chaudary, N. Triplet CFTR modulators: Future prospects for treatment of cystic fibrosis. Ther. Clin. Risk Manag. 2018, 14, 2375–2383. [Google Scholar] [CrossRef] [Scilit]
  302. Albright, J.D.; Reich, M.F.; Delos Santos, E.G.; Dusza, J.P.; Sum, F.-W.; Venkatesan, A.M.; Coupet, J.; Chan, P.S.; Ru, X.; Mazandarani, H.; et al. 5-Fluoro-2-methyl-N-[4-(5H-pyrrolo[2,1-c]- [1,4]benzodiazepin-10(11H)-ylcarbonyl)-3- chlorophenyl]benzamide (VPA-985):  An orally active arginine vasopressin antagonist with selectivity for V2 receptors. J. Med. Chem. 1998, 41, 2442–2444. [Google Scholar] [CrossRef] [Scilit]
  303. Robben, J.H.; Sze, M.; Knoers, N.V.A.M.; Deen, P.M.T. Functional rescue of vasopressin V2 receptor mutants in MDCK cells by pharmacochaperones: Relevance to therapy of nephrogenic diabetes insipidus. Am. J. Physiol. Physiol. 2007, 292, F253–F260. [Google Scholar] [CrossRef] [Scilit]
  304. Moeller, H.B.; Rittig, S.; Fenton, R.A. Nephrogenic diabetes insipidus: Essential insights into the molecular background and potential therapies for treatment. Endocr. Rev. 2013, 34, 278–301. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  305. Sorrenson, B.; Suetani, R.J.; Williams, M.J.A.; Bickley, V.M.; George, P.M.; Jones, G.T.; McCormick, S.P.A. Functional rescue of mutant ABCA1 proteins by sodium 4-phenylbutyrate. J. Lipid Res. 2013, 54, 55–62. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  306. Sabirzhanova, I.; Lopes Pacheco, M.; Rapino, D.; Grover, R.; Handa, J.T.; Guggino, W.B.; Cebotaru, L. Rescuing trafficking mutants of the ATP-binding cassette protein, ABCA4, with small molecule correctors as a treatment for Stargardt eye disease. J. Biol. Chem. 2015, 290, 19743–19755. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  307. Cavanaugh, A.; McKenna, J.; Stepanchick, A.; Breitwieser, G.E. Calcium-sensing receptor biosynthesis includes a cotranslational conformational checkpoint and endoplasmic reticulum retention. J. Biol. Chem. 2010, 285, 19854–19864. [Google Scholar] [CrossRef] [Scilit]
  308. Dorwart, M.R.; Shcheynikov, N.; Baker, J.M.R.; Forman-Kay, J.D.; Muallem, S.; Thomas, P.J. Congenital chloride-losing diarrhea causing mutations in the STAS domain result in misfolding and mistrafficking of SLC26A3. J. Biol. Chem. 2008, 283, 8711–8722. [Google Scholar] [CrossRef] [Scilit]
  309. Keller, D.I.; Rougier, J.-S.; Kucera, J.P.; Benammar, N.; Fressart, V.; Guicheney, P.; Madle, A.; Fromer, M.; Schläpfer, J.; Abriel, H. Brugada syndrome and fever: Genetic and molecular characterization of patients carrying SCN5A mutations. Cardiovasc. Res. 2005, 67, 510–519. [Google Scholar] [CrossRef] [Scilit]
  310. Musil, L.S.; Le, A.-C.N.; VanSlyke, J.K.; Roberts, L.M. Regulation of connexin degradation as a mechanism to increase gap junction assembly and function. J. Biol. Chem. 2000, 275, 25207–25215. [Google Scholar] [CrossRef] [Scilit]
  311. Vonk, W.I.M.; de Bie, P.; Wichers, C.G.K.; van den Berghe, P.V.E.; van der Plaats, R.; Berger, R.; Wijmenga, C.; Klomp, L.W.J.; van de Sluis, B. The copper-transporting capacity of ATP7A mutants associated with Menkes disease is ameliorated by COMMD1 as a result of improved protein expression. Cell. Mol. Life Sci. 2012, 69, 149–163. [Google Scholar] [CrossRef] [Scilit]
  312. Nascimento-Ferreira, I.; Santos-Ferreira, T.; Sousa-Ferreira, L.; Auregan, G.; Onofre, I.; Alves, S.; Dufour, N.; Colomer Gould, V.F.; Koeppen, A.; Déglon, N.; et al. Overexpression of the autophagic beclin-1 protein clears mutant ataxin-3 and alleviates Machado-Joseph disease. Brain 2011, 134, 1400–1415. [Google Scholar] [CrossRef] [Scilit]
  313. Grove, D.E.; Fan, C.-Y.; Ren, H.Y.; Cyr, D.M. The endoplasmic reticulum-associated Hsp40 DNAJB12 and Hsc70 cooperate to facilitate RMA1 E3-dependent degradation of nascent CFTRDeltaF508. Mol. Biol. Cell 2011, 22, 301–314. [Google Scholar] [CrossRef] [Scilit]
  314. Rowe, S.M.; McColley, S.A.; Rietschel, E.; Li, X.; Bell, S.C.; Konstan, M.W.; Marigowda, G.; Waltz, D.; Boyle, M.P.; Group, V.-. 809-102 S. Lumacaftor/Ivacaftor treatment of patients with cystic fibrosis heterozygous for F508del-CFTR. Ann. Am. Thorac. Soc. 2017, 14, 213–219. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  315. Gentzsch, M.; Ren, H.Y.; Houck, S.A.; Quinney, N.L.; Cholon, D.M.; Sopha, P.; Chaudhry, I.G.; Das, J.; Dokholyan, N.V.; Randell, S.H.; et al. Restoration of R117H CFTR folding and function in human airway cells through combination treatment with VX-809 and VX-770. Am. J. Physiol. Cell. Mol. Physiol. 2016, 311, L550–L559. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  316. Bagdany, M.; Veit, G.; Fukuda, R.; Avramescu, R.G.; Okiyoneda, T.; Baaklini, I.; Singh, J.; Sovak, G.; Xu, H.; Apaja, P.M.; et al. Chaperones rescue the energetic landscape of mutant CFTR at single molecule and in cell. Nat. Commun. 2017, 8, 398. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  317. Wang, Y.; Bartlett, M.C.; Loo, T.W.; Clarke, D.M. Specific rescue of cystic fibrosis transmembrane conductance regulator processing mutants using pharmacological chaperones. Mol. Pharmacol. 2006, 70, 297–302. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  318. Wellhauser, L.; Chiaw, P.K.; Pasyk, S.; Li, C.; Ramjeesingh, M.; Bear, C.E. A Small-molecule modulator interacts directly with ΔPhe508-CFTR to modify its ATPase activity and conformational stability. Mol. Pharmacol. 2009, 75, 1430–1438. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  319. Taylor-Cousar, J.L.; Munck, A.; McKone, E.F.; van der Ent, C.K.; Moeller, A.; Simard, C.; Wang, L.T.; Ingenito, E.P.; McKee, C.; Lu, Y.; et al. Tezacaftor–Ivacaftor in patients with cystic fibrosis homozygous for Phe508del. N. Engl. J. Med. 2017, 377, 2013–2023. [Google Scholar] [CrossRef] [Scilit]
  320. Jacobs, M.T.; Zhang, Y.-W.; Campbell, S.D.; Rudnick, G. Ibogaine, a noncompetitive inhibitor of serotonin transport, acts by stabilizing the cytoplasm-facing State of the transporter. J. Biol. Chem. 2007, 282, 29441–29447. [Google Scholar] [CrossRef] [Scilit]
  321. Bulling, S.; Schicker, K.; Zhang, Y.-W.; Steinkellner, T.; Stockner, T.; Gruber, C.W.; Boehm, S.; Freissmuth, M.; Rudnick, G.; Sitte, H.H.; et al. The Mechanistic basis for noncompetitive ibogaine inhibition of serotonin and dopamine transporters. J. Biol. Chem. 2012, 287, 18524–18534. [Google Scholar] [CrossRef] [Scilit]
  322. Sucic, S.; Kasture, A.; Mazhar Asjad, H.M.; Kern, C.; El-Kasaby, A.; Freissmuth, M. When transporters fail to be transported: How to rescue folding-deficient SLC6 transporters. J. Neurol. Neuromed. 2016, 1, 34–40. [Google Scholar] [CrossRef] [Scilit]
  323. Houck, S.A.; Ren, H.Y.; Madden, V.J.; Bonner, J.N.; Conlin, M.P.; Janovick, J.A.; Conn, P.M.; Cyr, D.M. Quality control autophagy degrades soluble ERAD-resistant conformers of the misfolded membrane protein GnRHR. Mol. Cell 2014, 54, 166–179. [Google Scholar] [CrossRef] [Scilit]
  324. Leaños-Miranda, A.; Ulloa-Aguirre, A.; Janovick, J.A.; Conn, P.M. In vitro coexpression and pharmacological rescue of mutant gonadotropin-releasing hormone receptors causing hypogonadotropic hypogonadism in humans expressing compound heterozygous alleles. J. Clin. Endocrinol. Metab. 2005, 90, 3001–3008. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  325. Walker, V.E.; Wong, M.J.H.; Atanasiu, R.; Hantouche, C.; Young, J.C.; Shrier, A. Hsp40 chaperones promote degradation of the HERG potassium channel. J. Biol. Chem. 2010, 285, 3319–3329. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  326. Zhou, Z.; Gong, Q.; January, C.T. Correction of defective protein trafficking of a mutant HERG potassium channel in human long QT syndrome: Pharmacological and temperature effects. J. Biol. Chem. 1999, 274, 31123–31126. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  327. Bass, J.; Chiu, G.; Argon, Y.; Steiner, D.F. Folding of insulin receptor monomers is facilitated by the molecular chaperones calnexin and calreticulin and impaired by rapid dimerization. J. Cell Biol. 1998, 141, 637–646. [Google Scholar] [CrossRef] [Scilit]
  328. Huang, H.; Wang, W.; Tao, Y.-X. Pharmacological chaperones for the misfolded melanocortin-4 receptor associated with human obesity. Biochim. Biophys. Acta Mol. Basis Dis. 2017, 1863, 2496–2507. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  329. Tao, Y.-X. The melanocortin-4 receptor: Physiology, pharmacology, and pathophysiology. Endocr. Rev. 2010, 31, 506–543. [Google Scholar] [CrossRef] [Scilit]
  330. Fan, Z.-C.; Tao, Y.-X. Functional characterization and pharmacological rescue of melanocortin-4 receptor mutations identified from obese patients. J. Cell. Mol. Med. 2009, 13, 3268–3282. [Google Scholar] [CrossRef] [Scilit]
  331. Ulbrich, L.; Favaloro, F.L.; Trobiani, L.; Marchetti, V.; Patel, V.; Pascucci, T.; Comoletti, D.; Marciniak, S.J.; De Jaco, A. Autism-associated R451C mutation in neuroligin3 leads to activation of the unfolded protein response in a PC12 Tet-On inducible system. Biochem. J. 2016, 473, 423–434. [Google Scholar] [CrossRef] [Scilit]
  332. Shepshelovich, J.; Goldstein-Magal, L.; Globerson, A.; Yen, P.M.; Rotman-Pikielny, P.; Hirschberg, K. Protein synthesis inhibitors and the chemical chaperone TMAO reverse endoplasmic reticulum perturbation induced by overexpression of the iodide transporter pendrin. J. Cell Sci. 2005, 118, 1577–1586. [Google Scholar] [CrossRef] [Scilit]
  333. Jin, Z.-B.; Mandai, M.; Yokota, T.; Higuchi, K.; Ohmori, K.; Ohtsuki, F.; Takakura, S.; Itabashi, T.; Wada, Y.; Akimoto, M.; et al. Identifying pathogenic genetic background of simplex or multiplex retinitis pigmentosa patients: A large scale mutation screening study. J. Med. Genet. 2008, 45, 465–472. [Google Scholar] [CrossRef] [Scilit]
  334. Jin, T.; Gu, Y.; Zanusso, G.; Sy, M.; Kumar, A.; Cohen, M.; Gambetti, P.; Singh, N. The Chaperone Protein bip binds to a mutant prion protein and mediates its degradation by the proteasome. J. Biol. Chem. 2000, 275, 38699–38704. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  335. Li, T.; Sandberg, M.A.; Pawlyk, B.S.; Rosner, B.; Hayes, K.C.; Dryja, T.P.; Berson, E.L. Effect of vitamin A supplementation on rhodopsin mutants threonine-17 --> methionine and proline-347 --> serine in transgenic mice and in cell cultures. Proc. Natl. Acad. Sci. USA 1998, 95, 11933–11938. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  336. Mattle, D.; Kuhn, B.; Aebi, J.; Bedoucha, M.; Kekilli, D.; Grozinger, N.; Alker, A.; Rudolph, M.G.; Schmid, G.; Schertler, G.F.X.; et al. Ligand channel in pharmacologically stabilized rhodopsin. Proc. Natl. Acad. Sci. USA 2018, 115, 3640–3645. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  337. Vasireddy, V.; Chavali, V.R.M.; Joseph, V.T.; Kadam, R.; Lin, J.H.; Jamison, J.A.; Kompella, U.B.; Reddy, G.B.; Ayyagari, R. Rescue of photoreceptor degeneration by curcumin in transgenic rats with P23H rhodopsin mutation. PLoS ONE 2011, 6, e21193. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  338. Chen, Y.; Chen, Y.; Jastrzebska, B.; Golczak, M.; Gulati, S.; Tang, H.; Seibel, W.; Li, X.; Jin, H.; Han, Y.; et al. A novel small molecule chaperone of rod opsin and its potential therapy for retinal degeneration. Nat. Commun. 2018, 9, 1976. [Google Scholar] [CrossRef] [Scilit]
  339. Chiu, A.M.; Mandziuk, J.J.; Loganathan, S.K.; Alka, K.; Casey, J.R. High throughput assay identifies glafenine as a corrector for the folding defect in corneal dystrophy–causing mutants of SLC4A11. Investig. Ophthalmol. Vis. Sci. 2015, 56, 7739–7753. [Google Scholar] [CrossRef] [Scilit]
  340. Robben, J.H.; Sze, M.; Knoers, N.V.A.M.; Deen, P.M.T. Rescue of vasopressin V2 receptor mutants by chemical chaperones: Specificity and mechanism. Mol. Biol. Cell 2006, 17, 379–386. [Google Scholar] [CrossRef] [Scilit]
Figure 1. Trafficking of membrane proteins. As soon as the new membrane protein (MP) starts translocating to the ER, it will associate with chaperones and other proteins, assisting in getting a structural conformation into the lipid membranes. Well-folded proteins will continue trafficking through the endomembrane system to and from the PM, while misfolded proteins are re-directed to ER protein folding or degradation pathways, reducing their secretion to the extracellular space where they could further misfold or aggregate into proteotoxic conformations.
Figure 1. Trafficking of membrane proteins. As soon as the new membrane protein (MP) starts translocating to the ER, it will associate with chaperones and other proteins, assisting in getting a structural conformation into the lipid membranes. Well-folded proteins will continue trafficking through the endomembrane system to and from the PM, while misfolded proteins are re-directed to ER protein folding or degradation pathways, reducing their secretion to the extracellular space where they could further misfold or aggregate into proteotoxic conformations.
Biomolecules 10 00728 g001
Figure 2. Misfolded membrane protein phenotypes. Simplified scheme of membrane proteins (MP) with folding problems. Normal: As soon as a nascent protein starts being translated at the ribosomes and translocated to the ER, chaperones will assist in folding, and well-folded proteins will travel in lipidic vesicles (MP carrier) from the ER to the Golgi apparatus to reach the plasma membrane, where they undergo a constant recycling cycle. Mislocated: Abnormally folded proteins will selectively be excluded from transport vesicles for accumulation in the lumen of the ER, triggering a heightened state of ER stress; to relax the stressed ER, the proteasomal degradation of proteins will be induced. Protein aggregates can also induce mitochondrial stress, promoting apoptosis. Dysfunctional: Function of misfolded protein reaching the PM can be affected due to protein over- or underexpression; if protein expression seems normal, protein stability in the plasma membrane may be affected, increasing the recycling turnover rate, or function can be atypical (i.e., non-functional or having a differently modulated function).
Figure 2. Misfolded membrane protein phenotypes. Simplified scheme of membrane proteins (MP) with folding problems. Normal: As soon as a nascent protein starts being translated at the ribosomes and translocated to the ER, chaperones will assist in folding, and well-folded proteins will travel in lipidic vesicles (MP carrier) from the ER to the Golgi apparatus to reach the plasma membrane, where they undergo a constant recycling cycle. Mislocated: Abnormally folded proteins will selectively be excluded from transport vesicles for accumulation in the lumen of the ER, triggering a heightened state of ER stress; to relax the stressed ER, the proteasomal degradation of proteins will be induced. Protein aggregates can also induce mitochondrial stress, promoting apoptosis. Dysfunctional: Function of misfolded protein reaching the PM can be affected due to protein over- or underexpression; if protein expression seems normal, protein stability in the plasma membrane may be affected, increasing the recycling turnover rate, or function can be atypical (i.e., non-functional or having a differently modulated function).
Biomolecules 10 00728 g002
Table 1. Signal peptide for protein localization in the endoplasmic reticulum and plasma membrane.
Table 1. Signal peptide for protein localization in the endoplasmic reticulum and plasma membrane.
SequenceProteinLocationOrganismReference
VVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIRE.mTOR.Endoplasmic reticulum.Homo sapiens; Mus musculus; Rattus norvegicus.[39]
HALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT.PTP-1B.Endoplasmic reticulum.Homo sapiens.[40]
MEAMWLLCVALAVLAWG.GlcNAc-PI.Endoplasmic reticulum.Homo sapiens.[41]
IPHDLCHNGEKSKKPSKIKSLFKKKSK.STIM2.Endoplasmic reticulum.Homo sapiens; Mus musculus.[42]
GVMLGSIFCALITMLGHI.Cosmc.Endoplasmic reticulum.Bos taurus; Homo sapiens; Mus musculus; Rattus norvegicus.[43]
MRLLLALLGVLLSVPGPPVLS.FGFR4.Plasma membrane.Homo sapiens.[44]
MDCRKMARFSYSVIWIMAISKVFELGLVAG.TDGF.Plasma membrane.Homo sapiens.[45]
MPAWGALFLLWATAEA.(GP)IX.Plasma membrane.Homo sapiens.[46]
LRCLACSCFRTPVWPR.prRDH.Plasma membrane.Bos taurus.[47]
MGCGCSSHPE.Lck.Plasma membrane.Homo sapiens; Aotus nancymaae.[48,49]
VTNGSTYILVPLSH.FSHR.Plasma membrane.Homo sapiens.[50]
AETENFV.M3 mAChR.Plasma membrane.Homo sapiens; Gorilla gorilla gorilla; Pan troglodytes; Pongo pygmaeus.[51,52]
Table 2. Chaperones used to rescue misfolded plasma membrane proteins related to diseases.
Table 2. Chaperones used to rescue misfolded plasma membrane proteins related to diseases.
Misfolded Membrane ProteinDiseaseGeneRescuing Strategy
Molecular ChaperonesChemical ChaperonesPharmacological Chaperones
α-synucleinParkinson’s diseaseSNCA Hsp70 [223,224,225]
Aquaporin-2Autosomal Nephrogenic Diabetes InsipidusAQP2 Glycerol, Trimethylamine-N-oxide (TMAO) and Dimethyl sulfoxide (DMSO) [2,272,273].
Arginine-Vasopressin (AVP) Receptor 2 (AVPR2)Nephrogenic Syndrome of Inappropriate Antidiuresis and Diabetes Insipidus (nephrogenic, X-Linked)AVPR2 OPC51803, VA999088, and VA999089 [293]. L44P, A294P, and R337X [294].
SR49059, VPA-985, OPC31260, OPC41061 (Tolvaptan) and SR121463B [293,302,303].
MCF14, MCF18, and MCF57 [294,304].
ATP-binding Cassette TransporterTangier diseaseABCA1 Sodium 4-Phenylbutyrate (4-PBA) [305].
Stargardt Eye diseaseABCA4 VX-809 (Lumacaftor) [306].
Bile Salt Export Pump (BSEP)Progressive Familial Intrahepatic Cholestasis type 2 ABCB11 4-PBA mixed with Anticonvulsant-Oxcarbazepine, and Maralixibat [274,275].
Calcium-Sensing Receptor (CaSR)Familial Hypocalciuric HypercalcemiaCaSR MG132, NPS R-568 [295,307].
Cardiac Sodium (Na+) Channel NaV1.5Brugada Syndrome
Nocturnal Death syndrome
SCN5A Curcumin [308].Mexiletine [309].
Connexin Cx31, Cx43, Cx50Charcot-Marie-Tooth syndromeGJA1 Cycloheximide [310].
Copper-transporting P-type ATPase Menkes diseaseATP7A Excess of copper [311].Copper Toxicosis Protein COMMD1 [311].
Cyclic Nucleotide Gated (CNG) Channel Retinitis Pigmentosa, AchromatopsiaCNGA3 TUDCA (Tauroursodeoxycholate Sodium salt), 4-PBA [278].
Glycerol [312].
MTSHB (Hydroxybenzyl-Methanethiosulfonate), MTSEA (Aminoethyl-Methanethiosulfonate) [123].
CPT-cGMP [8-(chlorophenylthio)-cGMP] [278].
Cystic Fibrosis Transmembrane Conductance Regulator (CFTR)Cystic FibrosisCFTRHsc70, Hsp90 [313]. Hsc70/Hdj-2 [218].Glycerol [98]. TMAO [269].
4-PBA [276,277].
VX-809 (Lumacaftor) [269].
Lumacaftor/Ivacaftor [314,315].
Cycloheximide [316].
Corr-4a and VRT-532 [317,318].
VX-661(Tezacaftor)/Ivacaftor [319].
Dopamine Transporter (DAT)Infantile parkinsonism-dystoniaSLC6A3 Ibogaine, Noribogaine [320,321,322].
Gonadotropin Releasing Hormone Receptor (GnRHR)Hypogonadotropic hypogonadismGNRHRJB12, Hsp70 [323]. IN3 [324].
HERG potassium channelHereditary long QT syndromeKCNH2sp40/DnaJ [325]. E-4031 [289,326].
Cisapride [291].
Thapsigargin [290].
Insulin receptorDiabetes Mellitus, Insulin-resistant syndromeINSRCalnexin and Calreticulin [327].
Melanocortin-4 receptor (MC4R) Severe early-onset morbid obesity MC4R Ipsen 17 [288,328].
ML00253764, Ipsen 5i [328,329,330].
Voltage-gated potassium channel (VGKC)Autosomal Dominant Deafness type 2AKCNQ4Hsp90β [241].
Neuroligin-3X-linked autism, Asperger syndromeNLGN3Calnexin [331].
PendrinPendred syndrome and Non-syndromic
Hearing loss
SLC26A4 (PDS) TMAO [332].Cycloheximide (CHX), Puromycin [332].
Prion Protein (PrP)Genetic Creutzfeldt-Jakob disease, Gerstmann Straussler Scheinker syndome and Fatal Familial InsomniaPRNPBiP [333], [334].
RhodopsinRetinitis PigmentosaRHO1-cis retinal [335].DMSO [336].
Curcumin [337].
YC-001 [338].
S-RS1 [336].
Sodium-borate cotransporterCorneal dystrophySLC4A11 Anti-inflammatory drugs (NSAIDs), Glafenine, Ibuprofen, and Acetylsalicylic acid dissolved in DMSO [339].
Vasopressin Type 2 Receptor (V2R) Nephrogenic Diabetes InsipidusV2R Glycerol, DMSO and TMAO [272,273].SR49059 [197,286,287].
Thapsigargin/Curcumin and Ionomycin [340].
Voltage sensitive potassium channel (Kv1.5)Atrial FibrillationKCNA5
Hsp70 [215].

Share and Cite

MDPI and ACS Style

Juarez-Navarro, K.; Ayala-Garcia, V.M.; Ruiz-Baca, E.; Meneses-Morales, I.; Rios-Banuelos, J.L.; Lopez-Rodriguez, A. Assistance for Folding of Disease-Causing Plasma Membrane Proteins. Biomolecules 2020, 10, 728. https://doi.org/10.3390/biom10050728

AMA Style

Juarez-Navarro K, Ayala-Garcia VM, Ruiz-Baca E, Meneses-Morales I, Rios-Banuelos JL, Lopez-Rodriguez A. Assistance for Folding of Disease-Causing Plasma Membrane Proteins. Biomolecules. 2020; 10(5):728. https://doi.org/10.3390/biom10050728

Chicago/Turabian Style

Juarez-Navarro, Karina, Victor M. Ayala-Garcia, Estela Ruiz-Baca, Ivan Meneses-Morales, Jose Luis Rios-Banuelos, and Angelica Lopez-Rodriguez. 2020. "Assistance for Folding of Disease-Causing Plasma Membrane Proteins" Biomolecules 10, no. 5: 728. https://doi.org/10.3390/biom10050728

APA Style

Juarez-Navarro, K., Ayala-Garcia, V. M., Ruiz-Baca, E., Meneses-Morales, I., Rios-Banuelos, J. L., & Lopez-Rodriguez, A. (2020). Assistance for Folding of Disease-Causing Plasma Membrane Proteins. Biomolecules, 10(5), 728. https://doi.org/10.3390/biom10050728

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop