The Role of Amphibian AMPs Against Oxidative Stress and Related Diseases
Abstract
1. Introduction
2. AMPs from Amphibians with Antioxidant Properties
2.1. Antioxidin Family
2.2. Pleurain Family
2.3. Cathelicidin Family
2.4. Spinosan Family
2.5. Jindongenin and Palustrin Families
2.6. Taipehensin Family
2.7. Brevinin Family
2.8. Nigroain Family
2.9. Andersonin Family
2.10. Odorranain Family
2.11. Hainanenin Family
2.12. FW Family
2.13. OM Family
2.14. OA Family
2.15. Temporin Family
2.16. Daiyunin and Pleskein Families
2.17. Jindongenin Family
2.18. Tryptophilins Family
2.19. Other AOPs from Amphibians
3. Amphibian AOPs and Oxidative Stress-Related Diseases
4. Future Prospects
5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Marenah, L.; Flatt, P.R.; Orr, D.F.; Shaw, C.; Abdel-Wahab, Y.H.A. Skin Secretions of Rana saharica Frogs Reveal Antimicrobial Peptides Esculentins-1 and -1B and Brevinins-1E and -2EC with Novel Insulin Releasing Activity. J. Endocrinol. 2006, 188, 1–9. [Google Scholar] [CrossRef] [PubMed]
- Arcanjo, D.D.R.; Vasconcelos, A.G.; Comerma-Steffensen, S.G.; Jesus, J.R.; Silva, L.P.; Pires, O.R.; Costa-Neto, C.M.; Oliveira, E.B.; Migliolo, L.; Franco, O.L.; et al. A Novel Vasoactive Proline-Rich Oligopeptide from the Skin Secretion of the Frog Brachycephalus ephippium. PLoS ONE 2015, 10, e0145071. [Google Scholar] [CrossRef] [PubMed]
- Wang, X.; Song, Y.; Li, J.; Liu, H.; Xu, X.; Lai, R.; Zhang, K. A New Family of Antimicrobial Peptides from Skin Secretions of Rana pleuraden. Peptides 2007, 28, 2069–2074. [Google Scholar] [CrossRef]
- Feng, G.; Wu, J.; Yang, H.-L.; Mu, L. Discovery of Antioxidant Peptides from Amphibians: A Review. Protein Pept. Lett. 2021, 28, 1220–1229. [Google Scholar] [CrossRef]
- Kirk, J.T.O. Light and Photosynthesis in Aquatic Ecosystems; Cambridge University Press: Cambridge, UK, 2010; ISBN 9780521151757. [Google Scholar] [CrossRef]
- Clarke, B.T. The Natural History Of Amphibian Skin Secretions, Their Normal Functioning And Potential Medical Applications. Biol. Rev. 1997, 72, 365–379. [Google Scholar] [CrossRef]
- Geihs, M.A.; Moreira, D.C.; López-Martínez, G.; Minari, M.; Ferreira-Cravo, M.; Carvajalino-Fernández, J.M.; Hermes-Lima, M. Commentary: Ultraviolet Radiation Triggers “Preparation for Oxidative Stress” Antioxidant Response in Animals: Similarities and Interplay with Other Stressors. Comp. Biochem. Physiol. A Mol. Integr. Physiol. 2020, 239, 110585. [Google Scholar] [CrossRef]
- Yang, H.; Wang, X.; Liu, X.; Wu, J.; Liu, C.; Gong, W.; Zhao, Z.; Hong, J.; Lin, D.; Wang, Y.; et al. Antioxidant Peptidomics Reveals Novel Skin Antioxidant System. Mol. Cell. Proteom. 2009, 8, 571–583. [Google Scholar] [CrossRef]
- Chevion, S.; Berry, E.M.; Kitrossky, N.; Kohen, R. Evaluation of Plasma Low Molecular Weight Antioxidant Capacity by Cyclic Voltammetry. Free Radic. Biol. Med. 1997, 22, 411–421. [Google Scholar] [CrossRef]
- Shindo, Y.; Witt, E.; Packer, L. Antioxidant Defense Mechanisms in Murine Epidermis and Dermis and Their Responses to Ultraviolet Light. J. Investig. Dermatol. 1993, 100, 260–265. [Google Scholar] [CrossRef]
- Yin, S.; Wang, Y.; Liu, N.; Yang, M.; Hu, Y.; Li, X.; Fu, Y.; Luo, M.; Sun, J.; Yang, X. Potential Skin Protective Effects after UVB Irradiation Afforded by an Antioxidant Peptide from Odorrana andersonii. Biomed. Pharmacother. 2019, 120, 109535. [Google Scholar] [CrossRef]
- Zhu, Y.; Wang, K.; Jia, X.; Fu, C.; Yu, H.; Wang, Y. Antioxidant Peptides, the Guardian of Life from Oxidative Stress. Med. Res. Rev. 2024, 44, 275–364. [Google Scholar] [CrossRef] [PubMed]
- Xie, H.; Hou, S.; Jiang, J.; Sekutowicz, M.; Kelly, J.; Bacskai, B.J. Rapid Cell Death Is Preceded by Amyloid Plaque-Mediated Oxidative Stress. Proc. Natl. Acad. Sci. USA 2013, 110, 7904–7909. [Google Scholar] [CrossRef] [PubMed]
- Van der Vliet, A.; Janssen-Heininger, Y.M.W. Hydrogen Peroxide as a Damage Signal in Tissue Injury and Inflammation: Murderer, Mediator, or Messenger? J. Cell Biochem. 2014, 115, 427–435. [Google Scholar] [CrossRef] [PubMed]
- Di Meo, S.; Reed, T.T.; Venditti, P.; Victor, V.M. Role of ROS and RNS Sources in Physiological and Pathological Conditions. Oxid. Med. Cell Longev. 2016, 2016, 1245049. [Google Scholar] [CrossRef]
- Nieborowska-Skorska, M.; Kopinski, P.K.; Ray, R.; Hoser, G.; Ngaba, D.; Flis, S.; Cramer, K.; Reddy, M.M.; Koptyra, M.; Penserga, T.; et al. Rac2-MRC-CIII–Generated ROS Cause Genomic Instability in Chronic Myeloid Leukemia Stem Cells and Primitive Progenitors. Blood 2012, 119, 4253–4263. [Google Scholar] [CrossRef]
- Radisky, D.C.; Levy, D.D.; Littlepage, L.E.; Liu, H.; Nelson, C.M.; Fata, J.E.; Leake, D.; Godden, E.L.; Albertson, D.G.; Nieto, M.A.; et al. Rac1b and Reactive Oxygen Species Mediate MMP-3-Induced EMT and Genomic Instability. Nature 2005, 436, 123–127. [Google Scholar] [CrossRef]
- Deng, L.; Du, C.; Song, P.; Chen, T.; Rui, S.; Armstrong, D.G.; Deng, W. The Role of Oxidative Stress and Antioxidants in Diabetic Wound Healing. Oxid. Med. Cell Longev. 2021, 2021, 8852759. [Google Scholar] [CrossRef]
- Senoner, T.; Dichtl, W. Oxidative Stress in Cardiovascular Diseases: Still a Therapeutic Target? Nutrients 2019, 11, 2090. [Google Scholar] [CrossRef]
- Bourdon, E.; Blache, D. The Importance of Proteins in Defense Against Oxidation. Antioxid. Redox Signal 2001, 3, 293–311. [Google Scholar] [CrossRef]
- Hardas, S.S.; Sultana, R.; Clark, A.M.; Beckett, T.L.; Szweda, L.I.; Paul Murphy, M.; Butterfield, D.A. Oxidative Modification of Lipoic Acid by HNE in Alzheimer Disease Brain. Redox Biol. 2013, 1, 80–85. [Google Scholar] [CrossRef]
- Hou, L.; Zhou, X.; Zhang, C.; Wang, K.; Liu, X.; Che, Y.; Sun, F.; Li, H.; Wang, Q.; Zhang, D.; et al. NADPH Oxidase-Derived H2O2 Mediates the Regulatory Effects of Microglia on Astrogliosis in Experimental Models of Parkinson’s Disease. Redox Biol. 2017, 12, 162–170. [Google Scholar] [CrossRef] [PubMed]
- Berggren, K.L.; Chen, J.; Fox, J.; Miller, J.; Dodds, L.; Dugas, B.; Vargas, L.; Lothian, A.; McAllum, E.; Volitakis, I.; et al. Neonatal Iron Supplementation Potentiates Oxidative Stress, Energetic Dysfunction and Neurodegeneration in the R6/2 Mouse Model of Huntington’s Disease. Redox Biol. 2015, 4, 363–374. [Google Scholar] [CrossRef] [PubMed]
- Martins, D.; English, A.M. SOD1 Oxidation and Formation of Soluble Aggregates in Yeast: Relevance to Sporadic ALS Development. Redox Biol. 2014, 2, 632–639. [Google Scholar] [CrossRef] [PubMed]
- Dimri, G.P.; Leet, X.; Basile, G.; Acosta, M.; Scorrt, G.; Roskelley, C.; Medrano, E.E.; Linskensi, M.; Rubeljii, I.; Pereira-Smithii, O.; et al. A Biomarker That Identifies Senescent Human Cells in Culture and in Aging Skin in Vivo. Proc. Natl. Acad. Sci. USA 1995, 92, 9363–9367. [Google Scholar] [CrossRef] [PubMed]
- Millis, A.J.; Hoyle, M.; McCue, H.M.; Martini, H. Differential Expression of Metalloproteinase and Tissue Inhibitor of Metalloproteinase Genes in Aged Human Fibroblasts. Exp. Cell Res. 1992, 201, 373–379. [Google Scholar] [CrossRef]
- Gu, Y.; Han, J.; Jiang, C.; Zhang, Y. Biomarkers, Oxidative Stress and Autophagy in Skin Aging. Ageing Res. Rev. 2020, 59, 101036. [Google Scholar] [CrossRef]
- Mookherjee, N.; Anderson, M.A.; Haagsman, H.P.; Davidson, D.J. Antimicrobial Host Defence Peptides: Functions and Clinical Potential. Nat. Rev. Drug Discov. 2020, 19, 311–332. [Google Scholar] [CrossRef]
- Wang, J.; Dou, X.; Song, J.; Lyu, Y.; Zhu, X.; Xu, L.; Li, W.; Shan, A. Antimicrobial Peptides: Promising Alternatives in the Post Feeding Antibiotic Era. Med. Res. Rev. 2019, 39, 831–859. [Google Scholar] [CrossRef]
- Xu, X.; Lai, R. The Chemistry and Biological Activities of Peptides from Amphibian Skin Secretions. Chem. Rev. 2015, 115, 1760–1846. [Google Scholar] [CrossRef]
- Zhang, X.; Feng, C.; Wang, S.; Wang, Y.; Fu, Z.; Zhang, Y.; Sun, H.; Xie, C.; Fu, Y.; Tao, J.; et al. A Novel Amphibian-Derived Peptide Alleviated Ultraviolet B-Induced Photodamage in Mice. Biomed. Pharmacother. 2021, 136, 111258. [Google Scholar] [CrossRef]
- Guo, C.; Hu, Y.; Li, J.; Liu, Y.; Li, S.; Yan, K.; Wang, X.; Liu, J.; Wang, H. Identification of Multiple Peptides with Antioxidant and Antimicrobial Activities from Skin and Its Secretions of Hylarana taipehensis, Amolops lifanensis, and Amolops granulosus. Biochimie 2014, 105, 192–201. [Google Scholar] [CrossRef]
- Lu, Z.; Zhai, L.; Wang, H.; Che, Q.; Wang, D.; Feng, F.; Zhao, Z.; Yu, H. Novel Families of Antimicrobial Peptides with Multiple Functions from Skin of Xizang Plateau Frog, Nanorana parkeri. Biochimie 2010, 92, 475–481. [Google Scholar] [CrossRef] [PubMed]
- Chen, Z.; Yang, X.; Liu, Z.; Zeng, L.; Lee, W.; Zhang, Y. Two Novel Families of Antimicrobial Peptides from Skin Secretions of the Chinese Torrent Frog, Amolops jingdongensis. Biochimie 2012, 94, 328–334. [Google Scholar] [CrossRef] [PubMed]
- Feng, G.; Wei, L.; Che, H.; Shen, Y.; Yang, J.; Mi, K.; Liu, J.; Wu, J.; Yang, H.; Mu, L. A Frog Peptide Ameliorates Skin Photoaging Through Scavenging Reactive Oxygen Species. Front. Pharmacol. 2022, 12, 761011. [Google Scholar] [CrossRef] [PubMed]
- Sousa, N.A.; Oliveira, G.A.L.; de Oliveira, A.P.; Lopes, A.L.F.; Iles, B.; Nogueira, K.M.; Araújo, T.S.L.; Souza, L.K.M.; Araújo, A.R.; Ramos-Jesus, J.; et al. Novel Ocellatin Peptides Mitigate LPS-Induced ROS Formation and NF-KB Activation in Microglia and Hippocampal Neurons. Sci. Rep. 2020, 10, 2696. [Google Scholar] [CrossRef]
- Rong, M.; Liu, J.; Liao, Q.; Lin, Z.; Wen, B.; Ren, Y.; Lai, R. The Defensive System of Tree Frog Skin Identified by Peptidomics and RNA Sequencing Analysis. Amino Acids 2019, 51, 345–353. [Google Scholar] [CrossRef]
- Magalhães, L.M.; Segundo, M.A.; Reis, S.; Lima, J.L.F.C. Methodological Aspects about in Vitro Evaluation of Antioxidant Properties. Anal. Chim. Acta 2008, 613, 1–19. [Google Scholar] [CrossRef]
- Jung, H.A.; Jeong, D.-M.; Chung, H.Y.; Lim, H.A.; Kim, J.Y.; Yoon, N.Y.; Choi, J.S. Re-Evaluation of the Antioxidant Prenylated Flavonoids from the Roots of Sophora flavescens. Biol. Pharm. Bull. 2008, 31, 908–915. [Google Scholar] [CrossRef]
- Xu, X.; Yang, H.; Ma, D.; Wu, J.; Wang, Y.; Song, Y.; Wang, X.; Lu, Y.; Yang, J.; Lai, R. Toward an Understanding of the Molecular Mechanism for Successful Blood Feeding by Coupling Proteomics Analysis with Pharmacological Testing of Horsefly Salivary Glands. Mol. Cell. Proteom. 2008, 7, 582–590. [Google Scholar] [CrossRef]
- Peskin, A.V.; Winterbourn, C.C. Assay of Superoxide Dismutase Activity in a Plate Assay Using WST-1. Free Radic. Biol. Med. 2017, 103, 188–191. [Google Scholar] [CrossRef]
- Qin, D.; Lee, W.H.; Gao, Z.; Zhang, W.; Peng, M.; Sun, T.; Gao, Y. Protective Effects of Antioxidin-RL from Odorrana livida against Ultraviolet B-Irradiated Skin Photoaging. Peptides 2018, 101, 124–134. [Google Scholar] [CrossRef] [PubMed]
- Liu, H.; Guo, X.; Yi, T.; Zhu, Y.; Ren, X.; Guo, R.; Dai, Y.; Liang, S. Frog Skin Derived Peptides With Potential Protective Effects on Ultraviolet B–Induced Cutaneous Photodamage. Front. Immunol. 2021, 12, 613365. [Google Scholar] [CrossRef] [PubMed]
- Radak, Z.; Zhao, Z.; Goto, S.; Koltai, E. Age-Associated Neurodegeneration and Oxidative Damage to Lipids, Proteins and DNA. Mol. Aspects Med. 2011, 32, 305–315. [Google Scholar] [CrossRef]
- Pisoschi, A.M.; Pop, A.; Cimpeanu, C.; Predoi, G. Antioxidant Capacity Determination in Plants and Plant-Derived Products: A Review. Oxid. Med. Cell Longev. 2016, 2016, 9130976. [Google Scholar] [CrossRef]
- Yu, H.; Qiao, X.; Gao, J.; Wang, C.; Cai, S.; Feng, L.; Wang, H.; Wang, Y.-P. Identification and Characterization of Novel Antioxidant Peptides Involved in Redox Homeostasis of Frog: Limnonectes fragilis. Protein Pept. Lett. 2015, 22, 776–784. [Google Scholar] [CrossRef]
- Qian, Z.J.; Jung, W.K.; Kim, S.K. Free Radical Scavenging Activity of a Novel Antioxidative Peptide Purified from Hydrolysate of Bullfrog Skin, Rana catesbeiana Shaw. Bioresour. Technol. 2008, 99, 1690–1698. [Google Scholar] [CrossRef]
- Barbosa, E.A.; Plácido, A.; Moreira, D.C.; Albuquerque, L.; Dematei, A.; Silva-Carvalho, A.; Cabral, W.F.; Báo, S.N.; Saldanha-Araújo, F.; Kuckelhaus, S.A.S.; et al. The Peptide Secreted at the Water to Land Transition in a Model Amphibian Has Antioxidant Effects. Proc. Biol. Sci. 2021, 288, 20211531. [Google Scholar] [CrossRef]
- Barbosa, E.A.; Oliveira, A.; Plácido, A.; Socodato, R.; Portugal, C.C.; Mafud, A.C.; Ombredane, A.S.; Moreira, D.C.; Vale, N.; Bessa, L.J.; et al. Structure and Function of a Novel Antioxidant Peptide from the Skin of Tropical Frogs. Free Radic. Biol. Med. 2018, 115, 68–79. [Google Scholar] [CrossRef]
- Åkerström, B.; Maghzal, G.J.; Winterbourn, C.C.; Kettle, A.J. The Lipocalin A1-Microglobulin Has Radical Scavenging Activity. J. Biol. Chem. 2007, 282, 31493–31503. [Google Scholar] [CrossRef]
- Von Heijne, G. Membrane Proteins: From Sequence To Structure. Annu. Rev. Biophys. Biomol. Struct. 1994, 23, 167–192. [Google Scholar] [CrossRef]
- Mosmann, T. Rapid Colorimetric Assay for Cellular Growth and Survival: Application to Proliferation and Cytotoxicity Assays. J. Immunol. Methods 1983, 65, 55–63. [Google Scholar] [CrossRef] [PubMed]
- Wen, C.; Zhang, J.; Zhang, H.; Duan, Y.; Ma, H. Plant Protein-Derived Antioxidant Peptides: Isolation, Identification, Mechanism of Action and Application in Food Systems: A Review. Trends Food Sci. Technol. 2020, 105, 308–322. [Google Scholar] [CrossRef]
- López-García, G.; Dublan-García, O.; Arizmendi-Cotero, D.; Gómez Oliván, L.M. Antioxidant and Antimicrobial Peptides Derived from Food Proteins. Molecules 2022, 27, 1343. [Google Scholar] [CrossRef]
- Zhang, S.; Guo, H.; Shi, F.; Wang, H.; Li, L.; Jiao, X.; Wang, Y.; Yu, H. Hainanenins: A Novel Family of Antimicrobial Peptides with Strong Activity from Hainan Cascade-Frog, Amolops hainanensis. Peptides 2012, 33, 251–257. [Google Scholar] [CrossRef]
- Yang, X.; Wang, Y.; Zhang, Y.; Lee, W.H.; Zhang, Y. Rich Diversity and Potency of Skin Antioxidant Peptides Revealed a Novel Molecular Basis for High-Altitude Adaptation of Amphibians. Sci. Rep. 2016, 6, 19866. [Google Scholar] [CrossRef]
- Brand-Williams, W.; Cuvelier, M.E.; Berset, C. Use of a Free Radical Method to Evaluate Antioxidant Activity. LWT Food Sci. Technol. 1995, 28, 25–30. [Google Scholar] [CrossRef]
- He, W.; Feng, F.; Huang, Y.; Guo, H.; Zhang, S.; Li, Z.; Liu, J.; Wang, Y.; Yu, H. Host Defense Peptides in Skin Secretions of Odorrana tiannanensis: Proof for Other Survival Strategy of the Frog than Merely Anti-Microbial. Biochimie 2012, 94, 649–655. [Google Scholar] [CrossRef]
- Yang, X.; Lee, W.H.; Zhang, Y. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs. J. Proteome Res. 2012, 11, 306–319. [Google Scholar] [CrossRef]
- Chen, T.; Orr, D.F.; O’Rourke, M.; McLynn, C.; Bjourson, A.J.; McClean, S.; Hirst, D.; Rao, P.; Shaw, C. Pachymedusa dacnicolor Tryptophyllin-1: Structural Characterization, Pharmacological Activity and Cloning of Precursor cDNA. Regul. Pept. 2004, 117, 25–32. [Google Scholar] [CrossRef]
- Ellis-Steinborner, S.T.; Scanlon, D.; Musgrave, I.F.; Tran, T.T.N.; Hack, S.; Wang, T.; Abell, A.D.; Tyler, M.J.; Bowie, J.H. An Unusual Kynurenine-Containing Opioid Tetrapeptide from the Skin Gland Secretion of the Australian Red Tree Frog Litoria rubella. Sequence Determination by Electrospray Mass Spectrometry. Rapid Commun. Mass Spectrom. 2011, 25, 1735–1740. [Google Scholar] [CrossRef]
- Wang, R.; Chen, T.; Zhou, M.; Wang, L.; Shaw, C. PsT-1: A New Tryptophyllin Peptide from the Skin Secretion of Waxy Monkey Leaf Frog, Phyllomedusa sauvagei. Regul. Pept. 2013, 184, 14–21. [Google Scholar] [CrossRef] [PubMed]
- Zasloff, M. Magainins, a Class of Antimicrobial Peptides from Xenopus skin: Isolation, Characterization of Two Active Forms, and Partial cDNA Sequence of a Precursor. Proc. Natl. Acad. Sci. USA 1987, 84, 5449–5453. [Google Scholar] [CrossRef] [PubMed]
- Liu, C.; Hong, J.; Yang, H.; Wu, J.; Ma, D.; Li, D.; Lin, D.; Lai, R. Frog Skins Keep Redox Homeostasis by Antioxidant Peptides with Rapid Radical Scavenging Ability. Free Radic. Biol. Med. 2010, 48, 1173–1181. [Google Scholar] [CrossRef] [PubMed]
- Song, Y.; Ji, S.; Liu, W.; Yu, X.; Meng, Q.; Lai, R. Different Expression Profiles of Bioactive Peptides in Pelophylax nigromaculatus from Distinct Regions. Biosci. Biotechnol. Biochem. 2013, 77, 1075–1079. [Google Scholar] [CrossRef]
- Zhang, C.; Zhou, Y.; Yang, G.Y.; Li, S. Biomimetic Peptides Protect Cells from Oxidative Stress. Am. J. Transl. Res. 2017, 9, 5518–5527. [Google Scholar] [PubMed]
- Cao, X.; Wang, Y.; Wu, C.; Li, X.; Fu, Z.; Yang, M.; Bian, W.; Wang, S.; Song, Y.; Tang, J.; et al. Cathelicidin-OA1, a Novel Antioxidant Peptide Identified from an Amphibian, Accelerates Skin Wound Healing. Sci. Rep. 2018, 8, 1–15. [Google Scholar] [CrossRef]
- Feng, G.; Wei, L.; Che, H.; Shen, Y.; Mi, K.; Bian, H.; Yang, H.; Wu, J.; Mu, L. Cathelicidin-NV from Nanorana ventripunctata Effectively Protects HaCaT Cells, Ameliorating Ultraviolet B-Induced Skin Photoaging. Peptides 2022, 150, 170712. [Google Scholar] [CrossRef]
- Lu, H.; Chai, J.; Xu, Z.; Wu, J.; He, S.; Liao, H.; Huang, P.; Huang, X.; Chen, X.; Jiang, H.; et al. Cath-KP, a Novel Peptide Derived from Frog Skin, Prevents Oxidative Stress Damage in a Parkinson’s Disease Model. Zool. Res. 2024, 45, 108–124. [Google Scholar] [CrossRef]
- Dong, B.J.; Zhan, Z.G.; Zheng, R.Q.; Chen, W.; Min, J.J. cDNA Cloning and Functional Characterisation of Four Antimicrobial Peptides from Paa spinosa. Z. Naturforsch C J. Biosci. 2015, 70, 251–256. [Google Scholar] [CrossRef]
- Chai, J.; Liu, J.; Tian, M.; Liao, H.; Wu, J.; Xie, J.; Lai, S.; Mo, G.; Chen, X.; Xu, X. Multiple Mechanistic Action of Brevinin-1FL Peptide against Oxidative Stress Effects in an Acute Inflammatory Model of Carrageenan-Induced Damage. Oxid. Med. Cell Longev. 2022, 2022, 1–21. [Google Scholar] [CrossRef]
- Wang, X.; Ren, S.; Guo, C.; Zhang, W.; Zhang, X.; Zhang, B.; Li, S.; Ren, J.; Hu, Y.; Wang, H. Identification and Functional Analyses of Novel Antioxidant Peptides and Antimicrobial Peptides from Skin Secretions of Four East Asian Frog Species. Acta Biochim. Biophys. Sin. 2017, 49, 550–559. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Cao, X.; Fu, Z.; Wang, S.; Li, X.; Liu, N.; Feng, Z.; Yang, M.; Tang, J.; Yang, X. Identification and Characterization of a Novel Gene-Encoded Antioxidant Peptide Obtained from Amphibian Skin Secretions. Nat. Prod. Res. 2020, 34, 754–758. [Google Scholar] [CrossRef] [PubMed]
- Li, X.; Wang, Y.; Zou, Z.; Yang, M.; Wu, C.; Su, Y.; Tang, J.; Yang, X. OM-LV20, a Novel Peptide from Odorous Frog Skin, Accelerates Wound Healing in Vitro and in Vivo. Chem. Biol. Drug Des. 2018, 91, 126–136. [Google Scholar] [CrossRef] [PubMed]
- Bian, W.; Meng, B.; Li, X.; Wang, S.; Cao, X.; Liu, N.; Yang, M.; Tang, J.; Wang, Y.; Yang, X. OA-GL21, a Novel Bioactive Peptide from Odorrana andersonii, Accelerated the Healing of Skin Wounds. Biosci. Rep. 2018, 38, BSR20180215. [Google Scholar] [CrossRef] [PubMed]
- Plácido, A.; do Pais do Amaral, C.; Teixeira, C.; Nogueira, A.; Brango-Vanegas, J.; Alves Barbosa, E.; Moreira, D.C.; Silva-Carvalho, A.; da Silva, M.D.G.; do Nascimento Dias, J.; et al. Neuroprotective Effects on Microglia and Insights into the Structure–Activity Relationship of an Antioxidant Peptide Isolated from Pelophylax perezi. J. Cell Mol. Med. 2022, 26, 2793–2807. [Google Scholar] [CrossRef]
- Xie, C.; Fan, Y.; Yin, S.; Li, Y.; Liu, N.; Liu, Y.; Shu, L.; Fu, Z.; Wang, Y.; Zhang, Y.; et al. Novel Amphibian-Derived Antioxidant Peptide Protects Skin against Ultraviolet Irradiation Damage. J. Photochem. Photobiol. B 2021, 224, 112327. [Google Scholar] [CrossRef]
- Je, J.Y.; Qian, Z.J.; Kim, S.K. Antioxidant Peptide Isolated from Muscle Protein of Bullfrog, Rana catesbeiana Shaw. J. Med. Food 2007, 10, 401–407. [Google Scholar] [CrossRef]
- Plácido, A.; Bueno, J.; Barbosa, E.A.; Moreira, D.C.; Dias, J.D.N.; Cabral, W.F.; Albuquerque, P.; Bessa, L.J.; Freitas, J.; Kuckelhaus, S.A.S.; et al. The Antioxidant Peptide Salamandrin-i: First Bioactive Peptide Identified from Skin Secretion of Salamandra Genus (Salamandra Salamandra). Biomolecules 2020, 10, 512. [Google Scholar] [CrossRef]
- Sanchis, I.; Spinelli, R.; Aschemacher, N.; Siano, A.S. Rational Design and Synthesis of Modified Natural Peptides from Boana pulchella (Anura) as Acetylcholinesterase Inhibitors and Antioxidants. Amino Acids 2022, 54, 181–192. [Google Scholar] [CrossRef]
- Gu, M.; Ren, J.; Sun, W.; You, L.; Yang, B.; Zhao, M. Isolation and Identification of Antioxidative Peptides from Frog (Hylarana guentheri) Protein Hydrolysate by Consecutive Chromatography and Electrospray Ionization Mass Spectrometry. Appl. Biochem. Biotechnol. 2014, 173, 1169–1182. [Google Scholar] [CrossRef]
- Krishnan, N.; Dickman, M.B.; Becker, D.F. Proline Modulates the Intracellular Redox Environment and Protects Mammalian Cells against Oxidative Stress. Free Radic. Biol. Med. 2008, 44, 671–681. [Google Scholar] [CrossRef] [PubMed]
- Kościuczuk, E.M.; Lisowski, P.; Jarczak, J.; Strzałkowska, N.; Jóźwik, A.; Horbańczuk, J.; Krzyżewski, J.; Zwierzchowski, L.; Bagnicka, E. Cathelicidins: Family of Antimicrobial Peptides. A Review. Mol. Biol. Rep. 2012, 39, 10957–10970. [Google Scholar] [CrossRef] [PubMed]
- Mu, L.; Tang, J.; Liu, H.; Shen, C.; Rong, M.; Zhang, Z.; Lai, R. A Potential Wound-Healing-Promoting Peptide from Salamander Skin. FASEB J. 2014, 28, 3919–3929. [Google Scholar] [CrossRef] [PubMed]
- Ge, L.; Lyu, P.; Zhou, M.; Zhang, H.; Wan, Y.; Li, B.; Li, R.; Wang, L.; Chen, T.; Shaw, C. AcT-2: A Novel Myotropic and Antimicrobial Type 2 Tryptophyllin from the Skin Secretion of the Central American Red-Eyed Leaf Frog, Agalychnis callidryas. Sci. World J. 2014, 2014, 158546. [Google Scholar] [CrossRef]
- Feng, L.; Shi, N.; Cai, S.; Qiao, X.; Chu, P.; Wang, H.; Long, F.; Yang, H.; Yang, Y.; Wang, Y.; et al. De Novo Molecular Design of a Novel Octapeptide That Inhibits in Vivo Melanogenesis and Has Great Transdermal Ability. J. Med. Chem. 2018, 61, 6846–6857. [Google Scholar] [CrossRef]
- Tossi, A.; Sandri, L.; Giangaspero, A. Amphipathic, α-Helical Antimicrobial Peptides. Biopolymers 2000, 55, 4–30. [Google Scholar] [CrossRef]
- Chaudhary, M.R.; Chaudhary, S.; Sharma, Y.; Singh, T.A.; Mishra, A.K.; Sharma, S.; Mehdi, M.M. Aging, Oxidative Stress and Degenerative Diseases: Mechanisms, Complications and Emerging Therapeutic Strategies. Biogerontology 2023, 24, 609–662. [Google Scholar] [CrossRef]
- Schieber, M.; Chandel, N.S. ROS Function in Redox Signaling and Oxidative Stress. Curr. Biol. 2014, 24, R453–R462. [Google Scholar] [CrossRef]
- Kowalczyk, P.; Sulejczak, D.; Kleczkowska, P.; Bukowska-Ośko, I.; Kucia, M.; Popiel, M.; Wietrak, E.; Kramkowski, K.; Wrzosek, K.; Kaczyńska, K. Mitochondrial Oxidative Stress—A Causative Factor and Therapeutic Target in Many Diseases. Int. J. Mol. Sci. 2021, 22, 13384. [Google Scholar] [CrossRef]
- Bai, R.; Guo, J.; Ye, X.Y.; Xie, Y.; Xie, T. Oxidative Stress: The Core Pathogenesis and Mechanism of Alzheimer’s Disease. Ageing Res. Rev. 2022, 77, 101619. [Google Scholar] [CrossRef]
- Arfin, S.; Jha, N.K.; Jha, S.K.; Kesari, K.K.; Ruokolainen, J.; Roychoudhury, S.; Rathi, B.; Kumar, D. Oxidative Stress in Cancer Cell Metabolism. Antioxidants 2021, 10, 642. [Google Scholar] [CrossRef] [PubMed]
- Dhapola, R.; Beura, S.K.; Sharma, P.; Singh, S.K.; HariKrishnaReddy, D. Oxidative Stress in Alzheimer’s Disease: Current Knowledge of Signaling Pathways and Therapeutics. Mol. Biol. Rep. 2024, 51, 48. [Google Scholar] [CrossRef] [PubMed]
- Gao, C.; Jiang, J.; Tan, Y.; Chen, S. Microglia in Neurodegenerative Diseases: Mechanism and Potential Therapeutic Targets. Signal Transduct. Target. Ther. 2023, 8, 359. [Google Scholar] [CrossRef]
- Dash, U.C.; Bhol, N.K.; Swain, S.K.; Samal, R.R.; Nayak, P.K.; Raina, V.; Panda, S.K.; Kerry, R.G.; Duttaroy, A.K.; Jena, A.B. Oxidative Stress and Inflammation in the Pathogenesis of Neurological Disorders: Mechanisms and Implications. Acta Pharm. Sin. B 2024, in press. [Google Scholar] [CrossRef]
- Marucci, G.; Buccioni, M.; Ben, D.D.; Lambertucci, C.; Volpini, R.; Amenta, F. Efficacy of Acetylcholinesterase Inhibitors in Alzheimer’s Disease. Neuropharmacology 2021, 190, 108352. [Google Scholar] [CrossRef]
- Spinelli, R.; Aimaretti, F.M.; López, J.A.; Siano, A.S. Amphibian Skin Extracts as Source of Bioactive Multi-Target Agents against Different Pathways of Alzheimer’s Disease. Nat. Prod. Res. 2021, 35, 686–689. [Google Scholar] [CrossRef]
- Spinelli, R.; Humpola, M.V.; Sanchís, I.; de los Angeles Méndez, E.; Siano, A. Biological Characterization of Natural Peptide BcI-1003 from Boana cordobae (Anura): Role in Alzheimer’s Disease and Microbial Infections. Int. J. Pept. Res. Ther. 2023, 29, 6. [Google Scholar] [CrossRef]
- Sanchis, I.; Spinelli, R.; Aschemacher, N.; Humpola, M.V.; Siano, A. Acetylcholinesterase Inhibitory Activity of a Naturally Occurring Peptide Isolated from Boana pulchella (Anura: Hylidae) and Its Analogs. Amino Acids 2020, 52, 387–396. [Google Scholar] [CrossRef]
- Jenner, P.; Olanow, C.W. Oxidative Stress and the Pathogenesis of Parkinson’s Disease. Neurology 1996, 47, S161–S170. [Google Scholar] [CrossRef]
- Dias, V.; Junn, E.; Mouradian, M.M. The Role of Oxidative Stress in Parkinson’s Disease. J. Parkinsons Dis. 2013, 3, 461–491. [Google Scholar] [CrossRef]
- Dorszewska, J.; Kowalska, M.; Prendecki, M.; Piekut, T.; Kozłowska, J.; Kozubski, W. Oxidative Stress Factors in Parkinson’s Disease. Neural Regen. Res. 2021, 16, 1383–1391. [Google Scholar] [CrossRef] [PubMed]
- Orfali, R.; Alwatban, A.Z.; Orfali, R.S.; Lau, L.; Chea, N.; Alotaibi, A.M.; Nam, Y.W.; Zhang, M. Oxidative Stress and Ion Channels in Neurodegenerative Diseases. Front. Physiol. 2024, 15, 1320086. [Google Scholar] [CrossRef]
- Krueger, J.S.; Keshamouni, V.G.; Atanaskova, N.; Reddy, K.B. Temporal and Quantitative Regulation of Mitogen-Activated Protein Kinase (MAPK) Modulates Cell Motility and Invasion. Oncogene 2001, 20, 4209–4218. [Google Scholar] [CrossRef]
- Singh, R.; Letai, A.; Sarosiek, K. Regulation of Apoptosis in Health and Disease: The Balancing Act of BCL-2 Family Proteins. Nat. Rev. Mol. Cell Biol. 2019, 20, 175–193. [Google Scholar] [CrossRef]
- Chen, Q.; Wu, J.; Li, X.; Ye, Z.; Yang, H.; Mu, L. Amphibian-Derived Natural Anticancer Peptides and Proteins: Mechanism of Action, Application Strategies, and Prospects. Int. J. Mol. Sci. 2023, 24, 13985. [Google Scholar] [CrossRef]
- Glorieux, C.; Liu, S.; Trachootham, D.; Huang, P. Targeting ROS in Cancer: Rationale and Strategies. Nat. Rev. Drug Discov. 2024, 23, 583–606. [Google Scholar] [CrossRef]
- Rezatabar, S.; Karimian, A.; Rameshknia, V.; Parsian, H.; Majidinia, M.; Kopi, T.A.; Bishayee, A.; Sadeghinia, A.; Yousefi, M.; Monirialamdari, M.; et al. RAS/MAPK Signaling Functions in Oxidative Stress, DNA Damage Response and Cancer Progression. J. Cell Physiol. 2019, 234, 14951–14965. [Google Scholar] [CrossRef]
- Hayes, J.D.; Dinkova-Kostova, A.T.; Tew, K.D. Oxidative Stress in Cancer. Cancer Cell 2020, 38, 167–197. [Google Scholar] [CrossRef]
- Najafi, M.; Goradel, N.H.; Farhood, B.; Salehi, E.; Solhjoo, S.; Toolee, H.; Kharazinejad, E.; Mortezaee, K. Tumor Microenvironment: Interactions and Therapy. J. Cell Physiol. 2019, 234, 5700–5721. [Google Scholar] [CrossRef]
- Acevedo-León, D.; Monzó-Beltrán, L.; Pérez-Sánchez, L.; Naranjo-Morillo, E.; Gómez-Abril, S.Á.; Estañ-Capell, N.; Bañuls, C.; Sáez, G. Oxidative Stress and DNA Damage Markers in Colorectal Cancer. Int. J. Mol. Sci. 2022, 23, 11664. [Google Scholar] [CrossRef]
- Mahalingaiah, P.K.S.; Singh, K.P. Chronic Oxidative Stress Increases Growth and Tumorigenic Potential of MCF-7 Breast Cancer Cells. PLoS ONE 2014, 9, e87371. [Google Scholar] [CrossRef] [PubMed]
- Luo, M.; Zhou, L.; Huang, Z.; Li, B.; Nice, E.C.; Xu, J.; Huang, C. Antioxidant Therapy in Cancer: Rationale and Progress. Antioxidants 2022, 11, 1128. [Google Scholar] [CrossRef] [PubMed]
- Schalka, S.; Silva, M.S.; Lopes, L.F.; de Freitas, L.M.; Baptista, M.S. The Skin Redoxome. J. Eur. Acad. Dermatol. Venereol. 2022, 36, 181–195. [Google Scholar] [CrossRef] [PubMed]
- Emanuelli, M.; Sartini, D.; Molinelli, E.; Campagna, R.; Pozzi, V.; Salvolini, E.; Simonetti, O.; Campanati, A.; Offidani, A. The Double-Edged Sword of Oxidative Stress in Skin Damage and Melanoma: From Physiopathology to Therapeutical Approaches. Antioxidants 2022, 11, 612. [Google Scholar] [CrossRef]
- Tang, X.; Yang, T.; Yu, D.; Xiong, H.; Zhang, S. Current Insights and Future Perspectives of Ultraviolet Radiation (UV) Exposure: Friends and Foes to the Skin and beyond the Skin. Environ. Int. 2024, 185, 108535. [Google Scholar] [CrossRef]
- Wang, S.; Yang, M.; Yin, S.; Zhang, Y.; Zhang, Y.; Sun, H.; Shu, L.; Liu, Y.; Kang, Z.; Liu, N.; et al. A New Peptide Originated from Amphibian Skin Alleviates the Ultraviolet B-Induced Skin Photodamage. Biomed. Pharmacother. 2022, 150, 112987. [Google Scholar] [CrossRef]
- Yin, S.; Li, S.; Bian, W.; Yang, M.; Liu, N.; Hu, Y.; Li, X.; Wang, Y.; Li, Z.; Sun, J.; et al. Antioxidant Peptide AOP-P1 Derived from Odorous Frog Showed Protective Effects Against UVB-Induced Skin Damages. Int. J. Pept. Res. Ther. 2020, 26, 557–565. [Google Scholar] [CrossRef]
- Campbell, L.J.; Crews, C.M. Molecular and Cellular Basis of Regeneration and Tissue Repair: Wound Epidermis Formation and Function in Urodele Amphibian Limb Regeneration. Cell Mol. Life Sci. 2008, 65, 73–79. [Google Scholar] [CrossRef]
- Yin, S.; Wang, Y.; Yang, X. Amphibian-Derived Wound Healing Peptides: Chemical Molecular Treasure Trove for Skin Wound Treatment. Front. Pharmacol. 2023, 14, 1120228. [Google Scholar] [CrossRef]
- Lammi, C.; Aiello, G.; Boschin, G.; Arnoldi, A. Multifunctional Peptides for the Prevention of Cardiovascular Disease: A New Concept in the Area of Bioactive Food-Derived Peptides. J. Funct. Foods 2019, 55, 135–145. [Google Scholar] [CrossRef]
- Kim, M.J.; Chilakala, R.; Jo, H.G.; Lee, S.J.; Lee, D.S.; Cheong, S.H. Anti-Obesity and Anti-Hyperglycemic Effects of Meretrix Lusoria Protamex Hydrolysate in Ob/Ob Mice. Int. J. Mol. Sci. 2022, 23, 4015. [Google Scholar] [CrossRef]
AOPs Families | Name | Sequence as 1- and 3-Letter Symbols | Number of Amino Acids | Methods Used for Antioxidant Activity | Possible Functional Amino Acids | References |
---|---|---|---|---|---|---|
Antioxidin | Antioxidin-RP1 | AMRLTYNKPCLYGT Ala-Met-Arg-Leu-Thr-Tyr-Asn-Lys-Pro-Cys-Leu-Tyr-Gly-Thr | 14 | Free radical scavenging activity: DPPH and ABTS•+; FRAP. | 1 Pro 2 Tyr 1 Met 1 Cys | [8] |
Antioxidin-RP2 | SMRLTYNKPCLYGT Ser-Met-Arg-Leu-Thr-Tyr-Asn-Lys-Pro-Cys-Leu-Tyr-Gly-Thr | 14 | Free radical scavenging activity: DPPH and ABTS•+; FRAP. | 1 Pro 2 Tyr 1 Met 1 Cys | [8] | |
Antioxidin-RL | AMRLTYNRPCIYAT Ala-Met-Arg-Leu-Thr-Tyr-Asn-Arg-Pro-Cys-Ile-Tyr-Ala-Thr | 14 | Free radical scavenging activity: ABTS•+ and FRAP; ABTS•+ reaction kinetics. | 1 Pro 2 Tyr 1 Met 1 Cys | [64] | |
Antioxidin-PN | FLPSSPWNEGTYVLKKLKS Phe-Leu-Pro-Ser-Ser-Pro-Trp-Asn-Glu-Gly-Thr-Tyr-Val-Leu-Lys-Lys-Leu-Lys-Ser | 19 | Free radical scavenging activity: ABTS•+ and ABTS•+ reaction kinetics. | 2 Pro 1 Tyr 1 Trp | [65] | |
Antioxidin-2 | YMRLTYNRPCIYAT Tyr-Met-Arg-Leu-Thr-Tyr-Asn-Arg-Pro-Cys-Ile-Tyr-Ala-Thr | 14 | Free radical scavenging activity: ABTS•+; attenuated PC-12 cell injury induced by H2O2; suppress intracellular ROS content boosted by H2O2; inhibition of the change in SOD1 and GPx1 expression caused by H2O2 stimulation. | 1 Pro 3 Tyr 1 Met 1 Cys | [66] | |
Antioxidin-I | TWYFITPYIPDK Thr-Trp-Tyr-Phe-Ile-Thr-Pro-Tyr-Ile-Pro-Asp-Lys | 12 | In vitro radical scavenging assays: ABTS•+, DPPH, ORAC, and NO; GSH redox balance experiment. | 2 Pro 2 Tyr 1 Trp | [49] | |
Antioxidin-NV | GWANTLKNVAGGLCKMTGAA Gly-Trp-Ala-Asn-Thr-Leu-Lys-Asn-Val-Ala-Gly-Gly-Leu-Cys-Lys-Met-Thr-Gly-Ala-Ala | 20 | Free radical scavenging activity: ABTS•+; intracellular and mitochondrial ROS production (2′,7′-dichlorodihydrofluorescein diacetate (DCFH-DA) assay and kit assay, respectively); hairless mouse model of photoaged skin-immunohistochemistry analysis. | 1 Trp 1 Met 1 Cys | [35] | |
Pleurain | Pleurain-A1 | SIITMTKEAKLPQLWKQIACRLYNTC Ser-Ile-Ile-Thr-Met-Thr-Lys-Glu-Ala-Lys-Leu-Pro-Gln-Leu-Trp-Lys-Gln-IleAla-Cys-Arg-Leu-Tyr-Asn-Thr-Cys | 26 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 1 Pro 1 Tyr 1 Trp 1 Met 2 Cys | [8] |
Pleurain-D1 | FLSGILKLAFKIPSVLCAVLKNC Phe-Lys-Ser-Gly-Ile-Leu-Lys-Leu-Ala-Phe-Lys-Ile-Pro-Ser-Val-Leu-Cys-Ala-Val-Leu-Lys-Asn-Cys | 23 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 1 Pro 2 Cys | [8] | |
Pleurain-E1 | AKAWGIPPHVIPQIVPVRIRPLCGNV Ala-Lys-Ala-Trp-Gly-Ile-Pro-Pro-His-Val-Ile-Pro-Gln-Ile-Val-Pro-Val-Arg-Ile-Arg-Pro-Leu-Cys-Gly-Asn-Val | 26 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 5 Pro 1 Trp 1 Cys | [8] | |
Pleurain-G1 | GFWDSVKEGLKNAAVTILNKIKCKISECPPA Gly-Phe-Trp-Asp-Ser-Val-Lys-Glu-Gly-Leu-Lys-Asn-Ala-Ala-Val-Thr-Ile-Leu-Asn-Lys-Ile-Lys-Cys-Lys-Ile-Ser-Glu-Cys-Pro-Pro-Ala | 31 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 2 Pro 1 Trp 2 Cys | [8] | |
Pleurain-J1 | FIPGLRRLFATVVPTVVCAINKLPPG Phe-Ile-Pro-Gly-Leu-Arg-Arg-Leu-Phe-Ala-Thr-Val-Val-Pro-Thr-Val-Val-Cys-Ala-Ile-Asn-Lys-Leu-Pro-Pro-Gly | 26 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 4 Pro 1 Cys | [8] | |
Pleurain-K1 | DDPDKGMLKWKNDFFQEF Asp-Asp-Pro-Asp-Lys-Gly-Met-Leu-Lys-Trp-Lys-Asn-Asp-Phe-Phe-Gln-Glu-Phe | 18 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 1 Pro 1 Trp 1 Met | [8] | |
Pleurain-M1 | GLLDSVKEGLKKVAGQLLDTLKCKISGCTPA Gly-Leu-Leu-Asp-Ser-Val-Lys-Glu-Gly-Leu-Lys-Lys-Val-Ala-Gly-Gln-Leu-Leu-Asp-Thr-Leu-Lys-Cys-Lys-Ile-Ser-Gly-Cys-Thr-Pro-Ala | 31 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 1 Pro 2 Cys | [8] | |
Pleurain-N1 | GFFDRIKALTKNVTLELLNTITCKLPVTPP Gly-Phe-Phe-Asp-Arg-Ile-Lys-Ala-Leu-Thr-Lys-Asn-Val-Thr-Leu-Glu-Leu-Leu-Asn-Thr-Ile-Thr-Cys-Lys-Leu-Pro-Val-Thr-Pro-Pro | 30 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 3 Pro 1 Cys | [8] | |
Pleurain-P1 | SFGAKNAVKNGLQKLRNQCQANNYQGPFCDIFKKNP Ser-Phe-Gly-Ala-Lys-Asn-Ala-Val-Lys-Asn-Gly-Leu-Glu-Lys-Leu-Arg-Asn-Gln-Cys-Gln-Ala-Asn-Asn-Tyr-Gln-Gly-Pro-Phe-Cys-Asp-Ile-Phe-Lys-Lys-Asn-Pro | 36 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 2 Pro 2 Cys 1 Tyr | [8] | |
Pleurain-R1 | CVHWMTNTARTACIAP Cys-Val-His-Trp-Met-Thr-Asn-Thr-Ala-Arg-Thr-Ala-Cys-Ile-Ala-Pro | 16 | Free radical scavenging activity: DPPH, ABTS•+, NO, and FRAP. | 1 Pro 1 Trp 2 Cys 1 Met | [8] | |
Pleurain-E-OT | ATAWRMPPNGIPPIVAVRIRPLCGTV Ala-Thr-Ala-Trp-Arg-Met-Pro-Pro-Asn-Gly-Ile-Pro-Pro-Ile-Val-Ala-Val-Arg-Ile-Arg-Pro-Leu-Cys-Gly-Thr-Val | 26 | Free radical scavenging activity: DPPH. | 5 Pro 1 Cys 1 Trp 1 Met | [58] | |
Catelicidin | Catelicidin-OA1 | IGRDPTWSHLAASCLKCIFDDLPKTHN Ile-Gly-Arg-Asp-Pro-Thr-Trp-Ser-His-Leu-Ala-Ala-Ser-Cys-Leu-Lys-Cys-Ile-Phe-Asp-Asp-Leu-Pro-Lys-Thr-His-Asn | 27 | Free radical scavenging activity: DPPH; ABTS•+. | 2 Pro 1 Trp 2 Cys | [67] |
Catelicidin-NV | ARGKKECKDDRCRLLMKRGSFSYV Ala-Arg-Gly-Lys-Lys-Glu-Cys-Lys-Asp-Asp-Arg-Cys-Arg-Leu-Leu-Met-Lys-Arg-Gly-Ser-Phe-Ser-Tyr-Val | 24 | Free radical scavenging activity: ABTS•+; determination of intracellular ROS generation. Antioxidant enzyme assays in vivo (CAT and SOD); MDA level determination. | 1 Tyr 1 Cys 1 Met | [68] | |
Cath-KP | GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV Gly-Cys-Ser-Gly-Arg-Phe-Cys-Asn-Leu-Phe-Asn-Asn-Arg-Arg-Pro-Gly-Arg-Leu-Thr-Leu-Ile-His-Arg-Pro-Gly-Gly-Asp-Lys-Arg-Thr-Ser-Thr-Gly-Leu-Ile-Tyr-Val | 37 | Free radical scavenging activity: DPPH, ABTS•+, and FRAP; intracellular ROS detection of lives cells (DCFH-DA assay) by flow cytometry; intracellular SOD, CAT, and NO detection assays. | 2 Pro 2 Cys 1 Tyr | [69] | |
Spinosan | Spinosan A | DLGKASYPIAYS Asp-Leu-Gly-Lys-Ala-Ser-Tyr-Pro-Ile-Ala-Tyr-Ser | 12 | Free radical scavenging activity: DPPH. | 1 Pro 2 Tyr | [70] |
Spinosan B | DYCKPEECDYYFSFPI Asp-Tyr-Cys-Lys-Pro-Glu-Glu-Cys-Asp-Tyr-Tyr-Phe-Ser-Phe-Pro-Ile | 16 | Free radical scavenging activity: DPPH. | 2 Pro 2 Cys 3 Tyr | [70] | |
Spinosan C | DLSMMRKAGSNIVCGLNGLC Asp-Leu-Ser-Met-Met-Arg-Lys-Ala-Gly-Ser-Asn-Ile-Val-Cys-Gly-Leu-Asn-Gly-Leu-Cys | 20 | Free radical scavenging activity: DPPH. | 2 Met 2 Cys | [70] | |
Spinosan D | MEELYKEIDDCVNYGNCKTLKLM Met-Glu-Glu-Leu-Tyr-Lys-Glu-Ile-Asp-Asp-Cys-Val-Asn-Tyr-Gly-Asn-Cys-Lys-Thr-Leu-Lys-Leu-Met | 23 | Free radical scavenging activity: DPPH. | 2 Met 2 Tyr 2 Cys | [70] | |
Palustrin | Palustrin-2AJ1 | GFMDTAKNVAKNVAVTLIDKLRCKVTGGC Gly-Phe-Met-Asp-Thr-Ala-Lys-Asn-Val-Ala-Lys-Asn-Val-Ala-Val-Thr-Leu-Ile-Asp-Lys-Leu-Arg-Cys-Lys-Val-Thr-Gly-Gly-Cys | 29 | Free radical scavenging activity: DPPH. | 2 Cys 1 Met | [34] |
Palustrin-2GN1 | GLWNTIKEAGKKFALNLLDKIRCGIAGGCKG Gly-Leu-Trp-Asn-Thr-Ile-Lys-Glu-Ala-Gly-Lys-Lys-Phe-Ala-Leu-Asn-Leu-Leu-Asp-Lys-Ile-Arg-Cys-Gly-Ile-Ala-Gly-Gly-Cys-Lys-Gly | 31 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Trp 1 Cys | [32] | |
Brevinin | Brevinin-1TP1 | FLPGLIKAAVGVGSTILCKITKKC Phe-Leu-Pro-Gly-Leu-Ile-Lys-Ala-Ala-Val-Gly-Val-Gly-Ser-Thr-Ile-Leu-Cys-Lys-Ile-Thr-Lys-Lys-Cys | 24 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Pro 2 Cys | [32] |
Brevinin-1TP2 | FLPGLIKAAVGIGSTIFCKISKKC Phe-Leu-Pro-Gly-Leu-Ile-Lys-Ala-Ala-Val-Gly-Ile-Gly-Ser-Thr-Ile-Phe-Cys-Lys-Ile-Ser-Lys-Lys-Cys | 24 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Pro 2 Cys | [32] | |
Brevinin-1TP3 | FLPGLIKVAVGVGSTILCKITKKC Phe-Leu-Pro-Gly-Leu-Ile-Lys-Val-Ala-Val-Gly-Val-Gly-Ser-Thr-Ile-Leu-Cys-Lys-Ile-Thr-Lys-Lys-Cys | 24 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Pro 2 Cys | [32] | |
Brevinin-1LF1 | FLPMLAGLAANFLPKIICKITKKC Phe-Leu-Pro-Met-Leu-Ala-Gly-Leu-Ala-Ala-Asn-Phe-Leu-Pro-Lys-Ile-Ile-Cys-Lys-Ile-Thr-Lys-Lys-Cys | 24 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 2 Pro 2 Cys | [32] | |
Brevinin-1FL | FWERCSRWLLN Phe-Trp-Glu-Arg-Cys-Ser-Arg-Trp-Leu-Leu-Asn | 11 | Free radical scavenging activity: DPPH, ABTS•+, NO, FRAP; MDA, SOD, CAT, LHD, and GSH levels in PC-12 cell. ROS detection in PC-12 cell (DCFH-DA assay) flow cytometry. | 2 Trp 1 Cys | [71] | |
Nigroain | Nigroain -B-MS1 | CVVSSGWKWNYKIRCKLTGNC Cys-Val-Val-Ser-Ser-Gly-Trp-Lys-Trp-Asn-Tyr-Lys-Ile-Arg-Cys-Lys-Leu-Thr-Gly-Asn-Cys | 21 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 2 Trp 1 Tyr 3 Cys | [72] |
Nigroain -C-MS1 | FKTWKNRPILSSCSGIIKG Phe-Lys-Thr-Trp-Lys-Asn-Arg-Pro-Ile-Leu-Ser-Ser-Cys-Ser-Gly-Ile-Ile-Lys-Gly | 19 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Trp 1 Cys | [72] | |
Nigroain-D-SN1 | CQWQFISPSRAGCIGP Cys-Gln-Trp-Gln-Phe-Ile-Ser-Pro-Ser-Arg-Ala-Gly-Cys-Ile-Gly-Pro | 16 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 2 Pro 1 Trp 2 Cys | [72] | |
Nigroain -K-SN1 | SLWETIKNAGKGFILNILDKIRCKVAGGCKT Ser-Leu-Trp-Glu-Thr-Ile-Lys-Asn-Ala-Gly-Lys-Gly-Phe-Ile-Leu-Asn-Ile-Leu-Asp-Lys-Ile-Arg-Cys-Lys-Val-Ala-Gly-Gly-Cys-Lys-Thr | 31 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Trp 2 Cys | [72] | |
Andersonin | Andersonin-AOP1 | FLPGLECVW Phe-Leu-Pro-Gly-Leu-Glu-Cys-Val-Trp | 9 | Free radical scavenging activity: DPPH and ABTS•+; inducibility of antioxidant activities of skin secretions and skin tolerance to UVB exposure. | 1 Pro 1 Trp 1 Cys | [56] |
Andersonin-AOP2 | SLSCFLSFTR Ser-Lys-Ser-Cys-Phe-Leu-Ser-Phe-Thr-Arg | 10 | Free radical scavenging activity: DPPH and ABTS•+; inducibility of antioxidant activities of skin secretions and skin tolerance to UVB exposure. | 1 Cys | [56] | |
Andersonin-AOP10a | SYLNSLSCFLSFT Ser-Tyr-Leu-Asn-Ser-Leu-Ser-Cys-Phe-Leu-Ser-Phe-Thr | 13 | Free radical scavenging activity: DPPH and ABTS•+; inducibility of antioxidant activities of skin secretions and skin tolerance to UVB exposure. | 1 Cys 1 Tyr | [56] | |
Andersonin-AOP11a | GMGYMMLCGLSGM Gly-Met-Gly-Tyr-Met-Met-Leu-Cys-Gly-Leu-Ser-Gly-Met | 13 | Free radical scavenging activity: DPPH and ABTS•+; inducibility of antioxidant activities of skin secretions and skin tolerance to UVB exposure. | 4 Met 1 Tyr 1 Cys | [56] | |
Andersonin-AOP14d | TGKHMAGCFKFGES Thr-Gly-Lys-His-Met-Ala-Gly-Cys-Phe-Lys-Phe-Gly-Glu-Ser | 14 | Free radical scavenging activity: DPPH and ABTS•+; inducibility of antioxidant activities of skin secretions and skin tolerance to UVB exposure. | 1 Cys 1 Met | [56] | |
Andersonin-AOP15 | AYMKQHMYCAASFF Ala-Tyr-Met-Lys-Gln-His-Met-Tyr-Cys-Ala-Ala-Ser-Phe-Phe | 14 | Free radical scavenging activity: DPPH and ABTS•+; inducibility of antioxidant activities of skin secretions and skin tolerance to UVB exposure. | 2 Met 2 Tyr 1 Cys | [56] | |
Andersonin-AOP16 | VVKCSYRQGSPDSR Val-Val-Lys-Cys-Ser-Tyr-Arg-Gln-Gly-Ser-Pro-Asp-Ser-Arg | 14 | Free radical scavenging activity: DPPH and ABTS•+; inducibility of antioxidant activities of skin secretions and skin tolerance to UVB exposure. | 1 Pro 1 Tyr 1 Cys | [56] | |
Andersonin-AOP23 | GLFSMILGVGKKTLCGLSGLW Gly-Leu-Phe-Ser-Met-Ile-Leu-Gly-Val-Gly-Lys-Lys-Thr-Leu-Cys-Gly-Leu-Ser-Gly-Leu-Trp | 21 | Free radical scavenging activity: DPPH and ABTS•+; inducibility of antioxidant activities of skin secretions and skin tolerance to UVB exposure. | 1 Trp 1 Cys 1 Met | [56] | |
Odorranain | Odorranain-G-OT | FVPAILCSILKTC Phe-Val-Pro-Ala-Ile-Leu-Cys-Ser-Ile-Leu-Lys-Thr-Cys | 13 | Free radical scavenging activity: DPPH. | 1 Pro 2 Cys | [58] |
Odorranain-A-OT | VVKCSFRPGSPAPRCK Val-Val-Lys-Cys-Ser-Phe-Arg-Pro-Gly-Ser-Pro-Ala-Pro-Arg-Cys-Lys | 16 | Free radical scavenging activity: DPPH. | 3 Pro 2 Cys | [58] | |
Odorranain-M-OM | AMRLTYNRPCIYAT Ala-Met-Arg-Leu-Thr-Tyr-Asn-Arg-Pro-Cys-Ile-Tyr-Ala-Tyr | 14 | Free radical scavenging activity: DPPH. | 1 Pro 1 Cys 1 Met 2 Tyr | [58] | |
Odorranain-A-OA11 | VVKCSYRQGSPDSR Val-Val-Lys-Cys-Ser-Tyr-Arg-Gln-Gly-Ser-Pro-Asp-Ser-Arg | 14 | Free radical scavenging activity ABTS•+. | 1 Pro 1 Cys 1 Tyr | [59] | |
Hainanenin | Hainanenin-1 | FALGAVTKLLPSLLCMITRKC Phe-Ala-Leu-Gly-Ala-Val-Thr-Lys-Leu-Leu-Pro-Ser-Leu-Leu-Cys-Met-Ile-Thr-Arg-Lys-Cys | 21 | Free radical scavenging activity: DPPH. | 1 Pro 2 Cys 1 Met | [55] |
Hainanenin-5 | FALGAVTKRLPSLFCLITRKC Phe-Ala-Leu-Gly-Ala-Val-Thr-Lys-Arg-Leu-Pro-Ser-Leu-Phe-Cys-Leu-Ile-Thr-Arg-Lys-Cys | 21 | Free radical scavenging activity: DPPH. | 1 Pro 2 Cys | [55] | |
FW | FW-1 | FWPLI(NH2) Phe-Trp-Pro-Leu-Ile(NH2) | 5 | The fluorometric assay (DCFH-DA assay) to measure the intracellular ROS level. | 1 Pro 1 Trp | [43] |
FW-2 | FWPMI(NH2) Phe-Trp-Pro-Met-Ile(NH2) | 5 | The fluorometric assay (DCFH-DA assay) to measure the intracellular ROS level. | 1 Pro 1 Trp 1 Met | [43] | |
Taipehensin | Taipehensin-1TP1 | TLIWEFYHQILDEYNKENKG Thr-Leu-Ile-Trp-Glu-Phe-Tyr-His-Gln-Ile-Leu-Asp-Glu-Tyr-Asn-Lys-Glu-Asn-Lys-Gly | 20 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 2 Tyr 1 Trp | [32] |
Taipehensin-2TP | CLMARPNYRCKIFKQC Cys-Leu-Met-Ala-Arg-Pro-Asn-Tyr-Arg-Cys-Lys-Ile-Phe-Lys-Gln-Cys | 16 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Pro 3 Cys 1 Met | [32] | |
OM | OM-GF17 | GFFKWHPRCGEEHSMWT Gly-Phe-Phe-Lys-Trp-His-Pro-Arg-Cys-Gly-Glu-Glu-His-Ser-Met-Trp-Thr | 17 | Free radical scavenging activity: DPPH, ABTS•+, and NO; FRAP. | 1 Pro 1 Met 2 Trp 1 Cys | [73] |
OM-LV20 | LVGKLLKGAVGDVCGLLPIC Leu-Val-Gly-Lys-Leu-Leu-Lys-Gly-Ala-Val-Gly-Asp-Val-Cys-Gly-Leu-Leu-Pro-Ile-Cys | 20 | Free radical scavenging activity: DPPH, ABTS•+, and NO; FRAP. | 1 Pro 2 Cys | [74] | |
OM-GL15 | GLLSGHYGRASPVAC Gly-Leu-Leu-Ser-Gly-His-Tyr-Gly-Arg-Ala-Ser-Pro-Val-Ala-Cys | 15 | Free radical scavenging activity: DPPH, ABTS•+, and FRAP. | 1 Pro 1 Cys 1 Tyr | [31] | |
OA | OA-GL21 | GLLSGHYGRVVSTQSGHYGRG Gly-Leu-Leu-Ser-Gly-His-Tyr-Gly-Arg-Val-Val-Ser-Thr-Gln-Ser-Gly-His-Tyr-Gly-Arg-Gly | 21 | Free radical scavenging activity: DPPH and ABTS•+. | 2 Tyr | [75] |
OA-VI12 | VIPFLACRPLGL Val-Ile-Pro-Phe-Leu-Ala-Cys-Arg-Pro-Leu-Gly-Leu | 12 | ROS levels in HaCaT cells treated with H2O2 or UVB irradiation (DCFH-DA assay); measurement of SOD and GSH levels in UVB-irradiated mouse skin. | 2 Pro 1 Cys | [11] | |
Temporin | Temporin-TP1 | FLPVLGKVIKLVGGLL(NH2) Phe-Leu-Pro-Val-Leu-Gly-Lys-Val-Ile-Lys-Leu-Val-Gly-Gly-Leu-Leu(NH2) | 16 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Pro | [32] |
Temporin-MS1 | FLTGLIGGLMKALGK Phe-Leu-Thr-Gly-Leu-Ile-Gly-Gly-Leu-Met-Lys-Ala-Leu-Gly-Lys | 15 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Met | [72] | |
Triptofilins | Pat-2 | FPPWL(NH2) Phe-Pro-Pro-Trp-Leu(NH2) | 5 | ROS and RNS intracellular analysis by flow cytometry assay. In silico antioxidant studies. | 2 Pro 1 Trp | [48] |
PpT-2 | FPWLLS(NH2) Phe-Pro-Trp-Leu-Leu-Ser(NH2) | 6 | Free radical scavenging activity: ABTS•+ and DPPH; ROS and RNS intracellular analysis by flow cytometry assay. | 1 Pro 1 Trp 1 Ser | [76] | |
Wuchuanin | Wuchuanin-AOP5 | TVWGFRPSKPPSGYR Thr-Val-Trp-Gly-Phe-Arg-Pro-Ser-Lys-Pro-Pro-Ser-Gly-Tyr-Arg | 15 | Free radical scavenging activity: ABTS•+. | 3 Pro 1 Tyr 1 Trp | [59] |
Wuchuanin-A1 | APDRPRKFCGILG Ala-Pro-Asp-Arg-Pro-Arg-Lys-Phe-Cys-Gly-Ile-Leu-Gly | 13 | Free radical scavenging activity: ABTS•+. | 2 Pro 1 Cys | [59] | |
Ranacyclin | Ranacyclin-HB1 | GAPKGCWTKSYPPQPCFGKK Gly-Ala-Pro-Lys-Gly-Cys-Trp-Thr-Lys-Ser-Tyr-Pro-Pro-Gln-Pro-Cys-Phe-Gly-Lys-Lys | 20 | Free radical scavenging activity: ABTS•+ and DPPH. | 4 Pro 2 Cys 1 Trp 1 Tyr | [72] |
Daiyunin | Daiyunin-1 | CGYKYGCMVKVDR Cys-Gly-Tyr-Lys-Tyr-Gly-Cys-Met-Val-Lys-Val-Asp-Arg | 13 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 1 Met 2 Tyr 2 Cys | [72] |
Pleskein | Pleskein-2 | FFLLPIPNDVKCKVLGICKS Phe-Phe-Leu-Leu-Pro-Ile-Pro-Asn-Asp-Val-Lys-Cys-Lys-Val-Leu-Gly-Ile-Cys-Lys-Ser | 20 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 2 Pro 2 Cys | [72] |
OS | OS-LL11 | LLPPWLCPRNK Leu-Leu-Pro-Pro-Trp-Leu-Cys-Pro-Arg-Asn-Lys | 11 | Photodamage and mechanisms related to the ability to eliminate free radicals: ABTS•+, DPPH; ROS, Lipid peroxide (LPO), MDA, LDH, and CAT levels in mouse keratinocytes. | 3 Pro 1 Trp | [77] |
Odorranaopin | Odorranaopin-MS2 | DNVYSRPPQRFGQNVIS Asp-Asn-Val-Tyr-Ser-Arg-Pro-Pro-Gln-Arg-Phe-Gly-Gln-Asn-Val-Ile-Ser | 17 | Free radical scavenging activity: DPPH and ABTS•+; ABTS•+ and DPPH free radical scavenging kinetics. | 2 Pro 1 Tyr | [72] |
Jindongenin | Jindongenin-1a | DSMGAVKLAKLLIDKMKCEVTKAC Asp-Ser-Met-Gly-Ala-Val-Lys-Leu-Ala-Lys-Leu-Leu-Ile-Asp-Lys-Met-Lys-Cys-Glu-Val-Thr-Lys-Ala-Cys | 24 | Free radical scavenging activity: DPPH. | 2 Met 2 Cys | [34] |
Parkerin | Parkerin | GWANTLKNVAGGLCKITGAA Gly-Trp-Ala-Asn-Thr-Leu-Lys-Asn-Val-Ala-Gly-Gly-Leu-Cys-Lys-Ile-Thr-Gly-Ala-Ala | 20 | Free radical scavenging activity: DPPH. | 1 Trp 1 Cys | [33] |
Hejiangin | Hejiangin-A1 | RFIYMKGFGKPRFGKR Arg-Phe-Ile-Tyr-Met-Lys-Gly-Phe-Gly-Lys-Pro-Arg-Phe-Gly-Lys-Arg | 16 | Free radical scavenging activity: ABTS•+ | 1 Pro 1 Tyr 1 Met | [59] |
APBMH | APBMH | LEQQVDDLEGSLEQEKK Leu-Glu-Gln-Gln-Val-Asp-Asp-Leu-Glu-Gly-Ser-Leu-Glu-Gln-Glu-Lys-Lys | 17 | Hydroxyl radical scavenging activity; superoxide radical scavenging activity; lipid peroxidation inhibition assay; protective effect of the purified peptide against hydroxyl radical-induced DNA damage. | - | [78] |
Salamandrin | Salamandrin-I | FAVWGCADYRGY(NH2) Phe-Ala-Val-Trp-Gly-Cys-Ala-Asp-Tyr-Arg-Gly-Tyr(NH2) | 12 | Free radical scavenging activity: ABTS•+ and DPPH; in silico antioxidant studies. | 1 Cys 1 Tyr | [79] |
APBSP | APBSP | LEELEEELEGCE Leu-Glu-Glu-Leu-Glu-Glu-Glu-Leu-Glu-Gly-Cys-Glu | 12 | Lipid peroxidation inhibition assay; scavenging effect on DPPH radical; hydroxyl radicals scavenging activity; superoxide anion radical scavenging activity; peroxyl radicals scavenging activity. | 1 Cys | [47] |
W3 | W3 | LGWVSKGKLL(NH2) Leu-Gly-Trp-Val-Ser-Lys-Gly-Lys-Leu-Leu(NH2) | 10 | Free radical scavenging activity: DPPH; Fe2+ chelating capability. | 1 Trp | [80] |
Macrotympanain-A1 | Macrotympanain-A1 | FLPGLECVW Phe-Leu-Pro-Gly-Leu-Glu-Cys-Val-Trp | 9 | Free radical scavenging activity: ABTS•+. | 1 Pro 1 Cys 1 Trp | [59] |
Ansin2 | Ansin2 | TRCFRVCS Thr-Arg-Cys-Phe-Arg-Val-Cys-Ser | 8 | Free radical scavenging activity: DPPH and ABTS•+; FRAP. | 1 Cys | [80] |
Frog Protein | Hydrolysates (FPHs) | L/IK Leu/Ile-Lys | 2 | Free radical scavenging activity: DPPH and ORAC; FRAP. | - | [81] |
Hydrolysates (FPHs) | FK Phe-Lys | 2 | Free radical scavenging activity: DPPH and ORAC; FRAP. | - | [81] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Silva Ortíz, Y.L.; de Sousa, T.C.; Kruklis, N.E.; Galeano García, P.; Brango-Vanegas, J.; Soller Ramada, M.H.; Franco, O.L. The Role of Amphibian AMPs Against Oxidative Stress and Related Diseases. Antibiotics 2025, 14, 126. https://doi.org/10.3390/antibiotics14020126
Silva Ortíz YL, de Sousa TC, Kruklis NE, Galeano García P, Brango-Vanegas J, Soller Ramada MH, Franco OL. The Role of Amphibian AMPs Against Oxidative Stress and Related Diseases. Antibiotics. 2025; 14(2):126. https://doi.org/10.3390/antibiotics14020126
Chicago/Turabian StyleSilva Ortíz, Yudy Lorena, Thaís Campos de Sousa, Natália Elisabeth Kruklis, Paula Galeano García, José Brango-Vanegas, Marcelo Henrique Soller Ramada, and Octávio Luiz Franco. 2025. "The Role of Amphibian AMPs Against Oxidative Stress and Related Diseases" Antibiotics 14, no. 2: 126. https://doi.org/10.3390/antibiotics14020126
APA StyleSilva Ortíz, Y. L., de Sousa, T. C., Kruklis, N. E., Galeano García, P., Brango-Vanegas, J., Soller Ramada, M. H., & Franco, O. L. (2025). The Role of Amphibian AMPs Against Oxidative Stress and Related Diseases. Antibiotics, 14(2), 126. https://doi.org/10.3390/antibiotics14020126