Next Article in Journal
Seasonal Variability and Pathogenicity of Kiwifruit Bacterial Canker Pathogens in Sichuan Province, China
Previous Article in Journal
First Complete Genome of Reticuloendotheliosis Virus in a Mallard Duck from Brazil: Phylogenetic Insights and Evolutionary Analysis
Previous Article in Special Issue
The Course of COVID-19 and Long COVID: Identifying Risk Factors among Patients Suffering from the Disease before and during the Omicron-Dominant Period
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

In Silico Analysis and Transcriptional Profiling of A Putative Metalloprotease ADAMTSL as A Potential Tick Antigen against Rhipicephalus microplus

by
Cesar Onoshi Sedano-Juarez
1,
Ninnet Gómez-Romero
2,
Miguel Ángel Alonso-Díaz
3,
América Ivette Barrera-Molina
4,
David Emanuel Reyes-Guerrero
5 and
Rodolfo Lagunes-Quintanilla
5,*
1
Facultad de Medicina Veterinaria y Zootecnia, Universidad Nacional Autónoma de México, Avenida Universidad 3000, Ciudad de México 04510, Mexico
2
Departamento de Microbiología e Inmunología, Facultad de Medicina Veterinaria y Zootecnia, Universidad Nacional Autónoma de México, Avenida Universidad 3000, Ciudad de México 04510, Mexico
3
Centro de Enseñanza, Investigación y Extensión en Ganadería Tropical, Facultad de Medicina Veterinaria y Zootecnia, Universidad Nacional Autónoma de México, Km. 5.5 Carretera Federal Tlapacoyan-Martínez de La Torre, Martínez de La Torre 93600, Mexico
4
Facultad de Nutrición, Universidad Autónoma del Estado de Morelos, Calle Ixtaccíhuatl 100, Vista Hermosa, Cuernavaca 62350, Mexico
5
Centro Nacional de Investigación Disciplinaria en Salud Animal e Inocuidad—INIFAP, Carretera Federal Cuernavaca—Cuautla 8534, Col. Progreso, Jiutepec 62550, Mexico
*
Author to whom correspondence should be addressed.
Pathogens 2025, 14(2), 190; https://doi.org/10.3390/pathogens14020190
Submission received: 31 December 2024 / Revised: 7 February 2025 / Accepted: 10 February 2025 / Published: 14 February 2025
(This article belongs to the Special Issue Infectious Diseases and Vaccine Technology Research)

Abstract

The cattle tick, Rhipicephalus microplus, is the most significant ectoparasite in the cattle industry. The application of acaricides constitutes the main control method. However, inadequate treatments have serious drawbacks, including the appearance of multi-resistant ticks. Tick vaccines offer a safe and economically sustainable alternative for controlling R. microplus. Nevertheless, the efficacy of existing vaccines has been limited by polymorphisms in target antigens among strains from different geographical regions. In this study, we characterized a putative Metalloprotease from the ADAMTSL family. We analyzed three regions to evaluate their transcriptional profiling in different R. microplus tick tissues, using two constitutive genes (β-tubulin and Elfa-1) as references. The expression levels showed that ADAMTSL-R1 was upregulated 39.37-fold (p ≤ 0.05) in salivary glands. The ADAMTSL-R2 showed the highest expression, rising 7.69-fold (p ≤ 0.05) in ovaries and up to 59.39-fold (p ≤ 0.05) in egg mass. Furthermore, this region showed the highest level of conservation among Rhipicephalus isolates. The ADAMTSL-R3 was upregulated only in the egg mass. The results of this study provide a basis for future research focused on elucidating the role of these protein variants in tick biology, including their feeding mechanisms and potential implications in pathogen transmission. Understanding these factors may aid in developing an effective tick vaccine.

1. Introduction

The cattle tick, Rhipicephalus microplus, is a hematophagous arthropod distributed in the tropical and subtropical regions of Africa, Australia, and Latin America (32° N, 32° S). This species represents the most important challenge in the cattle industry, as it has the potential to transmit pathogens responsible for diseases such as babesiosis (Babesia bovis and Babesia bigemina) and anaplasmosis (Anaplasma marginale) [1]. The cattle industry is affected by decreased milk production, lower reproductive rates, and increased veterinary costs due to acaricide treatments. Additionally, intensive use, improper practices, and the genetic plasticity of R. microplus have led to resistance against most acaricide products, including organophosphates, pyrethroids, amidines, phenylpyrazolones, and macrocyclic lactones [2]. Globally, approximately one billion cattle are at risk of infestation by R. microplus, resulting in estimated annual economic losses ranging from USD 22 to 30 billion [3]. Alternative approaches have included using different cattle breeds, pasture management, plants as tick repellents or acaricides, microbial control, and anti-tick vaccines [4].
Anti-tick vaccines have become one of the most promising alternatives for managing R. microplus infestations, offering advantages such as specificity, environmental safety, improved animal and human health, easy administration, and cost reduction [5]. The recombinant Bm86 antigen is the only commercially available worldwide. However, its efficacy was limited due to genetic polymorphisms in the Bm86 sequence, which differed across geographic regions and tick populations [6]. Therefore, in recent years, methodological approaches have been studied to identify new targets for developing anti-tick vaccines using reverse vaccinology, which integrates functional genomics, in silico analysis, and systems biology [7]. The discovery of tick antigens against R. microplus has been particularly challenging due to the lack of a complete genome in databases. This is primarily attributed to its complexity, as the genome is approximately 7.1 Gb long, with 70% consisting of highly repetitive sequences, making its assembly exceptionally difficult [8]. However, transcriptomes from different tissues of adult R. microplus ticks, including ovaries [9], salivary glands, and larvae [10,11], have been reported. Recent studies have facilitated the identification of innovative vaccine antigen candidates. The evaluation of synthetic and recombinant proteins is currently underway to assess their potential to elicit protective immunity in cattle infested by R. microplus [7,12]. Furthermore, this approach has led to identifying target antigens (such as peptides and epitopes) that trigger the production of specific antibodies, which interfere with tick feeding [13,14]. Recently, it has been known that ticks have evolved mechanisms of evasion of the host immune response by producing a complex mixture of bioactive compounds (peptides/proteins, nucleic acids, and other molecules) through the tick’s salivary glands [15]. One of these proteins is metalloprotease, a multifunctional protein involved in various biological processes in vertebrates regulating physiological and pathological functions [16]. In ticks, these proteins are essential for embryogenesis and maintaining feeding-related functions, as they facilitate the degradation of fibrin and fibrinogen [17,18], enabling the tick to feed continuously from the host.
Metalloproteases have been studied, and some development has been undertaken as a tick vaccine against R. microplus infestations. Vaccination with rBrRm-MP4 demonstrated an overall efficacy of 60%, significantly reducing tick number, oviposition, and egg hatching, demonstrating its potential as a tick vaccine candidate [19]. Moreover, multicomponent vaccines combining recombinant antigens, such as Rm39, Rm76, Rm180, and Rm239, have achieved even higher efficacy, reducing R. microplus infestation by 73.2% in immunized cattle [20]. For this reason, the present work aimed to characterize a putative metalloprotease from the ADAMTSL (a disintegrin and metalloproteinase with thrombospondin type 1 repeats/motif-like) family using bioinformatics and functional transcriptomics approaches to evaluate the physicochemical and immunogenic properties. Subsequently, we identified three regions to evaluate the transcriptional profiling in different R. microplus tick tissues.

2. Materials and Methods

2.1. Ticks

The R. microplus (Susceptible “Media Joya”) adult female ticks and larvae were obtained from laboratory colonies kept at the Tick Laboratory of the National Center of Disciplinary Research in Animal Health and Safety from the National Institute for Forestry, Agricultural and Livestock Research (CENID-SAI, INIFAP) in Jiutepec, Morelos, Mexico. This tick strain was collected initially from cattle infested in Tapalpa, Jalisco, Mexico (19°56′41.0″ N 103°45′27.0″ W).

2.2. In Silico Analysis

An in silico analysis was conducted on the metalloprotease–disintegrin protein belonging to the ADAMTSL family. The genomic, coding DNA, and amino acid sequences were identified and retrieved from the National Center for Biotechnology Information (NCBI) database (GenBank accession no. ADK62391.1 and HM748961.1). A comprehensive bioinformatics workflow was employed to characterize the protein. Protein family and domain predictions were performed using UniProtKB (https://www.uniprot.org/ accessed on 1 February 2023) [21] and Interpro (https://www.ebi.ac.uk/interpro/ accessed on 1 February 2023) [22] to identify functional domains within the amino acid sequence. The physicochemical properties, including molecular weight, protein size, theoretical isoelectric point (PI), amino acid composition, half-life, instability index, aliphatic index, and hydrophobicity, were analyzed using ProtParam (https://web.expasy.org/protparam/ accessed on 15 February 2023) [23]. Secondary structure analysis was conducted with ProtScale (https://web.expasy.org/protscale/ accessed on 17 February 2023) [23], employing the Kyte and Doolittle algorithm to identify hydrophobic regions; values above 1.6 indicate hydrophobic residues, while values below 1.6 indicate hydrophilic residues. Transmembrane regions were predicted using TMHMM 2.0 (https://services.healthtech.dtu.dk/services/TMHMM-2.0/ accessed on 21 February 2023) [24]. The signal peptide was assessed with SignalP 6.0 (https://services.healthtech.dtu.dk/services/SignalP-6.0/ accessed on 21 February 2023) [25], and potential glycosylation sites were predicted with NetNGlyc-1.0 (https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/ accessed on 24 February 2023) using the 0.5 glycosylation threshold [26]. The presence of linear B-cell epitopes was assessed using the following prediction tools: EMBOSS Antigenic (https://www.bioinformatics.nl/cgi-bin/emboss/antigenic accessed on 6 March 2023), considering an antigenic score ≥ 1.0 [27]; BepiPred-2.0 (http://www.cbs.dtu.dk/services/BepiPred/ accessed on 8 March 2023) using the 0.5 antigenicity threshold established by default [28]; and Predicting Antigenic Peptides (http://imed.med.ucm.es/Tools/antigenic.html accessed on 10 March 2023) using the Kolaskar and Tongaonkar algorithm with a score > 1.0. The overlapping amino acid sequences in the B-cell epitopes predicted by at least two tools were defined as the consensus predicted epitopes. Tertiary structure prediction was performed using the AlphaFold server (https://alphafoldserver.com/ accessed on 22 July 2024) [29] and SWISS-MODEL based on homology modeling (https://swissmodel.expasy.org/interactive accessed on 18 March 2024) [30]. Finally, molecular surface graphics of the hydrophobicity profiles, electrostatic potential distributions, and 3D model visualizations presented in this study were created using UCSF ChimeraX (https://www.rbvi.ucsf.edu/chimerax accessed on 3 April 2024) [31].

2.3. Sequence Analysis

Twenty-three nucleotide sequences were retrieved from GenBank for comparison with the metalloprotease–disintegrin sequence. The nucleotide and deduced amino acid sequences were analyzed using BioEdit Sequence Alignment Editor 7.2.5 for putative polymorphism. Further, amino acid sequences from each isolate were grouped according to identity/similarity using the SIAS tool (http://imed.med.ucm.es/Tools/sias.html accessed on 27 December 2024). Based on the information of the amino acid residues, it was investigated if there could be any putative antigenic change in the epitopes in the three regions selected, ADAMTSL-R1, ADAMTSL-R2, and ADAMTSL-R3, from available Rhipicephalus isolates using Jalview software version 2.11.4.1.

2.4. RNA Extraction and cDNA Synthesis

Five fully developed R. microplus (Susceptible “Media Joya”) female ticks were collected and washed thoroughly in PBS. The dorsal cuticle was dissected with a scalpel blade, and the salivary glands, midgut, and ovaries were separated using fine-tipped forceps, washed twice in PBS, and stored at −70 °C until used. Additionally, 100 mg of egg mass and unfed tick larvae were used for the experiment. Total RNA was extracted from the homogenized tick samples and pulverized in a frozen mortar using TRIzol reagent (Thermo Scientific®, Waltham, MA, USA) according to the manufacturer’s instructions. Briefly, 200 μL of chloroform were added to 1 mL of TRIZOL containing the homogenized samples, vortexed, and incubated for 5 min at room temperature (RT). The RNA-containing aqueous phase was centrifuged at 12,000× g for 10 min at 4 °C and transferred to a new tube. The RNA was precipitated by mixing an equal volume of isopropanol, and the pellets were obtained by centrifugation at 12,000× g for 10 min at 4 °C. The total RNA pellets were resuspended in diethylpyrocarbonate (DEPC)-treated water. The concentration was determined spectrophotometrically at 260 nm using a nanophotometer (Implen, Westlake Village, CA, USA), and the purity was assessed by the 260/280 nm optical density ratio. Only samples with ratios between 1.8 and 2.2 were included in subsequent analyses. Synthesis of cDNA was carried out from 5 μg of total RNA using RevertAid First Strand cDNA Synthesis (Thermo Scientific®, Waltham, MA, USA). The cDNA was subsequently used as a template to amplify the three regions selected from the metalloprotease–disintegrin protein.

2.5. RT-qPCR Assays

Primers were designed based on the immunogenic properties and functional domains of the metalloprotease–disintegrin protein from the R. microplus. This study identified three regions, ADAMTSL-R1, ADAMTSL-R2, and ADAMTSL-R3, along with the housekeeping genes β-tubulin and Elfa-1. The qPCR assays were performed in 0.2 mL nuclease-free tubes with a final volume of 20 μL per replication of each sample and analyzed in quadruplicate. The assays were prepared using commercial GoTaq® qPCR Master Mix 2× (Promega, Madison, WI, USA) at a primer concentration of 20 μM. The amplification process was carried out using a Rotor-Gene thermocycler (Corbett 6000 Research, Qiagen, Hilden, Germany) with the following cycling conditions: an initial denaturation step at 95 °C for 5 min, followed by 40 cycles of denaturation at 95 °C for 10 s, alignment at 60 °C for 30 s, and extension at 72 °C for 30 s. Finally, the amplicons were analyzed by electrophoresis on 1% agarose gels stained with ethidium bromide and visualized under UV light using a Kodak Gel Logic 1500 Imaging System (Rochester, NY, USA).

2.6. Relative Expression

Relative expression analysis was estimated based on the cycle threshold values (Ct) per region and housekeeping gene. The larval stage was used as a control, and its gene expression was compared with that of the egg mass, midgut, ovaries, and salivary glands. The relative expression was performed using the 2−(ΔΔCt) method with β-tubulin and Elfa-1 as standardizing genes [32]. The data analysis was conducted using the Qiagen® GeneGlobe Data Analysis Center platform (https://geneglobe.qiagen.com/mx/analyze accessed on 10 August 2023). The platform provided ΔCt, ΔΔCt, and fold change values for the groups of interest calculated as the ratio of the standardized expression of the interest group genes 2−ΔCt to the standardized expression of the control group genes 2−ΔCt. The 2−(ΔΔCt) values for each region and gene per group were automatically analyzed using Student’s t-test with a significance level of 0.05%.

3. Results

3.1. Bioinformatic Characterization

3.1.1. Family and Functional Domains

The ADAMTSL protein sequence consists of 2727 amino acids, encoded by a coding sequence (CDS) of 8181 bp distributed across 40 exons. The analysis revealed that the protein belongs to the disintegrin and metalloproteinase with thrombospondin motif (ADAMTS/ADAMTS-like) family. In addition, the domain prediction resulted in conserved peptides identified in the following order: one ADAM-TS spacer 1 (130–244), six thrombospondin type-1 (TSP1) domains (253–312, 315–371, 411–460, 461–517, 524–586, 588–642), 10 pancreatic trypsin inhibitor Kunitz (Kunitz/BPTI) domains (1436–1486, 1495–1545, 1554–1604, 1613–1663, 1675–1725, 1733–1783, 1801–1851, 1858–1908, 1925–1975, 2002–2052), one WAP-type domain (2184–2237), three immunoglobulin I-set (Ig-like) domains (2281–2360, 2370–2442, 2502–2575), and one protease and lacunin (PLAC) domain (2583–2622).

3.1.2. Physicochemical Analysis and Cellular Location and Structure

The physicochemical analysis predicted a molecular weight of 295.8 kDa, a PI of 5, an instability index of 5, an aliphatic index of 49.59, and a hydropathy index of −0.507. The predicted half-life of the designed construct was 1.1 h (in vitro in mammalian reticulocytes), 3 min (in vivo in yeast), and 2 min (in vivo in E. coli). The cellular localization analysis revealed that ADAMTSL lacks a signal peptide and does not contain transmembrane regions. The tertiary structure prediction generated by AlphaFold 3 indicates that the protein is composed mainly of loops (green), followed by sheets (yellow), and, to a lesser extent, helices (red) (Figure 1a). The electrostatic potential analysis revealed a surface gradient transitioning from red (regions with a high negative charge) to blue (regions with a high positive charge), suggesting that the ADAMTSL protein surface mainly exhibits low electrostatic potential (Figure 1b). The structural surface analysis showed that the protein primarily consists of hydrophilic regions (dark cyan) (Figure 1c). This observation is corroborated by the hydropathy plot, generated using the Kyte and Doolittle algorithm, which indicates that over 85% of the amino acid residues have a value below 1.6 (Figure 1d).

3.1.3. Immunogenic Analysis

The immunogenic analysis revealed that the ADAMTSL protein contains potential linear epitopes throughout its amino acid sequence (Figure 2a). The sequences of the epitopes with the highest scores are shown in Table 1. Based on the expression levels and their location within the coding regions of the ADAMTSL gene, two epitopes were selected for their potential immunogenic properties and presence in regions of interest for expression analysis. The ADAMTSL-R1 region includes YRPVCRLVNKAGHCPVAEVEAQPAAVVRADCRDVCRVDADCPDIRK-CCYNGCAHVCVQAVVTEVTTVQTS, which is located in the WAP domain, while the ADAMTSL-R2 region includes SLELCKQRCAHVVAPAVVDTP, situated in the Kunitz/BPTI domain. Both analyzed epitopes are located on the surface of the ADAMTSL protein, making them accessible to immune system molecules (Figure 2b).

3.2. Analysis of the Metalloprotease–Disintegrin (ADAMTSL)

The amino acid alignment of the ADAMTSL-R1 region revealed 16 variable sites. Notably, the amino acid changes at positions 44, 63, 134, 163, and 167 are specific to the R. sanguineus isolates and are not found in the R. microplus and R. appendiculatus isolates. In contrast, the substitutions at positions 67, 126, and 170 are unique to R. sanguineus and R. appendiculatus, with no changes observed in the R. microplus isolates. Additionally, the R. sanguineus isolates contain four extra amino acids at positions 101–104 compared to the R. microplus isolates. Conversely, amino acids in positions 101–120 are absent from the isolates of R. appendiculatus. Interestingly, within the R. microplus isolates, only two amino acid changes were detected at positions 118 and 140 (Figure 3). In the ADAMTSL-R2 region, the amino acid alignment predicted 19 variable sites. The amino acid substitutions at positions 10, 23, 54, 57, 76, 79, 105, 108, 109, 110, and 112 are characteristic of the R. sanguineus isolates, distinguishing them from the R. microplus and R. appendiculatus isolates. In contrast, amino acid residues at positions 7, 80, and 92 are conserved in the R. microplus isolates, while the R. sanguineus and R. appendiculatus isolates share the same amino acid changes at these positions. Overall, the amino acid alignment of the ADAMTSL-R2 region shows a high level of conservation among isolates of Rhipicephalus species (Figure 4). No amino acid changes were observed in the ADAMTSL-R3 region (Figure 5).

3.3. Relative Expression

A comparative analysis of ADAMTSL-R1, ADAMTSL-R2, and ADAMTSL-R3 was conducted by comparing the relative expression values of each region. Significant differences (p ≤ 0.05) were evaluated among the tissues analyzed, including egg mass, larvae, salivary glands, midgut, and ovaries of R. microplus (Table 2). ADAMTSL-R2 exhibited the highest expression frequency across the tissues, increasing by 7.69-fold (p ≤ 0.05) in the ovaries and up to 59.39-fold (p ≤ 0.05) in the R. microplus egg mass. The ADAMTSL-R1 region showed an increase in expression levels in the salivary glands, reaching up to 39.37-fold (p ≤ 0.05). In general, both ADAMTSL-R1 and ADAMTSL-R2 were upregulated in all the tissues (Figure 6). In contrast, ADAMTSL-R3 was upregulated only in the egg mass. Non-significant (p > 0.05) overexpression values were observed for this region of salivary glands, midgut, and ovaries (Figure 7).

4. Discussion

Recent advancements in omics sciences have revolutionized vaccine development by incorporating bioinformatics tools for analyzing genomic, transcriptomic, and proteomic data, facilitating the identification of promising vaccine candidates. Research that integrates transcription profiling analyses with a reverse vaccinology approach offers a robust framework for recognizing novel prophylactic targets. This combination presents sustainable and efficient strategies for protecting cattle against tick infestations. Following this approach, bioinformatic characterization of a putative metalloprotease from the ADAMTSL family was performed. These are secreted extracellular matrix (ECM) regulatory proteins that play critical roles in tissue development, homeostasis, repair, and regeneration [33].
The identified ADAMTSL protein primarily comprises hydrophilic regions exposed to the extracellular space. No transmembrane or intracellular regions were detected, suggesting that ADAMTSL is secreted into the extracellular environment, similar to ECM proteins. This characteristic is important, as proteins secreted into the extracellular space are recognized as suitable antigens for vaccine development due to their accessibility to the host’s immune system [34,35,36]. The proteins secreted by ticks are crucial in pathogen transmission, feeding, and immune modulation. They are key components of tick biology and promising targets for developing novel vaccine antigens [37]. Moreover, no signal peptide was identified in the analyzed amino acid sequence, which may be due to the reported genetic sequence being “partially sequenced”, suggesting that the signal peptide could be present in the undetermined region of the protein.
In this study, bioinformatic analyses revealed the presence of linear B cell epitopes, suggesting that the ADAMTSL protein contains several regions capable of eliciting a strong immune response, which could be valuable for vaccine development targeting R. microplus. Furthermore, the desirable features for a vaccine candidate should include being encoded by a single gene, expressed across tick tissues and life cycle, playing a key role in tick biology, not sharing homology with the host Bos taurus, and being capable of stimulating both B and T cells to trigger an immune humoral response [38,39]. Our findings are promising, as this approach has demonstrated effectiveness in previous studies focused on immunizing cattle [40,41,42,43]. However, future validation of these epitopes through experimental methods will be required to confirm their immunogenicity and potential for protective immunity.
Upon identifying a candidate antigen for developing an anti-tick vaccine, it is important to produce a sufficient quantity of the antigen for subsequent validation processes. Depending on the antigen’s nature, biotechnological techniques should be employed to express the antigen in some host systems, such as bacteria, yeast, mammalian, or insect cells. Chemical synthesis may also be utilized. On the other hand, it is important to consider the immunogen formulation with carrier proteins or adjuvants as a part of the solution to enhance the immunogenicity, routes of administration, and immunization schedule. Once the experimental model for testing new antigens is established, the selected mammalian host must be immunized with the antigen, which is expected to generate a strong and long-lasting immune response [44].
The three-dimensional structure of the target protein revealed a model with 70.6% sequence identity to a protein from the tick Ixodes ricinus (GenBank accession no. A0A6B0VED9). This high sequence identity suggests a reliable structural homology that provides insights into potential molecular functions. The homologous protein is also associated with serine protease inhibition, playing key roles in blood feeding, blood flow regulation, host angiogenesis disruption, and wound healing [45,46]. The consistent conservation of the protein structure, particularly in the Kunitz/BPTI domains, across tick species, as supported by both predictive tools, highlights the likelihood of a similar functional role. Moreover, the shared presence of functional domains, including BPTI/Kunitz, WAP, Ig-like, and PLAC, further supports this hypothesis. These domains are known for their involvement in protease inhibition and host response modulation, essential for tick survival and pathogenicity [47]. Additionally, predictive analysis of N-glycosylation sites revealed the presence of 33 glycosylation sites distributed across the 2727 amino acids of the analyzed sequence. However, no N-glycosylation sites were detected in the ADAMTSL-R1, ADAMTSL-R2, and ADAMTSL-R3 regions. The role of glycosylation in tick vaccine antigens has not been fully elucidated, but it is suggested to play a significant role in influencing antigenicity, immunogenicity, and host immune recognition [48,49]. However, the absence of glycosylation sites may facilitate the expression of antigens (epitope-containing peptides) in bacterial recombinant expression systems, which are cost-effective, scalable, and easy to handle [50,51].
Interestingly, a comparative transcription profile analysis revealed that ADAMTSL-R1, which contains Kunitz/BPTI domains and an epitope with immunogenic characteristics, was overexpressed in the salivary glands; these findings are consistent with those reported by Tirloni [52], who identified increased transcripts levels of metalloproteases in the salivary structures of partially engorged R. microplus ticks. According to studies conducted by Dai [46] and Alim [53], the expression of mRNA-encoding proteins with Kunitz/BPTI domains is upregulated during blood-feeding processes in the host. In addition, these kinds of proteins have been extensively documented in tick species [11,54,55] and identified in the salivary glands of R. microplus ([52], this study), I. scapularis [17,56], I. ricinus [57], I. persulcatus, and R. sanguineus [58]. These findings suggest that the metalloprotease–disintegrin (ADAMTSL) plays a key role in the parasite-host interaction, facilitating successful blood feeding.
ADAMTSL-R2, which comprises WAP and Ig domains, was upregulated in the egg mass and showed the highest level of conservation among the Rhipicephalus isolates. Firstly, this upregulation may be attributed to the role of certain metalloproteases in mediating interactions with embryonic morphogenetic proteins and their involvement in energy metabolism during embryogenesis [59,60,61]. In addition, it is posited that secreted proteins may contribute to the immune response during the embryonic development of R. microplus ticks [62]. Secondly, as discussed previously, it is essential to study proteins in full detail, analyzing the genetic variability from tick species in specific geographical locations to avoid polymorphisms directly affecting the development of anti-tick vaccines [63,64]. Finally, ADAMTSL-R3 was upregulated exclusively in the egg mass, which supports the hypothesis that this protein plays a key role during embryogenesis, regulating ADAMTS protease activity and ECM remodeling [65].
Overall, the comparative analysis of transcription profiles revealed that ADAMTSL-R1, ADAMTSL-R2, and ADAMTSL-R3 were overexpressed at varying levels across the analyzed tissues. This observation can be explained by the documented occurrence of alternative splicing events in ADAMTSL family proteins, including papilin in Caenorhabditis elegans [66] and Drosophila melanogaster [67]. Moreover, it has been hypothesized that a specific alternative splicing region may lead to the loss or gain of Kunitz/BPTI and Ig-like domains [68,69]. According to Kramerova [67], ADAMTSL proteins, such as papilin, are critical for extracellular matrix organization, cellular rearrangement, and the modulation of metalloprotease activity during organogenesis. In fact, RNAi-mediated suppression of papilin expression in C. elegans leads to alterations in basal membrane formation and embryonic lethality, suggesting that papilin is important for nematode embryogenesis [66]. In arthropods, RNAi disruption in Nilaparvata lugens causes phenotypic defects, such as egg non-hatching and abnormal embryo development [70].

5. Conclusions

This is the first report to provide bioinformatic characterization, immunological analysis, and transcriptional profiling of three specific regions of a protein belonging to the ADAMTSL family in different R. microplus tick tissues. These findings indicate that ADAMTSL-R1, ADAMTSL-R2, and ADAMTSL-R3 show significantly differing expression levels throughout the egg mass and larval stages, as well as in adult tissues, including the salivary glands, midgut, and ovaries of R. microplus. Furthermore, analyses of the ADAMTSL-R2 region showed a significant level of conservation among Rhipicephalus isolates, demonstrating the presence of epitopes within the putative metalloprotease ADAMTSL protein. In addition, the presence of immunogenic regions within ADAMTSL proteins highlights their potential as candidates for anti-tick vaccines. However, additional research is required to investigate the genetic and physiological diversity among tick isolates from several geographical regions and across tick species; this knowledge would be important to develop an effective anti-tick vaccine. Finally, targeting these proteins could interfere with tick development and reproduction, offering a sustainable and effective alternative to controlling R. microplus infestations.

6. Patents

The work presented in this manuscript is part of an ongoing patent application.

Author Contributions

C.O.S.-J.: methodology, formal analysis, writing—original draft preparation. N.G.-R.: methodology, conceptualization, validation. M.Á.A.-D.: supervision, visualization. A.I.B.-M.: supervision, visualization. D.E.R.-G.: methodology, investigation, validation. R.L.-Q.: funding acquisition, project administration, supervision, writing—review and editing. All authors have read and agreed to the published version of the manuscript.

Funding

This research was partly funded by INIFAP-Mexico, grant number 12273735667.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The databases analyzed during the current study are available from the corresponding author upon reasonable request.

Acknowledgments

Cesar Onoshi Sedano Juarez was supported by a CONAHCYT fellowship (827742) for master’s degree studies.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Oyen, K.; Poh, K.C. Rhipicephalus microplus (Southern cattle tick; Asian blue tick). Trends Parasitol. 2024, 41, 68–69. [Google Scholar] [CrossRef] [PubMed]
  2. Torrents, J.; Sarli, M.; Rossner, M.V.; Toffaletti, J.R.; Morel, N.; Martínez, N.C.; Webster, A.; Mangold, A.J.; Guglielmone, A.A.; Nava, S. Resistance of the cattle tick Rhipicephalus (Boophilus) microplus to ivermectin in Argentina. Res. J. Vet. Sci. 2020, 132, 332–337. [Google Scholar] [CrossRef] [PubMed]
  3. Lew-Tabor, A.E.; Rodriguez Valle, M. A review of reverse vaccinology approaches for the development of vaccines against ticks and tick-borne diseases. Ticks Tick-Born Dis. 2016, 7, 573–585. [Google Scholar] [CrossRef]
  4. Lagunes-Quintanilla, R.; Gómez-Romero, N.; Mendoza-Martínez, N.; Castro-Saines, E.; Galván-Arellano, D.; Basurto-Alcantara, F.J. Perspectives on using integrated tick management to control Rhipicephalus microplus in a tropical region of Mexico. Front. Vet. Sci. 2024, 11, 1497840. [Google Scholar] [CrossRef]
  5. Silva, L.A.; Ali, A.; Termignoni, C.; Vaz, I.D. Vaccination against Rhipicephalus microplus: An alternative to chemical control? Cienc. Rural 2023, 54, e20230161. [Google Scholar] [CrossRef]
  6. Bishop, L.J.; Stutzer, C.; Maritz-Olivier, C. More than Three Decades of Bm86: What We Know and Where to Go. J. Pathog. 2023, 12, 1071. [Google Scholar] [CrossRef]
  7. Pereira, D.F.; Ribeiro, H.S.; Gonçalves, A.A.; Da Silva, A.V.; Lair, D.F.; De Oliveira, D.S.; Boas, D.F.; Conrado, I.D.; Leite, J.C.; Barata, L.M.; et al. Rhipicephalus microplus: An overview of vaccine antigens against the cattle tick. Ticks Tick-Born Dis. 2022, 13, 101828. [Google Scholar] [CrossRef]
  8. Barrero, R.A.; Guerrero, F.D.; Black, M.; McCooke, J.; Chapman, B.; Schilkey, F.; Pérez de León, A.A.; Miller, R.J.; Bruns, S.; Dobry, J.; et al. Gene-enriched draft genome of the cattle tick Rhipicephalus microplus: Assembly by the hybrid Pacific Biosciences/Illumina approach enabled analysis of the highly repetitive genome. Int. J. Parasitol. 2017, 47, 569–583. [Google Scholar] [CrossRef]
  9. Heekin, A.M.; Guerrero, F.D.; Bendele, K.G.; Saldivar, L.; Scoles, G.A.; Dowd, S.E.; Gondro, C.; Nene, V.; Djikeng, A.; Brayton, K.A. The ovarian transcriptome of the cattle tick, Rhipicephalus (Boophilus) microplus, feeding upon a bovine host infected with Babesia bovis. Parasit. Vectors 2013, 6, 276. [Google Scholar] [CrossRef]
  10. Garcia, G.R.; Chaves Ribeiro, J.M.; Maruyama, S.R.; Gardinassi, L.G.; Nelson, K.; Ferreira, B.R.; Andrade, T.G.; de Miranda Santos, I.K. A transcriptome and proteome of the tick Rhipicephalus microplus shaped by the genetic composition of its hosts and developmental stage. Sci. Rep. 2020, 10, 12857. [Google Scholar] [CrossRef]
  11. Tirloni, L.; Braz, G.R.; Nunes, R.D.; Gandara, A.C.P.; Vieira, L.R.; Assumpção, T.C.; Sabadin, G.A.; Da Silva, R.M.; Guizzo, M.G.; Machado, J.A.; et al. A physiologic overview of the organ-specific transcriptome of the cattle tick Rhipicephalus microplus. Sci. Rep. 2020, 10, 18296. [Google Scholar] [CrossRef] [PubMed]
  12. Mendoza-Martínez, N.; Alonso-Díaz, M.A.; Merino, O.; Fernández-Salas, A.; Lagunes-Quintanilla, R. Protective efficacy of the peptide Subolesin antigen against the cattle tick Rhipicephalus microplus under natural infestation. Vet. Parasitol. 2021, 299, 109577. [Google Scholar] [CrossRef] [PubMed]
  13. Parvizpour, S.; Pourseif, M.M.; Razmara, J.; Rafi, M.A.; Omidi, Y. Epitope-based vaccine design: A comprehensive overview of bioinformatics approaches. Drug Discov. Today 2020, 25, 1034–1042. [Google Scholar] [CrossRef] [PubMed]
  14. Gong, H.R.; Hu, Y.; Li, X.; Yau, T.; Zhang, B.Z.; Huang, J.D. Non-Neutralizing Epitopes Shade Neutralizing Epitopes against Omicron in a Multiple Epitope-Based Vaccine. ACS Infect. Dis. 2022, 8, 2586–2593. [Google Scholar] [CrossRef]
  15. Šimo, L.; Kazimirova, M.; Richardson, J.; Bonnet, S.I. The Essential Role of Tick Salivary Glands and Saliva in Tick Feeding and Pathogen Transmission. Front. Cell. Infec. Microbiol. 2017, 7, 281. [Google Scholar] [CrossRef]
  16. Kessenbrock, K.; Plaks, V.; Werb, Z. Matrix Metalloproteinases: Regulators of the Tumor Microenvironment. Cell 2010, 141, 52–67. [Google Scholar] [CrossRef]
  17. Francischetti, I.M.; Mather, T.N.; Ribeiro, J.M.C. Cloning of a salivary gland metalloprotease and characterization of gelatinase and fibrin(ogen)lytic activities in the saliva of the Lyme disease tick vector Ixodes scapularis. Bioch. Biophys. Res. Comm. 2003, 305, 869–875. [Google Scholar] [CrossRef]
  18. Ranasinghe, S.; McManus, D.P. Structure and function of invertebrate Kunitz serine protease inhibitors. Dev. Comp. Immunol. 2013, 39, 219–227. [Google Scholar] [CrossRef]
  19. Ali, A.; Parizi, L.F.; Garcia-Guizzo, M.; Tirloni, L.; Seixas, A.; da Silva Vaz, I.; Termignoni, C. Immunoprotective potential of a Rhipicephalus (Boophilus) microplus metalloprotease. Vet. Parasitol. 2015, 207, 107–114. [Google Scholar] [CrossRef]
  20. Maruyama, S.R.; García, G.; Teixeira, F.R.; Brandão, L.A.C.; Anderson, J.M.; Ribeiro, J.M.C.; Valenzuela, J.G.; Horáčková, J.; VeríSsimo, C.J.; Katiki, L.M.; et al. Mining a differential sialotranscriptome of Rhipicephalus microplus guides antigen discovery to formulate a vaccine that reduces tick infestations. Parasit. Vectors 2017, 10, 206. [Google Scholar] [CrossRef]
  21. Coudert, E.; Gehant, S.; de Castro, E.; Pozzato, M.; Baratin, D.; Neto, T.; Sigrist, C.; Redaschi, N.; Bridge, A. Annotation of biologically relevant ligands in UniProtKB using ChEBI. Bioinformatics 2023, 39, 793–798. [Google Scholar] [CrossRef] [PubMed]
  22. Blum, M.; Andreeva, A.; Florentino, L.C.; Chuguransky, S.R.; Grego, T.; Hobbs, E.; Pinto, B.L.; Orr, A.; Paysan-Lafosse, T.; Ponamareva, I.; et al. InterPro: The protein sequence classification resource in 2025. Nucleic Acids Res. 2024, 20, 1082. [Google Scholar] [CrossRef] [PubMed]
  23. Wilkins, M.R.; Gasteiger, E.; Bairoch, A.; Sanchez, J.C.; Williams, K.L.; Appel, R.D.; Hochstrasser, D.F. Protein identification and analysis tools in the ExPASy server. Methods Mol. Biol. 2005, 112, 531–552. [Google Scholar] [CrossRef]
  24. Krogh, A.; Larsson, B.; von Heijne, G.; Sonnhammer, E.L. Predicting transmembrane protein topology with a hidden Markov model: Application to complete genomes. J. Mol. Biol. 2001, 305, 567–580. [Google Scholar] [CrossRef]
  25. Teufel, F.; Almagro-Armenteros, J.J.; Johansen, A.R. SignalP 6.0 predicts all five types of signal peptides using protein language models. Nat. Biotechnol. 2022, 40, 1023–1025. [Google Scholar] [CrossRef]
  26. Gupta, R.; Brunak, S. Prediction of glycosylation across the human proteome and the correlation to protein function. Biocomputing 2002, 7, 310–322. [Google Scholar]
  27. Rice, P.; Longden, I.; Bleasby, A. EMBOSS: The European Molecular Biology Open Software Suite. Trends Genet. 2000, 16, 276–277. [Google Scholar] [CrossRef]
  28. Larsen, J.E.; Lund, O.; Nielsen, M. Improved method for predicting linear B-cell epitopes. Immunome Res. 2006, 2, 2. [Google Scholar] [CrossRef][Green Version]
  29. Abramson, J.; Adler, J.; Dunger, J.; Evans, R.; Green, T.; Pritzel, A.; Ronneberger, O.; Willmore, L.; Ballard, A.J.; Bambrick, J.; et al. Accurate structure prediction of biomolecular interactions with AlphaFold 3. Nature 2024, 630, 493–500. [Google Scholar] [CrossRef]
  30. Waterhouse, A.; Bertoni, M.; Bienert, S.; Studer, G.; Tauriello, G.; Gumienny, R.; Heer, F.T.; de Beer, T.A.; Rempfer, C.; Bordoli, L.; et al. SWISS-MODEL: Homology modelling of protein structures and complexes. Nucleic Acids Res. 2018, 46, W296–W303. [Google Scholar] [CrossRef]
  31. Pettersen, E.F.; Goddard, T.D.; Huang, C.C.; Meng, E.C.; Couch, G.S.; Croll, T.I.; Morris, J.H.; Ferrin, T.E. UCSF ChimeraX: Structure visualization for researchers, educators, and developers. Protein Sci. 2021, 30, 70–82. [Google Scholar] [CrossRef] [PubMed]
  32. Nijhof, A.M.; Balk, J.A.; Postigo, M. Selection of reference genes for quantitative RT-PCR studies in Rhipicephalus (Boophilus) microplus and Rhipicephalus appendiculatus ticks and determination of the expression profile of Bm86. BMC Mol. Biol. 2009, 10, 112. [Google Scholar] [CrossRef] [PubMed]
  33. Karamanos, N.K.; Theocharis, A.D.; Piperigkou, Z.; Manou, D.; Passi, A.; Skandalis, S.S.; Vynios, D.H.; Orian-Rousseau, V.; Ricard-Blum, S.; Schmelzer, C.E.H.; et al. A guide to the composition and functions of the extracellular matrix. FEBS J. 2021, 288, 6850–6912. [Google Scholar] [CrossRef]
  34. Flower, D.R. Bioinformatics for Vaccinology, 1st ed.; Wiley-Blackwell: Oxford, UK, 2008. [Google Scholar]
  35. Flower, D.R.; Macdonald, I.K.; Ramakrishnan, K.; Davies, M.; Doytchinova, I. Computer aided selection of candidate vaccine antigens. Immunome Res. 2010, 6, S1. [Google Scholar] [CrossRef]
  36. Obolo-Mvoulouga, P.; Oleaga, A.; Manzano-Román, R.; Pérez-Sánchez, R. Evaluation of the protective efficacy of Ornithodoros moubata midgut membrane antigens selected using omics and in silico prediction algorithms. Ticks Tick-Borne Dis. 2018, 9, 1158–1172. [Google Scholar] [CrossRef]
  37. Chmelar, J.; Kotál, J.; Kovaríková, A.; Kotsyfakis, M. The use of tick salivary proteins as novel therapeutics. Front. Physiol. 2019, 10, 812. [Google Scholar] [CrossRef]
  38. Stutzer, C.; Richards, S.A.; Ferreira, M.; Baron, S.; Maritz-Olivier, C. Metazoan Parasite Vaccines: Present Status and Future Prospects. Front. Cell. Infect. Microbiol. 2018, 8, 67. [Google Scholar] [CrossRef]
  39. Couto, J.; Seixas, G.; Stutzer, C.; Olivier, N.A.; Maritz-Olivier, C.; Antunes, S.; Domingos, A. Probing the Rhipicephalus bursa sialomes in potential anti-tick vaccine candidates: A reverse vaccinology approach. Biomedicines 2021, 9, 363. [Google Scholar] [CrossRef]
  40. Guerrero, F.D.; Andreotti, R.; Bendele, K.G.; Cunha, R.C.; Miller, R.J.; Yeater, K.M.; De León, A.A. Rhipicephalus (Boophilus) microplus aquaporin as an effective vaccine antigen to protect against cattle tick infestations. Parasit. Vectors. 2014, 7, 475–487. [Google Scholar] [CrossRef]
  41. Lagunes, R.; Domínguez-García, D.; Quiroz, H.; Martínez-Velázquez, M.; Rosario-Cruz, R. Potential effects on Rhipicephalus microplus tick larvae fed on calves immunized with a Subolesin peptide predicted by epitope analysis. Trop. Biomed. 2016, 33, 726–738. [Google Scholar]
  42. De Sousa Neves, E.; Fidelis, C.F.; Tafur-Gómez, G.A.; de Araujo, L.; Vargas, M.I.; Sossai, S.; Prates-Patarroyo, P.A. Bovine immunisation with a recombinant peptide derived from synthetic SBm7462® (Bm86 epitope construct) immunogen for Rhipicephalus microplus control. Ticks Tick-Borne Dis. 2020, 11, 101461. [Google Scholar] [CrossRef]
  43. Coate, R.; Alonso-Díaz, M.Á.; Martínez-Velázquez, M.; Castro-Saines, E.; Hernández-Ortiz, R.; Lagunes-Quintanilla, R. Testing Efficacy of a Conserved Polypeptide from the Bm86 Protein against Rhipicephalus microplus in the Mexican Tropics. Vaccines 2023, 11, 1267. [Google Scholar] [CrossRef] [PubMed]
  44. Rodríguez-Mallon, A. Developing Anti-tick Vaccines. In Vaccine Design, 1st ed.; Humana Press: New York, NY, USA, 2016; Volume 2, pp. 243–259. [Google Scholar] [CrossRef]
  45. Islam, M.K.; Tsuji, N.; Miyoshi, T.; Alim, M.A.; Huang, X.; Hatta, T.; Fujisaki, K. The Kunitz-like modulatory protein haemangin is vital for hard tick blood-feeding success. PLoS Pathog. 2009, 5, e1000497. [Google Scholar] [CrossRef] [PubMed]
  46. Dai, S.; Zhang, A.; Huang, J. Evolution, expansion and expression of the Kunitz/BPTI gene family associated with long-term blood feeding in Ixodes Scapularis. BMC Evol. Biol. 2012, 12, 4. [Google Scholar] [CrossRef]
  47. Kotál, J.; Langhansová, H.; Lieskovská, J.; Andersen, J.F.; Francischetti, I.M.; Chavakis, T.; Kopecký, J.; Pedra, J.H.; Kotsyfakis, M.; Chmelař, J. Modulation of host immunity by tick saliva. J. Proteom. 2015, 128, 58–68. [Google Scholar] [CrossRef]
  48. De la Fuente, J.; Canales, M.; Kocan, K.M. The importance of protein glycosylation in development of novel tick vaccine strategies. Parasite Immunol. 2006, 28, 687–688. [Google Scholar] [CrossRef]
  49. Dowling, W.; Thompson, E.; Badger, C.; Mellquist, J.L.; Garrison, A.R.; Smith, J.M.; Paragas, J.; Hogan, R.J.; Schmaljohn, C. Influences of glycosylation on antigenicity, immunogenicity, and protective efficacy of ebola virus GP DNA vaccines. J. Virol. 2007, 81, 1821–1837. [Google Scholar] [CrossRef]
  50. Rosano, G.L.; Ceccarelli, E.A. Recombinant protein expression in Escherichia coli: Advances and challenges. Front. Microbiol. 2014, 5, 172. [Google Scholar] [CrossRef]
  51. Vieira Gomes, A.; Souza Carmo, T.; Silva Carvalho, L.; Mendonça Bahia, F.; Parachin, N. Comparison of Yeasts as Hosts for Recombinant Protein Production. Microorganisms 2018, 6, 38. [Google Scholar] [CrossRef]
  52. Tirloni, L.; Reck, J.; Terra, R.M.; Martins, J.R.; Mulenga, A.; Sherman, N.E.; Fox, J.W.; Yates, J.R.; Termignoni, C.; Pinto, A.F.; et al. Proteomic Analysis of Cattle Tick Rhipicephalus (Boophilus) microplus Saliva: A Comparison between Partially and Fully Engorged Females. PLoS ONE 2014, 9, e94831. [Google Scholar] [CrossRef]
  53. Alim, M.A.; Islam, M.K.; Anisuzzaman; Miyoshi, T.; Hatta, T.; Yamaji, K.; Matsubayashi, M.; Fujisaki, K.; Tsuji, N. A hemocyte-derived Kunitz-BPTI-type chymotrypsin inhibitor, HlChI, from the ixodid tick Haemaphysalis longicornis, plays regulatory functions in tick blood-feeding processes. Insect Biochem. Mol. Biol. 2012, 42, 925–934. [Google Scholar] [CrossRef] [PubMed]
  54. Lima, C.A.; Torquato, R.J.; Sasaki, S.D.; Justo, G.Z.; Tanaka, A.S. Biochemical characterization of a Kunitz type inhibitor similar to dendrotoxins produced by Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) hemocytes. Vet. Parasitol. 2010, 167, 279–287. [Google Scholar] [CrossRef] [PubMed]
  55. Schwarz, A.; Cabezas-Cruz, A.; Kopecký, J.; Valdés, J.J. Understanding the evolutionary structural variability and target specificity of tick salivary Kunitz peptides using next generation transcriptome data. BMC Evol. Biol. 2014, 14, 4. [Google Scholar] [CrossRef] [PubMed]
  56. Kazimírová, M.; Štibrániová, I. Tick salivary compounds: Their role in modulation of host defences and pathogen transmission. Front. Cell. Infect. Microbiol. 2013, 3, 43. [Google Scholar] [CrossRef]
  57. Decrem, Y.; Beaufays, J.; Blasioli, V.; Lahaye, K.; Brossard, M.; Vanhamme, L.; Godfroid, E. A family of putative metalloproteases in the salivary glands of the tick Ixodes ricinus. FEBS J. 2008, 275, 1485–1499. [Google Scholar] [CrossRef]
  58. Ali, A.; Tirloni, L.; Isezaki, M.; Seixas, A.; Konnai, S.; Ohashi, K.; Da Silva Vaz, I.; Termignoni, C. Reprolysin metalloproteases from Ixodes persulcatus, Rhipicephalus sanguineus and Rhipicephalus microplus ticks. Exp. Appl. Acarol. 2014, 63, 559–578. [Google Scholar] [CrossRef]
  59. Tsutsui, K.; Manabe, R.; Yamada, T.; Nakano, I.; Oguri, Y.; Keene, D.R.; Sengle, G.; Sakai, L.Y.; Sekiguchi, K. ADAMTSL-6 is a novel extracellular matrix protein that binds to fibrillin-1 and promotes fibrillin-1 fibril formation. J. Biol. Chem. 2010, 285, 4870–4882. [Google Scholar] [CrossRef]
  60. Kotsarenko, K.; Vechtova, P.; Hammerova, Z.; Langova, N.; Malinovska, L.; Wimmerova, M.; Sterba, J.; Grubhoffer, L. Newly identified DNA methyltransferases of Ixodes ricinus ticks. Ticks Tick-Borne Dis. 2020, 11, 101348. [Google Scholar] [CrossRef]
  61. Tang, Q.; Cheng, T.; Liu, W. Egg Protein Compositions over Embryonic Development in Haemaphysalis hystricis Ticks. Animal 2024, 14, 3466. [Google Scholar] [CrossRef]
  62. Santos, V.T.; Ribeiro, L.; Fraga, A.; de Barros, C.M.; Campos, E.; Moraes, J.; Fontenele, M.R.; Araújo, H.M.; Feitosa, N.M.; Logullo, C.; et al. The embryogenesis of the tick Rhipicephalus (Boophilus) microplus: The establishment of a new chelicerate model system. Genesis 2013, 51, 803–818. [Google Scholar] [CrossRef]
  63. García-García, J.E.; González, I.L.; González, D.M.; Valdés, M.; Méndez, L.; Lamberti, J.; B’Agostino, B.; Citroni, D.; Fragoso, H.; Ortiz, M.; et al. Sequence variations in the Boophilus microplus Bm86 locus and implications for immunoprotection in cattle vaccinated with this antigen. Exp. Appl. Acarol. 1999, 23, 883–895. [Google Scholar] [CrossRef] [PubMed]
  64. Lugo-Caro del Castillo, S.M.; Hernández-Ortiz, R.; Gómez-Romero, N.; Martínez-Velázquez, M.; Castro-Saines, E.; Lagunes-Quintanilla, R. Genetic diversity of the ATAQ gene in Rhipicephalus microplus collected in Mexico and implications as anti-tick vaccine. Parasitol. Res. 2020, 119, 3523–3529. [Google Scholar] [CrossRef] [PubMed]
  65. Moolhuijzen, P.M.; Lew-Tabor, A.E.; Morgan, J.A.; Valle, M.R.; Peterson, D.G.; Dowd, S.E.; Guerrero, F.D.; Bellgard, M.I.; Appels, R. The complexity of Rhipicephalus (Boophilus) microplus genome characterised through detailed analysis of two BAC clones. BMC Res. Notes 2011, 4, 254. [Google Scholar] [CrossRef] [PubMed]
  66. Kawano, T.; Zheng, H.; Merz, D.C.; Kohara, Y.; Tamai, K.K.; Nishiwaki, K.; Culotti, J.G. C. elegans mig-6 encodes papilin isoforms that affect distinct aspects of DTC migration, and interacts genetically with mig-17 and collagen IV. Development 2009, 136, 1433–1442. [Google Scholar] [CrossRef]
  67. Kramerova, I.A.; Kawaguchi, N.; Fessler, L.I.; Nelson, R.E.; Chen, Y.; Kramerov, A.A.; Kusche-Gullberg, M.; Kramer, J.M.; Ackley, B.D.; Sieron, A.L.; et al. Papilin in development; a pericellular protein with a homology to the ADAMTS metalloproteinases. Development 2000, 127, 5475–5485. [Google Scholar] [CrossRef]
  68. Kramerova, I.A.; Kramerov, A.A.; Fessler, J.H. Alternative splicing of papilin and the diversity of Drosophila extracellular matrix during embryonic morphogenesis. Developmental dynamics. Dev. Dyn. Off. Publ. Am. Assoc. Anat. 2003, 226, 634–642. [Google Scholar] [CrossRef]
  69. Taye, N.; Redhead, C.; Hubmacher, D. Secreted ADAMTS-like proteins as regulators of connective tissue function. Am. J. Physiol. Cell Physiol. 2024, 326, C756–C767. [Google Scholar] [CrossRef]
  70. Zhang, C.; Zhang, J.Y.; Wang, N.; Abou El-Ela, A.S.; Shi, Z.Y.; You, Y.Z.; Ali, S.A.; Zhou, W.W.; Zhu, Z.R. RNAi-mediated knockdown of papilin gene affects the egg hatching in Nilaparvata lugens. Pest Manag. Sci. 2024, 80, 4779–4789. [Google Scholar] [CrossRef]
Figure 1. Structural in silico analysis. (a) The structural ensemble of the ADAMTSL (ADK62391.1) protein was predicted using the BetaAlphaFold 3 server. The color code indicates secondary structure: red (helix), yellow (sheet), and green (loop). (b) The electrostatic surface analysis was generated using the ChimeraX coulombic command. The surfaces are colored to represent electrostatic potential energy values, ranging from the lowest (red, −10) to the highest (blue, +10). (c) The hydrophobicity profile was generated using the ChimeraX mlp command. The surfaces indicate hydrophobic properties, ranging from hydrophilic (dark cyan, −20) to hydrophobic (gold, +20). (d) The Kyte and Doolittle hydropathy plot derived from the amino acid sequence of the ADAMTSL protein classifies regions as hydrophobic and hydrophilic.
Figure 1. Structural in silico analysis. (a) The structural ensemble of the ADAMTSL (ADK62391.1) protein was predicted using the BetaAlphaFold 3 server. The color code indicates secondary structure: red (helix), yellow (sheet), and green (loop). (b) The electrostatic surface analysis was generated using the ChimeraX coulombic command. The surfaces are colored to represent electrostatic potential energy values, ranging from the lowest (red, −10) to the highest (blue, +10). (c) The hydrophobicity profile was generated using the ChimeraX mlp command. The surfaces indicate hydrophobic properties, ranging from hydrophilic (dark cyan, −20) to hydrophobic (gold, +20). (d) The Kyte and Doolittle hydropathy plot derived from the amino acid sequence of the ADAMTSL protein classifies regions as hydrophobic and hydrophilic.
Pathogens 14 00190 g001
Figure 2. Prediction of antigenic regions through bioinformatic analysis. (a) Linear epitope prediction using BepiPred-2.0. Residues with scores above the threshold (0.5) are predicted to be part of an epitope and are colored yellow. (b) The surface regions colored blue show the epitope present in ADAMTSL-R1, while the regions in red show the epitope found in ADAMTSL-R2.
Figure 2. Prediction of antigenic regions through bioinformatic analysis. (a) Linear epitope prediction using BepiPred-2.0. Residues with scores above the threshold (0.5) are predicted to be part of an epitope and are colored yellow. (b) The surface regions colored blue show the epitope present in ADAMTSL-R1, while the regions in red show the epitope found in ADAMTSL-R2.
Pathogens 14 00190 g002
Figure 3. Amino acid alignment of ADAMTSL-R1 region. The sequences between R. microplus, R. sanguineus, and R. appendiculatus isolates were analyzed. Conservation plot scores show amino acid changes in specific positions in the protein region.
Figure 3. Amino acid alignment of ADAMTSL-R1 region. The sequences between R. microplus, R. sanguineus, and R. appendiculatus isolates were analyzed. Conservation plot scores show amino acid changes in specific positions in the protein region.
Pathogens 14 00190 g003
Figure 4. Amino acid alignment of ADAMTSL-R2 region. The sequences between R. microplus, R. sanguineus, and R. appendiculatus isolates were analyzed. Conservation plot scores show amino acid changes in specific positions in the protein region.
Figure 4. Amino acid alignment of ADAMTSL-R2 region. The sequences between R. microplus, R. sanguineus, and R. appendiculatus isolates were analyzed. Conservation plot scores show amino acid changes in specific positions in the protein region.
Pathogens 14 00190 g004
Figure 5. Amino acid alignment of ADAMTSL-R3 region. The sequences between R. microplus, R. sanguineus, and R. appendiculatus isolates were analyzed. Conservation plot scores show amino acid changes in specific positions in the protein region.
Figure 5. Amino acid alignment of ADAMTSL-R3 region. The sequences between R. microplus, R. sanguineus, and R. appendiculatus isolates were analyzed. Conservation plot scores show amino acid changes in specific positions in the protein region.
Pathogens 14 00190 g005
Figure 6. Relative transcript accumulation of ADAMTSL-R1, ADAMTSL-R2, and ADAMTSL-R3 in free life stages and adults’ tissue of R. microplus. The expression level of ADAMTSL showed variability among regions of interest. Differences were considered statistically significant when p < 0.05. (a) Control vs. salivary glands. (b) Control vs. midgut. (c) Control vs. ovaries. (d) Control vs. egg mass.
Figure 6. Relative transcript accumulation of ADAMTSL-R1, ADAMTSL-R2, and ADAMTSL-R3 in free life stages and adults’ tissue of R. microplus. The expression level of ADAMTSL showed variability among regions of interest. Differences were considered statistically significant when p < 0.05. (a) Control vs. salivary glands. (b) Control vs. midgut. (c) Control vs. ovaries. (d) Control vs. egg mass.
Pathogens 14 00190 g006
Figure 7. Expression heat map for each region in different R. microplus tick tissues. The color green represents a low expression level, and the red color represents a high expression level.
Figure 7. Expression heat map for each region in different R. microplus tick tissues. The color green represents a low expression level, and the red color represents a high expression level.
Pathogens 14 00190 g007
Table 1. Epitopes identified in aminoacidic sequence of ADAMTSL protein.
Table 1. Epitopes identified in aminoacidic sequence of ADAMTSL protein.
ResidueEpitope SequenceDomain
2184–2237* YRPVCRLVNKAGHCPVAEVEAQPAAVVRADCRDVCRVDADCPDIRKCCYNGCAHVCVQAVVTEVTTVQTSWAP
523–641ESTKECVVDAVCNGTTSP1
1927–1976* SLELCKQRCAHVVAPAVVDTPKunitz_BPTI
2473–2573GNEVVTVDVVIATIg-like
2363–2451HQKVSHVTNLVVYVPATIRPSSATVTVTVSEIg-like
1493–1546PDACLLPKVVGPCDGQKunitz/BPTI
222–232ETILIVLLYQEN/A
1343–1357GCECQNLVYGCCPDGN/A
2140–2167DHRGCVQCRCSNPCETFSCHEAELCRIEN/A
998–1002EGCCVVTEFGCCRDNN/A
2569–2590NQSVSVHIVMDDIHVPESCTDSIg-like
1242–1261EGCICSRLLYGCCPDDVTPAN/A
410–460IREVVCINPTSP1
Residues with the highest score are shown in bold. * Indicates the sequences analyzed for their relative expression.
Table 2. Comparative expression of different regions of ADAMTSL gene in tissues of Rhipicephalus microplus.
Table 2. Comparative expression of different regions of ADAMTSL gene in tissues of Rhipicephalus microplus.
TissueRelative Expression
ADAMTSL-R1ADAMTSL-R2ADAMTSL-R3
Egg mass10.32 *59.32 *15.89 *
Salivary glands39.37 *13.97 *1.32
Midgut28.26 *9.05 *1.63
Ovaries28.26 *7.65 *1.37
* p < 0.05; bold letter: upregulated; italic letter: sub-regulated; black: normalized.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Sedano-Juarez, C.O.; Gómez-Romero, N.; Alonso-Díaz, M.Á.; Barrera-Molina, A.I.; Reyes-Guerrero, D.E.; Lagunes-Quintanilla, R. In Silico Analysis and Transcriptional Profiling of A Putative Metalloprotease ADAMTSL as A Potential Tick Antigen against Rhipicephalus microplus. Pathogens 2025, 14, 190. https://doi.org/10.3390/pathogens14020190

AMA Style

Sedano-Juarez CO, Gómez-Romero N, Alonso-Díaz MÁ, Barrera-Molina AI, Reyes-Guerrero DE, Lagunes-Quintanilla R. In Silico Analysis and Transcriptional Profiling of A Putative Metalloprotease ADAMTSL as A Potential Tick Antigen against Rhipicephalus microplus. Pathogens. 2025; 14(2):190. https://doi.org/10.3390/pathogens14020190

Chicago/Turabian Style

Sedano-Juarez, Cesar Onoshi, Ninnet Gómez-Romero, Miguel Ángel Alonso-Díaz, América Ivette Barrera-Molina, David Emanuel Reyes-Guerrero, and Rodolfo Lagunes-Quintanilla. 2025. "In Silico Analysis and Transcriptional Profiling of A Putative Metalloprotease ADAMTSL as A Potential Tick Antigen against Rhipicephalus microplus" Pathogens 14, no. 2: 190. https://doi.org/10.3390/pathogens14020190

APA Style

Sedano-Juarez, C. O., Gómez-Romero, N., Alonso-Díaz, M. Á., Barrera-Molina, A. I., Reyes-Guerrero, D. E., & Lagunes-Quintanilla, R. (2025). In Silico Analysis and Transcriptional Profiling of A Putative Metalloprotease ADAMTSL as A Potential Tick Antigen against Rhipicephalus microplus. Pathogens, 14(2), 190. https://doi.org/10.3390/pathogens14020190

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop