Next Article in Journal
Novel Insight into Culicoides (Diptera: Ceratopogonidae) Host Preferences and the First Evidence of Avian Haemosporidian Parasites in Biting Midges in Slovakia
Next Article in Special Issue
A Systematic Review and Meta-Analysis of Bovine Pestivirus Prevalence and Associated Risk Factors in Latin America
Previous Article in Journal
Mycobacterium fortuitum Infection Mimicking an Odontogenic Abscess: Report of a Pediatric Case with Relevant Literature Analysis
Previous Article in Special Issue
Encephalomyocarditis Virus in Non-Domesticated Species
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Discovery and Genomic Characterisation of Novel Papillomaviruses in Australian Wild Birds

1
Biomedical Sciences & Molecular Biology, College of Medicine and Dentistry, James Cook University, Townsville, QLD 4811, Australia
2
Institute for Biomedicine and Glycomics, Griffith University, Southport, QLD 4215, Australia
3
Biosecurity Research Program and Training Centre, Gulbali Institute, Charles Sturt University, Wagga Wagga, NSW 2678, Australia
4
School of Science, Technology and Engineering, University of the Sunshine Coast, Sippy Downs, QLD 4557, Australia
5
Centre for Bioinnovation, University of the Sunshine Coast, Sippy Downs, QLD 4557, Australia
*
Author to whom correspondence should be addressed.
Pathogens 2025, 14(6), 514; https://doi.org/10.3390/pathogens14060514
Submission received: 29 April 2025 / Revised: 19 May 2025 / Accepted: 21 May 2025 / Published: 22 May 2025
(This article belongs to the Special Issue Current Challenges in Veterinary Virology)

Abstract

Papillomaviruses are small, circular DNA viruses that infect epithelial and mucosal cells, which have co-evolved with their hosts over time. While certain mammalian papillomaviruses—especially those linked to disease—are well studied, there is limited knowledge about papillomaviruses associated with avian species. In this study, we identified two avian papillomaviruses from eye/choana swabs of the sacred kingfisher (Todiramphus sanctus) and the little corella (Cacatua sanguinea), collected in Queensland, Australia. The genomes of these viruses, designated as todiramphus sanctus papillomavirus 1 (TsPV1) and cacatua sanguinea papillomavirus 1 (CsPV1), were found to be 7883 and 7825 base pairs in length, respectively. The TsPV1 and CsPV1 genomes exhibited the highest nucleotide sequence identity (>56%) with papillomavirus genomes previously sequenced from mallards or wild ducks in the United States, followed by those from black-legged kittiwakes and Atlantic puffins (>54%) in Newfoundland, Canada. Both TsPV1 and CsPV1 share approximately a 65% nucleotide sequence identity in the L1 gene with anas platyrhynchos papillomavirus 3 (AplaPV3), indicating that they represent novel avian papillomaviruses. Notably, the two genomes in this study were nearly identical (99.69%), and their L1 proteins shared 100% sequence identity. Phylogenetic analysis positioned TsPV1 and CsPV1 within a clade of avian papillomaviruses associated with closely related avian hosts, including the mallard, African grey parrot, common chaffinch, and Atlantic canary. These findings underscore the importance of further research on studying additional Australian bird species longitudinally, which will help to establish potential disease associations and ecological impacts of previously unrecognised and novel papillomaviruses in Australian wild birds.

1. Introduction

The Papillomaviridae family comprises a broad and diverse group of non-enveloped, double-stranded DNA viruses that infect a wide variety of vertebrate species, including mammals, birds, reptiles, and fish [1,2,3,4,5,6,7,8]. As classified by the International Committee on Taxonomy of Viruses (ICTV), this family currently consists of more than 50 recognised genera and over 340 species [9,10]. While many papillomavirus (PV) infections are asymptomatic, certain PVs can cause benign epithelial growths, such as warts, which can sometimes develop into malignant lesions, including squamous cell carcinoma and other cancers affecting the skin or mucosa [2,3,4,5,6]. Although human papillomaviruses (HPVs) have been the most thoroughly studied within the Papillomaviridae family, advances in genomic sequencing have identified various PV types affecting other animal species, including birds. Avian papillomaviruses (APVs) represent a distinct and important subgroup within the Papillomaviridae family. They are currently classified within the genera Thetapapillomavirus, Etapapillomavirus, Dyoepsilonpapillomavirus, Dyozetapapillomavirus, Treisepsilonpapillomavirus, and Treiszetapapillomavirus. Despite their taxonomic recognition, APVs remain comparatively underexplored. Infected birds generally develop benign papillomas on their skin or mucosa, with the impact on their health varying according to the size and location of the lesions.
Structurally, APVs share similarities with other PVs, featuring a double-stranded, circular DNA genome typically between 5.7 and 8.6 kilobases (kb), enclosed within an icosahedral capsid [10]. The genome encodes several open reading frames (ORFs) that encode both structural proteins (L1 and L2) and non-structural proteins (E1–E9) involved in viral replication, cellular transformation, and capsid assembly [11,12]. The PV genome also contains a regulatory segment known as the long control region (LCR), with some viruses having an additional non-coding region. Although PVs share a conserved genomic structure, diversity in the E proteins exists across species, while the essential ORFs—E1, E2, L2, and L1—are consistently present across all PV genomes [13]. Despite these genetic similarities, APVs differ in evolutionary history and host specificity, making them valuable for studies in comparative viral genomics.
Traditionally, PVs were considered highly host-specific, evolving in close association with their host species, suggesting a pattern of host-specific codivergence. However, recent studies indicate that cross-species transmission may be more common than previously believed, especially among closely related host species [14,15,16]. For example, cases of cross-species transmission, such as bovine PVs infecting other herbivores and certain felids, suggest that host specificity in PVs may be more flexible than once assumed [17,18].
While much of the research on PV diversity has focused on mammals, there remains limited understanding of APVs. The earliest confirmed APV cases date to the 1970s, with PV-like particles detected in squamous papillomas in chaffinches using electron microscopy [19]. Subsequently, APVs have been found in other bird species, including the African grey parrot and the northern fulmar, in association with cutaneous tumours or lesions [20,21,22]. While the clinical manifestations of APV infections are generally benign, certain strains have shown the capacity for more invasive disease, particularly when co-infections or environmental stressors are present [19,20,21,22]. Recent advances in next-generation sequencing and molecular diagnostics are facilitating the identification, characterisation, and study of APV diversity, shedding light on their evolutionary pathways and potential for cross-species transmission.
This study reports the complete genome sequences and molecular characterization of two novel APVs detected in swabs collected from the sacred kingfisher (Todiramphus sanctus) and the little corella (Cacatua sanguinea). These findings improve our understanding of APV diversity, host–virus interactions, and evolutionary dynamics, which are essential for understanding broader implications for avian health and disease ecology.

2. Materials and Methods

2.1. Sampling and DNA Extraction

A subset of DNA samples (n = 11) from four wild avian groups—parrots, pigeons, kingfishers, and raptors—was selected for further investigation (see Supplementary Table S1 for details). Notably, the majority of these DNA samples harboured multiple avian pathogens, including Chlamydiaceae, beak and feather disease virus (BFDV), avipoxviruses, columbid alphaherpesvirus 1 (CoAHV1), and psittacid alphaherpesvirus 1 (PsAHV1) (Supplementary Table S1) [23]. These birds were admitted to the Australia Zoo Wildlife Hospital (AZWH, Beerwah, QLD, Australia) for various health issues, including clinical diseases and trauma. The attending veterinarians managed the pre-sampling, admission, care, and euthanasia processes. Approval for sampling from the euthanized birds was granted by the University of the Sunshine Coast Animal Research Ethics Committee (ANE1940, ANE2057) [23]. Genomic DNA was extracted from swab samples collected from the eye, liver, or eye/choana (Supplementary Table S1) using the QiaAMP DNA Mini Kit, following the manufacturer’s guidelines (Qiagen, Clayton, VIC, Australia). The eluted DNA was stored at −20 °C for subsequent analysis [23].

2.2. Next-Generation Sequencing

The quantity and quality of the extracted DNA were assessed using a Qubit dsDNA high-sensitivity assay kit with Qubit Fluorometer v4.0 (Thermo Fisher Scientific, Waltham, MA, USA). Library construction was performed using the Illumina DNA Prep (Illumina, San Diego, CA, USA) as per kit instructions, starting with 200 ng of DNA quantified using the Qubit Fluorometer v4.0 (Thermo Fisher Scientific, USA). The quality and quantity of the prepared library were evaluated by the Australian Genome Research Facility, Melbourne, Australia. Cluster generation and the sequencing of the library were performed with 150 bp paired-end reads on the Illumina® NovaSeq chemistry, according to the manufacturer’s instructions.

2.3. Bioinformatic Analyses

The resulting raw sequencing reads were analysed as per the established pipeline [24,25] using Geneious Prime® (version 2023.1.1, Biomatters, Auckland, New Zealand). Briefly, preliminary quality evaluation for all raw reads was generated and pre-processed to remove ambiguous base calls and poor-quality reads, and trimmed to remove the Illumina adapter sequences. Trimmed sequence reads were mapped against the chicken genome Gallus gallus (GenBank accession no. NC006088.5) to remove likely host DNA contamination. In addition, the reads were further mapped to the Escherichia coli bacterial genomic sequence (GenBank accession no. U00096) to remove possible bacterial contamination. The remaining cleaned and unmapped reads were used for de novo assembly using a SPAdes assembler (version 3.10.1) [26] in Geneious. The resulting contigs were compared against the nonredundant nucleotide and protein databases on GenBank using BLASTN and BLASTX [27], respectively, with an E-value threshold of 1 × 10−5 to remove potential false positives. Contigs that had significant BLAST (version 2.16.0) hits with bacteria, eukaryotes, or fungi were filtered out to remove non-viral reads. Virus contigs of interest greater than 500 nucleotides (nt) were imported into Geneious Prime® (version 2023.1.1) for further functional analysis. The detected viruses were annotated using Geneious Prime® (version 2023.1.1), where genus-specific published viruses were used as a reference guideline.

2.4. Comparative Genomics and Phylogenetic Analysis

The genomic comparisons of the newly sequenced complete viral genomes of papillomaviruses were visualised using clinker [28], Base-by-Base [29], and Geneious (version 2023.1.1). The pairwise sequence similarities between the selected PVs sequences were identified against representative avian papillomaviruses sequences by Base-by-Base and MAFFT software (Version 11.0.11) [29,30,31].
Phylogenetic analysis of the novel PV genome sequences identified in this study was conducted alongside selected papillomavirus genome sequences available in the GenBank database. APV sequences were downloaded from GenBank in July 2024 (Table 1). The amino acid sequences of the L1 gene and the nucleotide sequences of the selected complete PVs genomes were aligned using MAFFT (version 7.450) with the G-INS-i algorithm (gap open penalty 1.53; offset value 0.123) within Geneious. Maximum likelihood (ML) phylogenetic trees were constructed using LG (L1 gene) and GTR (complete genome) substitution models with 1000 bootstrap replicates in Geneious. Human papillomavirus 41 (GenBank accession number, X56147) was used as an outgroup.

3. Results

3.1. Genomes of Two Novel Avian Papillomaviruses

Two complete papillomavirus (PV) genomes were detected in DNA extracted from the eye tissue of a sacred kingfisher (T. sanctus) and a little corella (C. sanguinea), corresponding to a prevalence rate of 18.18%. The samples were collected from separate locations in Queensland—Peachester (sacred kingfisher) in October 2020 and Burpengary (little corella) in November 2020. The genomes measured 7883 bp (average coverage of 260.68×) and 7825 bp (average coverage of 10.20×) in length, respectively. The GC content for the todiramphus sanctus papillomavirus 1 (TsPV1) and cacatua sanguinea papillomavirus 1 (CsPV1) complete genome is 57.8%. The genomes of TsPV1 and CsPV1 sequenced in this study showed the highest nucleotide sequence identity (>56%) with a PV genome sequenced from a mallard in the United States (GenBank accession no. PP057987) [7], followed by a black-legged Kittiwake (>54%) from Newfoundland Canada (GenBank accession no. MK620305) [6] and an Atlantic puffin from Newfoundland Canada (>54%) (GenBank accession no. MK620302) (Table 1). In addition, the two PV genomes sequenced in this study were almost identical (99.69% nucleotide identity at the genomic level).

3.2. Comparative Analyses

Like other papillomaviruses, APVs identified in this study exhibited the characteristic genome structure, including the four core ORFs encoding the proteins L1, L2, E1, and E2. The ORFs for the E6 and E9 proteins, commonly found in most papillomaviruses, were also present. Additionally, an extra ORF encoding the hypothetical protein was identified (Figure 1A and Table 2).
The hexameric DNA helicase E1, the only enzyme encoded by papillomaviruses, is also the most conserved protein across these viruses [32]. In APVs, the E1 proteins range from 587 to 722 amino acids in length, slightly larger than those found in mammalian papillomaviruses, which typically span 600–650 amino acids [6]. Similarly to other papillomaviruses, the E1 proteins of TsPV1 and CsPV1 were 702 amino acids long, sharing the highest sequence identity with duck papillomavirus 3 (64.84%, GenBank accession no. QBR99468.1). Notably, the E1 proteins of TsPV1 and CsPV1 are identical, showing 100% amino acid identity. The E1 gene in both TsPV1 and CsPV1 encodes a typical bipartite nuclear localisation signal within the N-terminal region (sequence: 187RSKNSMPKRNAAGAIQVHGHDAAAPKRVRGP217), which has a predicted score of 6.1 as determined by cNLS mapper [33]. As illustrated in Figure 1B, the E1 gene also encodes several conserved motifs common to the AAA+ (ATPases associated with diverse cellular activities) protein family, including Walker A (phosphate-binding loop: GXXXXGK[T/S]; specifically, GVPDSGKS), Walker B (ATP-binding domain: XXDD; represented as AIDD), and Walker C (sensor 1: XX[T/S][T/S]N; represented as XXSSN). These motifs—highlighted by their conserved residues (shown in bold)—are well conserved across APV helicase domains.
Additionally, the DNA-binding domain, located within the C-terminal region of the E2 protein, serves as a key regulator of viral transcription and replication [34]. This sequence (GXTXQ[L/V]KTIRXR; position in TsPV1 and CsPV1, 325GYTGQLKTIRHR336) is also highly conserved across all papillomaviruses.
The L2 protein of the TsPV1 and CsPV1 showed the highest identity with duck papillomavirus (>44%, GenBank accession no. ANN29878.1) sequenced from India in 2014 [35]. Distinctive conserved motifs were identified within the L2 structural protein across all APVs (Figure 1C). Among these were the furin cleavage motif (RX[K/R]R) located in the N-terminal region of both TsPV1 and CsPV1, along with a variable number of transmembrane GXXXG domains and a sorting nexin 17 (SNX17)-binding site ([F/Y]XNPX[F/Y]). The furin cleavage site is crucial for viral entry, while the transmembrane domains and SNX17-binding motif are likely involved in endosomal escape [12]. Additionally, a syntaxin 18-binding site (D[Q/K]xL[Q/K]), which facilitates viral transport toward the nucleus [12], was also found in both TsPV1 and CsPV1.
The major capsid protein (L1) of papillomavirus in both TsPV1 and CsPV1 was 1551 bp in nucleotide length, displaying the highest amino acid similarity with duck papillomavirus (>65%, GenBank accession no. QBR99472), which was sequenced in India in 2014 [35]. The L1 proteins of TsPV1 and CsPV1 were found to be 100% identical.

3.3. Evolutionary Relationships of APVs

Phylogenetic analysis, using both the individual L1 gene (Figure 2A) and the complete genome sequences of the selected PVs (Figure 2B), provides support for the classification of the newly identified APVs in this study. The phylogenetic tree based on the individual L1 gene sequences of the selected APVs (Figure 2A) demonstrated a similar topology to the maximum likelihood (ML) tree generated from the complete genome sequences of the selected papillomaviruses (Figure 2B). As shown in Figure 2, both trees supported the formation of a subclade comprising papillomaviruses infecting the mallard (AplaPV1 and AplaPV3), African grey parrot (PePV1), common chaffinch (FcPV1), and Atlantic canary (ScPV1), reflecting their potential phylogenetic relationships. However, the phylogenetic positions of the TsPV1 and CsPV1 detected in this study lacked strong bootstrap support (maximum of 63%), indicating no obvious close relationship with other known papillomaviruses. This suggests that these viruses may represent an intermediate evolutionary lineage distinct from the previously identified avian papillomaviruses.

3.4. Taxonomic Identification

According to the International Committee for the Taxonomy of Viruses (ICTV), papillomavirus classification is determined through a combination of nucleotide identity thresholds for the L1 gene and the corresponding phylogenetic analysis. The ICTV has established distinct phylogenetic cut-offs for demarcating taxa—60% for genera, 70% for species, and 90% for types [10]. The average pairwise identities between the L1 nucleotide sequences of each APV type were calculated and are shown in Table 3.
The nucleotide sequence identity of the L1 gene of TsPV1 and CsPV1 was 100%, but they were found to be highly divergent compared to other APVs (Table 3 and Figure 3). Specifically, the L1 gene of TsPV1 and CsPV1 shared approximately 64% pairwise identity with AplaPV1 and AplaPV3, and around 60% identity with members of the genus Etapapillomavirus, including ScPV1 and FcPV1. \Based on these sequence similarities, TsPV1 and CsPV1 likely belong to the same genus as AplaPV1 and AplaPV3 (which is yet to be assigned). However, the detected papillomaviruses likely meet the criteria to be classified under a novel papillomavirus genus, with the highest pairwise identity being approximately 64%.

4. Discussion

This study reports the characterisation of two novel avian papillomaviruses (APVs), TsPV1 and CsPV1, detected from swabs taken from the eye tissues of the sacred kingfisher and little corella, respectively. Both viruses exhibit typical papillomavirus genomic structures, comprising four core open reading frames (ORFs) for L1, L2, E1, and E2, as well as the additional E6 and E9 ORFs found in most papillomaviruses. The presence of conserved motifs and structural elements across both genomes, along with the high nucleotide identity observed between them (99.69%), suggests these viruses are closely related and may represent a unique evolutionary lineage within the avian papillomaviruses.
Although papillomaviruses have been extensively studied in humans and certain domestic animals, their prevalence and ecological dynamics in wild avian species remain relatively underexplored. This study’s finding of a relatively high prevalence rate (18.18%) of papillomaviruses in the sampled avian population is particularly noteworthy. The observed prevalence aligns with earlier reports suggesting that papillomaviruses may be more widespread among avian species than previously recognised [6,13]. Several factors may contribute to these elevated prevalence rates, including the host species’ ecological characteristics, environmental conditions, and the mechanisms of virus transmission within bird populations. For instance, gregarious or communal species such as the sacred kingfisher (T. sanctus) and the little corella (C. sanguinea) may facilitate viral spread through close physical contact or shared habitats [36].
In terms of genomic sequence identity, TsPV1 and CsPV1 demonstrated the highest similarity to papillomaviruses found in other avian species, with >56% nucleotide identity to a virus isolated from a mallard (wild duck) in the United States [7], and approximately 54% similarity to viruses in black-legged kittiwakes and Atlantic puffins from Canada [6]. The relatively low sequence identities compared to other APVs and their high similarity to each other suggest these viruses may be members of a distinct, previously unrecognized genus within the Papillomaviridae family. Moreover, the L1 gene of TsPV1 and CsPV1 shared approximately 64% pairwise identity with AplaPV1 and AplaPV3. Based on these sequence similarities, TsPV1 and CsPV1 are likely members of distinct species within the same genus as AplaPV1 and AplaPV3.
Our analysis highlights the E1 protein as a critical component for both TsPV1 and CsPV1, aligning with its role as the most conserved enzyme in papillomaviruses [32]. The E1 proteins of both viruses are 702 amino acids long, closely matching the sizes of other avian E1 proteins [6,7,37], which are generally longer than those of mammalian papillomaviruses [38]. The presence of conserved motifs, including the Walker A, B, and C domains, indicates that these viruses retain key functional domains essential for viral replication and helicase activity, which is necessary for efficient viral DNA replication.
The DNA-binding domain within the E2 protein, which regulates viral transcription and replication [34], is also highly conserved across TsPV1 and CsPV1, with the sequence 325GYTGQLKTIRHR336 being consistent with known APVs [6,7,37]. These conserved sequences highlight the evolutionary importance of E2’s regulatory function in the viral life cycle, particularly for maintaining control over viral genome replication and transcription [34].
In the L2 protein, conserved motifs such as the furin cleavage site, transmembrane GXXXG domains, and the SNX17- and syntaxin 18-binding motifs are consistent with those found in other APVs, suggesting conserved mechanisms for host cell entry, endosomal escape, and nuclear transport [12]. These findings underscore the critical role of the L2 protein in facilitating multiple steps of the infection process, from entry into host cells to trafficking within the host cytoplasm and nucleus.
Phylogenetic analyses, based on both the L1 gene and complete PVs genome sequences, reveal that TsPV1 and CsPV1 likely occupy an intermediate evolutionary position among APVs. The lack of strong bootstrap support in their phylogenetic positioning reflects their divergence from established avian papillomaviruses, which may indicate that these viruses represent an early branch or a novel sub-lineage. This is further supported by their high pairwise identity to each other and relatively low identity to other APVs, with the highest similarity in the L1 gene at ~64%—significantly below the threshold for species demarcation but close to the genus boundary. Moreover, according to the ICTV’s classification criteria [10], the L1 gene nucleotide divergence of TsPV1 and CsPV1 supports their designation as members of a new papillomavirus genus as AplaPV1, AplaPV3, distinct from currently known avian PV lineages. These findings contribute valuable insights into the diversity and evolutionary history of APVs and highlight the existence of yet-unknown viral lineages in avian species. This study also acknowledges the limitation of not including traditional viral isolation experiments. This constraint primarily stems from the initial limited sampling strategy, which was specifically designed for viral metagenomic analysis rather than for culture-based virus isolation.

5. Conclusions

The identification of TsPV1 and CsPV1 enriches our understanding of APVs, particularly those infecting non-traditional avian hosts such as the sacred kingfisher and little corella. The close genetic relationship between TsPV1 and CsPV1, coupled with their unique phylogenetic placement, suggests they may represent a novel papillomavirus genus. Future studies involving a broader range of avian hosts and geographic regions are essential to clarify the diversity and evolutionary pathways of APVs and to further elucidate the functional roles of conserved motifs in viral pathogenesis and host adaptation.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/pathogens14060514/s1, Table S1: Sampling details used in this study.

Author Contributions

Conceptualization: S.S., V.K. and M.J.; investigation: S.S., V.K. and M.J.; funding acquisition: S.S. and M.J.; formal analysis: S.S.; wet-lab experiments: S.S. and M.J.; data analysis S.S., M.M.R. and B.K.N.; data curation: S.S.; supervision: S.S. and M.J.; writing (original draft preparation): S.S.; writing (review and editing): S.S., V.K., M.M.R., B.K.N. and M.J. All authors have read and agreed to the published version of the manuscript.

Funding

This research received no external funding.

Institutional Review Board Statement

Approval for sampling from the euthanized birds was granted by the University of the Sunshine Coast Animal Research Ethics Committee under the approval of ANE1940 (dated 21 August 2019) and ANE2057 (dated 1 September 2020).

Informed Consent Statement

Not applicable.

Data Availability Statement

Nucleotide sequences and associated data for the TsPV1 and CsPV1 genomes are available in the DDBJ/EMBL/GenBank databases under accession numbers PP922140–PP922141. The raw sequencing data from this study have been deposited in the NCBI Sequence Read Achieve (SRA) under the accession numbers SRR31823170–SRR31823171 and the BioProject accession number: PRJNA1202390 (BioSample accession numbers: SAMN45957023–SAMN45957024).

Acknowledgments

Subir Sarker and Martina Jelocnik are the recipients of an Australian Research Council Discovery Early Career Researcher Awards (DE200100367 and DE190100238, respectively) funded by the Australian Government. The Australian Government had no role in the study design, data collection, data analysis, decision to publish, or the preparation of the manuscript. The authors would also like to acknowledge the attending veterinarian of Brisbane Bird and Exotics Veterinary Service, QLD-4120, for providing samples. The authors would like to acknowledge Arvind Varsani for his guidance in verifying and correcting the detected APV genomes in this study.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Varsani, A.; Kraberger, S.; Jennings, S.; Porzig, E.L.; Julian, L.; Massaro, M.; Pollard, A.; Ballard, G.; Ainley, D.G. A novel papillomavirus in Adélie penguin (Pygoscelis adeliae) faeces sampled at the Cape Crozier colony, Antarctica. J. Gen. Virol. 2014, 95, 1352–1365. [Google Scholar] [CrossRef] [PubMed]
  2. Nicholls, P.K.; Stanley, M.A. The immunology of animal papillomaviruses. Vet. Immunol. Immunopathol. 2000, 73, 101–127. [Google Scholar] [CrossRef]
  3. Campo, M.S. Papillomavirus and disease in humans and animals. Vet. Comp. Oncol. 2003, 1, 3–14. [Google Scholar] [CrossRef]
  4. Cubie, H.A. Diseases associated with human papillomavirus infection. Virology 2013, 445, 21–34. [Google Scholar] [CrossRef]
  5. Mifsud, J.C.O.; Hall, J.; Van Brussel, K.; Rose, K.; Parry, R.H.; Holmes, E.C.; Harvey, E. A novel papillomavirus in a New Zealand fur seal (Arctocephalus forsteri) with oral lesions. NPJ Viruses 2024, 2, 10. [Google Scholar] [CrossRef]
  6. Canuti, M.; Munro, H.J.; Robertson, G.J.; Kroyer, A.N.K.; Roul, S.; Ojkic, D.; Whitney, H.G.; Lang, A.S. New Insight into Avian Papillomavirus Ecology and Evolution from Characterization of Novel Wild Bird Papillomaviruses. Front. Microbiol. 2019, 10, 701. [Google Scholar] [CrossRef]
  7. Olivo, D.; Kraberger, S.; Varsani, A. New duck papillomavirus type identified in a mallard in Missouri, USA. Arch. Virol. 2024, 169, 77. [Google Scholar] [CrossRef]
  8. Sarker, S.; Talukder, S.; Athukorala, A.; Whiteley, P.L. The Spleen Virome of Australia’s Endemic Platypus Is Dominated by Highly Diverse Papillomaviruses. Viruses 2025, 17, 176. [Google Scholar] [CrossRef]
  9. Van Doorslaer, K. Revisiting Papillomavirus Taxonomy: A Proposal for Updating the Current Classification in Line with Evolutionary Evidence. Viruses 2022, 14, 2308. [Google Scholar] [CrossRef]
  10. Van Doorslaer, K.; Chen, Z.; Bernard, H.U.; Chan, P.K.S.; DeSalle, R.; Dillner, J.; Forslund, O.; Haga, T.; McBride, A.A.; Villa, L.L.; et al. ICTV Virus Taxonomy Profile: Papillomaviridae. J. Gen. Virol. 2018, 99, 989–990. [Google Scholar] [CrossRef]
  11. Buck, C.B.; Day, P.M.; Trus, B.L. The papillomavirus major capsid protein L1. Virology 2013, 445, 169–174. [Google Scholar] [CrossRef]
  12. Wang, J.W.; Roden, R.B.S. L2, the minor capsid protein of papillomavirus. Virology 2013, 445, 175–186. [Google Scholar] [CrossRef]
  13. Rector, A.; Van Ranst, M. Animal papillomaviruses. Virology 2013, 445, 213–223. [Google Scholar] [CrossRef]
  14. Bravo, I.G.; Félez-Sánchez, M. Papillomaviruses: Viral evolution, cancer and evolutionary medicine. Evol. Med. Public. Health 2015, 2015, 32–51. [Google Scholar] [CrossRef]
  15. Gottschling, M.; Stamatakis, A.; Nindl, I.; Stockfleth, E.; Alonso, Á.; Bravo, I.G. Multiple Evolutionary Mechanisms Drive Papillomavirus Diversification. Mol. Biol. Evol. 2007, 24, 1242–1258. [Google Scholar] [CrossRef]
  16. Shah, S.D.; Doorbar, J.; Goldstein, R.A. Analysis of Host–Parasite Incongruence in Papillomavirus Evolution Using Importance Sampling. Mol. Biol. Evol. 2010, 27, 1301–1314. [Google Scholar] [CrossRef]
  17. Chambers, G.; Ellsmore, V.A.; O’brien, P.M.; Reid, S.W.J.; Love, S.; Campo, M.S.; Nasir, L. Association of bovine papillomavirus with the equine sarcoid. J. General. Virol. 2003, 84, 1055–1062. [Google Scholar] [CrossRef]
  18. Gil da Costa, R.M.; Peleteiro, M.C.; Pires, M.A.; DiMaio, D. An Update on Canine, Feline and Bovine Papillomaviruses. Transbound. Emerg. Dis. 2016, 64, 1371–1379. [Google Scholar] [CrossRef]
  19. Lina, P.H.C.; van Noord, M.J.; de Groot, F.G. Detection of Virus in Squamous Papillomas of the Wild Bird Species Fringilla coelebs. JNCI J. Natl. Cancer Inst. 1973, 50, 567–571. [Google Scholar] [CrossRef]
  20. Di Francesco, C.E.; Profeta, F.; Romanucci, M.; Zuccarini, R.; Altea, T.; Malatesta, D.; Della Salda, L.; Marsilio, F. Evidence of avian poxvirus and papillomavirus infection in Gyps fulvus in Italy. Arch. Virol. 2019, 164, 291–295. [Google Scholar] [CrossRef]
  21. Gaynor, A.M.; Fish, S.; Duerr, R.S.; Cruz, F.N.D.; Pesavento, P.A. Identification of a Novel Papillomavirus in a Northern Fulmar (Fulmarus glacialis) with Viral Production in Cartilage. Vet. Pathol. 2014, 52, 553–561. [Google Scholar] [CrossRef] [PubMed]
  22. Tachezy, R.; Rector, A.; Havelkova, M.; Wollants, E.; Fiten, P.; Opdenakker, G.; Jenson, A.B.; Sundberg, J.P.; Van Ranst, M. Avian papillomaviruses: The parrot Psittacus erithacus papillomavirus (PePV) genome has a unique organization of the early protein region and is phylogenetically related to the chaffinch papillomavirus. BMC Microbiol. 2002, 2, 19. [Google Scholar] [CrossRef]
  23. Kasimov, V.; Wille, M.; Sarker, S.; Dong, Y.; Shao, R.; Hall, C.; Potvin, D.; Conroy, G.; Valenza, L.; Gillett, A.; et al. Unexpected Pathogen Diversity Detected in Australian Avifauna Highlights Potential Biosecurity Challenges. Viruses 2023, 15, 143. [Google Scholar] [CrossRef]
  24. Sarker, S.; Isberg, R.S.; Moran, L.J.; Araujo, D.R.; Elliott, N.; Melville, L.; Beddoe, T.; Helbig, J.K. Crocodilepox Virus Evolutionary Genomics Supports Observed Poxvirus Infection Dynamics on Saltwater Crocodile (Crocodylus porosus). Viruses 2019, 11, 1116. [Google Scholar] [CrossRef]
  25. Sarker, S.; Hannon, C.; Athukorala, A.; Bielefeldt-Ohmann, H. Emergence of a Novel Pathogenic Poxvirus Infection in the Endangered Green Sea Turtle (Chelonia mydas) Highlights a Key Threatening Process. Viruses 2021, 13, 219. [Google Scholar] [CrossRef]
  26. Bankevich, A.; Nurk, S.; Antipov, D.; Gurevich, A.A.; Dvorkin, M.; Kulikov, A.S.; Lesin, V.M.; Nikolenko, S.I.; Pham, S.; Prjibelski, A.D.; et al. SPAdes: A new genome assembly algorithm and its applications to single-cell sequencing. J. Comput. Biol. A J. Comput. Mol. Cell Biol. 2012, 19, 455–477. [Google Scholar] [CrossRef]
  27. Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic local alignment search tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
  28. Gilchrist, C.L.M.; Chooi, Y.-H. clinker & clustermap.js: Automatic generation of gene cluster comparison figures. Bioinform. 2021, 37, 2473–2475. [Google Scholar] [CrossRef]
  29. Hillary, W.; Lin, S.-H.; Upton, C. Base-By-Base version 2: Single nucleotide-level analysis of whole viral genome alignments. Microb. Inform. Exp. 2011, 1, 2. [Google Scholar] [CrossRef]
  30. Katoh, K.; Standley, D.M. MAFFT multiple sequence alignment software version 7: Improvements in performance and usability. Mol. Biol. Evol. 2013, 30, 772–780. [Google Scholar] [CrossRef]
  31. Franzosa, E.A.; Sirota-Madi, A.; Avila-Pacheco, J.; Fornelos, N.; Haiser, H.J.; Reinker, S.; Vatanen, T.; Hall, A.B.; Mallick, H.; McIver, L.J.; et al. Gut microbiome structure and metabolic activity in inflammatory bowel disease. Nat. Microbiol. 2019, 4, 293–305. [Google Scholar] [CrossRef] [PubMed]
  32. Bergvall, M.; Melendy, T.; Archambault, J. The E1 proteins. Virology 2013, 445, 35–56. [Google Scholar] [CrossRef]
  33. Kosugi, S.; Hasebe, M.; Tomita, M.; Yanagawa, H. Systematic identification of cell cycle-dependent yeast nucleocytoplasmic shuttling proteins by prediction of composite motifs. Proc. Natl. Acad. Sci. USA 2009, 106, 10171–10176. [Google Scholar] [CrossRef]
  34. McBride, A.A. The Papillomavirus E2 proteins. Virology 2013, 445, 57–79. [Google Scholar] [CrossRef]
  35. Fawaz, M.; Vijayakumar, P.; Mishra, A.; Gandhale, P.N.; Dutta, R.; Kamble, N.M.; Sudhakar, S.B.; Roychoudhary, P.; Kumar, H.; Kulkarni, D.D.; et al. Duck gut viral metagenome analysis captures snapshot of viral diversity. Gut Pathog. 2016, 8, 30. [Google Scholar] [CrossRef]
  36. Truchado, D.A.; Williams, R.A.J.; Benítez, L. Natural history of avian papillomaviruses. Virus Res. 2018, 252, 58–67. [Google Scholar] [CrossRef]
  37. Williams, R.A.J.; Tolf, C.; Waldenström, J. Molecular identification of papillomavirus in ducks. Sci. Rep. 2018, 8, 9096. [Google Scholar] [CrossRef]
  38. McBride, A.A. Human papillomaviruses: Diversity, infection and host interactions. Nat. Rev. Microbiol. 2022, 20, 95–108. [Google Scholar] [CrossRef]
Figure 1. (A) A genomic illustration of TsPV1 and CsPV1 in comparison with the selected APVs, visualized using Geneious Prime. The arrows depict the direction of the transcription of genes and open reading frames (ORFs). Each ORF of the APV genomes is colour coded and homologous genes are shown using their specific colour. Hyp indicates genes encoding a hypothetical protein. The Walker domains of the E1 helicase are highlighted in panel (B) (alignment positions 530–640), while specific protein domains of the L2 protein are shown in panel (C) (alignment positions 1–190). The domain designation and typical sequences of each motif are indicated below and above the alignments. TsPV1 and CsPV1 are the novel types identified in this study.
Figure 1. (A) A genomic illustration of TsPV1 and CsPV1 in comparison with the selected APVs, visualized using Geneious Prime. The arrows depict the direction of the transcription of genes and open reading frames (ORFs). Each ORF of the APV genomes is colour coded and homologous genes are shown using their specific colour. Hyp indicates genes encoding a hypothetical protein. The Walker domains of the E1 helicase are highlighted in panel (B) (alignment positions 530–640), while specific protein domains of the L2 protein are shown in panel (C) (alignment positions 1–190). The domain designation and typical sequences of each motif are indicated below and above the alignments. TsPV1 and CsPV1 are the novel types identified in this study.
Pathogens 14 00514 g001
Figure 2. Phylogenetic relationships between papillomaviruses detected in this study and other selected APVs. Maximum likelihood (ML) trees were constructed from multiple alignments of the L1 gene (A) and nucleotide sequences of the selected complete PVs genomes (B) using Geneious Prime (version 2023.1.1). The numbers on the branches represent bootstrap values as percentages. The labels at the branch tips refer to abbreviated virus names and GenBank accession numbers, followed by the host species in parentheses. The positions of the APVs detected in this study are highlighted in pink. Bootstrap values lower than 60 are not shown. Human papillomavirus 41 (GenBank accession number, X56147) was used as an outgroup. The details of the APVs used in the phylogenetic tree are provided in Table 1.
Figure 2. Phylogenetic relationships between papillomaviruses detected in this study and other selected APVs. Maximum likelihood (ML) trees were constructed from multiple alignments of the L1 gene (A) and nucleotide sequences of the selected complete PVs genomes (B) using Geneious Prime (version 2023.1.1). The numbers on the branches represent bootstrap values as percentages. The labels at the branch tips refer to abbreviated virus names and GenBank accession numbers, followed by the host species in parentheses. The positions of the APVs detected in this study are highlighted in pink. Bootstrap values lower than 60 are not shown. Human papillomavirus 41 (GenBank accession number, X56147) was used as an outgroup. The details of the APVs used in the phylogenetic tree are provided in Table 1.
Pathogens 14 00514 g002
Figure 3. A visual comparison of L1 gene amino acids from the selected avian papillomaviruses using Base-By-Base. Differences and indels in the L1 gene between PV sequences in this study (TsPV1 and CsPV1) and other avian papillomaviruses are shown in different colours (green = insertion, blue = substitution, red = deletion).
Figure 3. A visual comparison of L1 gene amino acids from the selected avian papillomaviruses using Base-By-Base. Differences and indels in the L1 gene between PV sequences in this study (TsPV1 and CsPV1) and other avian papillomaviruses are shown in different colours (green = insertion, blue = substitution, red = deletion).
Pathogens 14 00514 g003
Table 1. Comparative genomic analysis of representative APVs.
Table 1. Comparative genomic analysis of representative APVs.
Papillomavirus NameGenusSpeciesGenBank Accession NumbersLength (nt)HostAbbreviationPairwise Genomic Identity (%) _TsPV1Pairwise Genomic Identity (%) _CsPV1
Todiramphus sanctus papillomavirus 1 unclassifiedunclassifiedPP922140.17883Todiramphus sanctus (Sacred kingfisher)TsPV1 99.69
Cacatua sanguinea papillomavirus 1unclassifiedunclassifiedPP922141.17825Cacatua sanguinea (Little corella)CsPV199.69
Psittacus erithacus papillomavirus 1ThetapapillomavirusThetapapillomavirus 1AF502599.17304Psittacus erithacus (African grey parrot)PePV152.9852.17
Fringilla coelebs papillomavirus 1EtapapillomavirusEtapapillomavirus 1AY057109.17729Fringilla coelebs (Common chaffinch)FcPV150.3049.76
Francolinus leucoscepus papillomavirus 1DyoepsilonpapillomavirusDyoepsilonpapillomavirus 1EU188799.17498Pternistis leucoscepus (Yellow-necked francolin)FlPV150.7850.46
Chelonia mydas papillomavirus 1DyozetapapillomavirusDyozetapapillomavirus 1EU493091.16953Chelonia mydas (Green sea turtle)CmPV146.0245.34
Caretta caretta papillomavirus 1DyozetapapillomavirusDyozetapapillomavirus 1EU493092.17020Caretta caretta (Loggerhead sea turtle)CcPV146.2245.43
Pygoscelis adeliae papillomavirus 1TreisepsilonpapillomavirusTreisepsilonpapillomavirus 1KJ173785.17637Pygoscelis adeliae (Adélie penguin)PaPV151.7151.47
Fulmarus glacialis papillomavirus 1TreiszetapapillomavirusTreiszetapapillomavirus 1KJ452243.18132Fulmarus glacialis (Northern fulmar)FgPV145.3244.19
Pygoscelis adeliae papillomavirus 2TreisepsilonpapillomavirusTreisepsilonpapillomavirus 1MF168943.17654Pygoscelis adeliae (Adélie penguin)PaPV251.4151.74
Serinus canaria papillomavirus 1Etapapillomavirusunclassified EtapapillomavirusMF564196.18071Serinus canaria (Atlantic canary)ScPV150.3550.13
Fratercula arctica papillomavirus 1unclassifiedunclassifiedMK620302.17703Fratercula arctica (Atlantic puffin)FarcPV154.5054.17
Duck papillomavirus 3unclassifiedunclassifiedMK620303.17887Anas platyrhynchos (Mallard)AplaPV154.3053.89
Larus smithsonianus papillomavirus 1unclassifiedunclassifiedMK620304.17699Larus smithsonianus (American herring gull)LsmiPV154.3054.04
Rissa tridactyla papillomavirus 2unclassifiedunclassifiedMK620305.17763Rissa tridactyla (Black-legged Kittiwake)RtriPV154.5754.20
Anas platyrhynchos papillomavirus 2unclassifiedunclassifiedMW888448.18350Anas platyrhynchos (Mallard or wild duck)AplaPV245.2845.79
Anas platyrhynchos papillomavirus 3unclassifiedunclassifiedPP057987.17839Anas platyrhynchos (Mallard or wild duck)AplaPV356.6656.39
Table 2. Detected PVs’ genome annotations and comparative analysis of ORF.
Table 2. Detected PVs’ genome annotations and comparative analysis of ORF.
Gene SyntenyGenome Coordinatesnt SizeAA SizeBest Blast Hits (GenBank Accession Number)ProductSimilarity (%)Note
Todiramphus sanctus papillomavirus 1 (TsPV1, GenBank accession no. PP922140.1)
ORF01318–629312103Duck papillomavirus 3 (QBR99466.1)E644.44
ORF02693–28012109702Duck papillomavirus 3 (QBR99468.1)E164.84
ORF03823–1440618205Serinus canaria papillomavirus 1 (YP_009551917.1)E929.85
ORF042722–39181197398Gull papillomavirus 1 (QBR99477.1)E238.65
ORF073939–55701632543Duck papillomavirus (ANN29878.1)L245.36
ORF085558–71081551516 Duck papillomavirus 3 (QBR99472.1)L165.05
ORF067110–7556447148 hypothetical gene
Cacatua sanguinea papillomavirus 1 (CsPV1, GenBank accession no. PP922141.1)
ORF01318–629312103Duck papillomavirus 3 (QBR99466.1)E644.44
ORF02717–28252109702Duck papillomavirus 3 (QBR99468.1)E164.84
ORF03808–1464657218Serinus canaria papillomavirus 1 (YP_009551917.1)E929.85
ORF042746–39421197398Gull papillomavirus 1 (QBR99477.1)E238.90
ORF053950–55541605534Duck papillomavirus (ANN29878.1)L244.90
ORF065542–70921551516Duck papillomavirus 3 (QBR99472.1)L165.05
ORF077136–7516381126 hypothetical gene
Table 3. Average pairwise nucleotide identities of L1 gene among APVs.
Table 3. Average pairwise nucleotide identities of L1 gene among APVs.
1234567891011121314151617
1TsPV1-PP922140
2CsPV1-PP922141 100
3AplaPV1-MK62030363.1463.14
4AplaPV2-MW88844849.8949.8950.17
5AplaPV3-PP05798764.2464.2472.7351.68
6FlPV1-EU188799555561.7549.1061.84
7PePV1-AF50259959.6559.6560.7147.7061.6559.66
8RtriPV1-MK62030560.1360.1360.4248.5559.7557.1658.16
9LsmiPV1-MK62030457.8157.8160.3249.2359.9757.4957.1268.38
10PaPV2-MF16894356.1956.1958.7049.4458.2355.4756.9159.0660.51
11FarcPV1-MK62030258.9458.9460.7149.4060.5359.5958.4970.0469.4559.87
12PaPV1-KJ17378556.7456.7460.8951.3559.0259.0457.2059.5359.4165.1562.60
13FcPV1-AY05710959.7259.7259.9550.3559.2055.3356.5755.4454.8454.4857.0754.38
14ScPV1-MF56419660.0860.0859.3749.4160.0154.6256.8456.5755.0854.3456.6554.6464.86
15CmPV1-EU49309149.8349.8351.7747.9550.7148.6050.9648.4447.8850.2450.0750.0747.8149.62
16CcPV1-EU49309251.7251.7252.9248.6952.9550.2749.8350.8548.5950.8351.6850.3149.2151.5870.91
17FgPV1-KJ45224349.8649.8650.2163.1850.7049.3150.2549.6848.7750.6348.8749.2548.6350.4946.7947.67
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Sarker, S.; Kasimov, V.; Rahaman, M.M.; Nath, B.K.; Jelocnik, M. Discovery and Genomic Characterisation of Novel Papillomaviruses in Australian Wild Birds. Pathogens 2025, 14, 514. https://doi.org/10.3390/pathogens14060514

AMA Style

Sarker S, Kasimov V, Rahaman MM, Nath BK, Jelocnik M. Discovery and Genomic Characterisation of Novel Papillomaviruses in Australian Wild Birds. Pathogens. 2025; 14(6):514. https://doi.org/10.3390/pathogens14060514

Chicago/Turabian Style

Sarker, Subir, Vasilli Kasimov, Md. Mizanur Rahaman, Babu Kanti Nath, and Martina Jelocnik. 2025. "Discovery and Genomic Characterisation of Novel Papillomaviruses in Australian Wild Birds" Pathogens 14, no. 6: 514. https://doi.org/10.3390/pathogens14060514

APA Style

Sarker, S., Kasimov, V., Rahaman, M. M., Nath, B. K., & Jelocnik, M. (2025). Discovery and Genomic Characterisation of Novel Papillomaviruses in Australian Wild Birds. Pathogens, 14(6), 514. https://doi.org/10.3390/pathogens14060514

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop