Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia)
Abstract
1. Introduction
2. Materials and Methods
2.1. Identification of the McLOX
2.2. Physicochemical Analysis of McLOX Proteins
2.3. Phylogenetic Analysis of LOX Gene Family in Bitter Gourd
2.4. Gene Structure Analysis and Identification of Conserved Motifs
2.5. Analysis of Promoter Cis-Acting Elements
2.6. Material Handling
2.7. Expression Analysis of LOX Gene in Bitter Gourd
2.8. Determination of Volatile Substances
3. Results
3.1. Genome-Wide Characterization of the McLOX
3.2. Physicochemical Characterization of the McLOX Gene
3.3. Secondary and Tertiary Structure Analysis of McLOX
3.4. Phylogenetic Analysis
3.5. Gene Structure and Conserved Motifs Analysis of McLOX
3.6. Analysis of Cis-Acting Elements in Promoters of the LOX Gene Family in Bitter Gourd
3.7. Analysis of Expression Patterns in Different Tissues of the LOX Gene Family in Bitter Gourd
3.8. Analysis of Volatile Monoterpene Content of Bitter Gourd with Different Fruit Colors
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Conflicts of Interest
References
- Liavonchanka, A.; Feussner, I. Lipoxygenases: Occurrence, functions and catalysis. J. Plant Physiol. 2006, 163, 348–357. [Google Scholar] [CrossRef] [PubMed]
- Hildebrand, D.F. Lipoxygenases. Physiol. Plant. 1989, 76, 249–253. [Google Scholar] [CrossRef]
- Gigot, C.; Ongena, M.; Fauconnier, M.L.; Wathelet, J.P.; Du Jardin, P.; Thonart, P. The lipoxygenase metabolic pathway in plants: Potential for industrial production of natural green leaf volatiles. BASE 2010, 14, 451–460. [Google Scholar]
- Feussner, I.; Kühn, H.; Wasternack, C. Lipoxygenase-dependent degradation of storage lipids. Trends Plant Sci. 2001, 6, 268–273. [Google Scholar] [CrossRef]
- Acosta, I.F.; Laparra, H.; Romero, S.P.; Schmelz, E.; Hamberg, M.; Mottinger, J.P.; Moreno, M.A.; Dellaporta, S.L. tasselseed1 is a lipoxygenase affecting jasmonic acid signaling in sex determination of maize. Science 2009, 323, 262–265. [Google Scholar] [CrossRef]
- Chen, G.; Hackett, R.; Walker, D.; Taylor, A.; Lin, Z.; Grierson, D. Identification of a specific isoform of tomato lipoxygenase (TomloxC) involved in the generation of fatty acid-derived flavor compounds. Plant Physiol. 2004, 136, 2641–2651. [Google Scholar] [CrossRef] [PubMed]
- Chuck, G. Molecular Mechanisms of Sex Determination in Monoecious and Dioecious Plants. Adv. Bot. Res. 2010, 54, 53–83. [Google Scholar]
- Kolomiets, M.V.; Hannapel, D.J.; Chen, H.; Tymeson, M.; Gladon, R.J. Lipoxygenase is involved in the control of potato tuber development. Plant Cell 2001, 13, 613–626. [Google Scholar] [CrossRef]
- Chauvin, A.; Caldelari, D.; Wolfender, J.L.; Farmer, E.E. Four 13-lipoxygenases contribute to rapid jasmonate synthesis in wounded Arabidopsis thaliana leaves: A role for lipoxygenase 6 in responses to long-distance wound signals. New Phytol. 2013, 197, 566–575. [Google Scholar] [CrossRef]
- Sarde, S.J.; Bouwmeester, K.; Venegas-Molina, J.; David, A.; Boland, W.; Dicke, M. Involvement of sweet pepper CaLOX2 in jasmonate-dependent induced defence against Western flower thrips. J. Integr. Plant Biol. 2019, 61, 1085–1098. [Google Scholar] [CrossRef]
- Yang, X.Y.; Jiang, W.J.; Yu, H.J. The expression profiling of the lipoxygenase (LOX) family genes during fruit development, abiotic stress and hormonal treatments in cucumber (Cucumis sativus L.). Int. J. Mol. Sci. 2012, 13, 2481–2500. [Google Scholar] [CrossRef] [PubMed]
- Tsitsigiannis, D.I.; Keller, N.P. Oxylipins as developmental and host-fungal communication signals. Trends Microbiol. 2007, 15, 109–118. [Google Scholar] [CrossRef] [PubMed]
- Baldwin, I.T.; Schmelz, E.A.; Ohnmeiss, T.E. Wound-induced changes in root and shoot jasmonic acid pools correlate with induced nicotine synthesis inNicotiana sylvestris spegazzini and comes. J. Chem. Ecol. 1994, 20, 2139–2157. [Google Scholar] [CrossRef]
- Leone, A.; Bleve-Zacheo, T.; Gerardi, C.; Melillo, M.T.; Leo, L.; Zacheo, G. Lipoxygenase involvement in ripening strawberry. J. Agric. Food Chem. 2006, 54, 6835–6844. [Google Scholar] [CrossRef]
- Chang-Rong, G.; Yan-Mei, L.I.; Li-Jun, Y.J. Relationship Between LOX Activity, SA and JA Accumulation in Tobacco Leaves Under Water Stress. Agric. Sci. China 2003, 2, 624–628. [Google Scholar]
- Vogt, J.; Schiller, D.; Ulrich, D.; Schwab, W.; Dunemann, F. Identification of lipoxygenase (LOX) genes putatively involved in fruit flavour formation in apple (Malus × domestica). Tree Genet. Genomes 2013, 9, 1493–1511. [Google Scholar] [CrossRef]
- Zhang, C.; Jin, Y.; Liu, J.; Tang, Y.; Cao, S.; Qi, H.J.S.H. The phylogeny and expression profiles of the lipoxygenase (LOX) family genes in the melon (Cucumis melo L.) genome. Sci. Hortic. 2014, 170, 94–102. [Google Scholar] [CrossRef]
- Zhang, B.; Chen, K.; Bowen, J.; Allan, A.; Espley, R.; Karunairetnam, S.; Ferguson, I. Differential expression within the LOX gene family in ripening kiwifruit. J. Exp. Bot. 2006, 57, 3825–3836. [Google Scholar] [CrossRef]
- Cuevas-Glory, L.F.; Sosa-Moguel, O.; Pino, J.; Sauri-Duch, E.J.F.A.M. GC–MS Characterization of Volatile Compounds in Habanero Pepper (Capsicum chinense Jacq.) by Optimization of Headspace Solid-Phase Microextraction Conditions. Food Anal. Methods 2015, 8, 1005–1013. [Google Scholar] [CrossRef]
- Vogel, J.T.; Tieman, D.M.; Sims, C.A.; Odabasi, A.Z.; Clark, D.G.; Klee, H.J. Carotenoid content impacts flavor acceptability in tomato (Solanum lycopersicum). J. Sci. Food Agric. 2010, 90, 2233–2240. [Google Scholar] [CrossRef]
- Trierweiler, B.; Frechen, M.A.; Soukup, S.T.; Egert, B.; Baldermann, S.; Sanguansil, S.; Mccreight, J.D.; Kulling, S.E.; Dhillon, N.P.S. Bitter gourd, Momordica charantia L.; breeding lines differ in secondary metabolite content according to market type. J. Appl. Bot. Food Qual. 2019, 92, 106–115. [Google Scholar]
- Crops, G.S.L.B.S.M.F.I.o.V.; Shanghai, F.J.A.A. Correlation and Principal Component Analyses on Major Agronomic Characters of Balsam Pear (Momordica charantia L.). Acta Agric. Shanghai 2004, 20, 33–36. [Google Scholar]
- Yu-Sheng, L.U.; Zhi-Xiong, L.; Ji-Shui, Q.; Xiao-Xiao, C.; Jian-Ping, P.J.A.H.S. Fruit Character Diversity Analysis and Numerical Taxonomy of Wampee (Clausena lansium) Germplasm Resources. Acta Hortic. Sin. 2016, 43, 1903. [Google Scholar]
- Chambers, E.t.; Koppel, K. Associations of volatile compounds with sensory aroma and flavor: The complex nature of flavor. Molecules 2013, 18, 4887–4905. [Google Scholar] [CrossRef]
- Tieman, D.; Bliss, P.; McIntyre, L.M.; Blandon-Ubeda, A.; Bies, D.; Odabasi, A.Z.; Rodríguez, G.R.; van der Knaap, E.; Taylor, M.G.; Goulet, C.; et al. The chemical interactions underlying tomato flavor preferences. Curr. Biol. CB 2012, 22, 1035–1039. [Google Scholar] [CrossRef]
- Min, Y. SPME-GC-MS Analysis of Volatile Composition of Bitter Melon Fruits. Food Sci. 2010, 31, 171–174. [Google Scholar]
- Finn, R.D.; Clements, J.; Eddy, S.R. HMMER web server: Interactive sequence similarity searching. Nucleic Acids Res. 2011, 39, W29–W37. [Google Scholar] [CrossRef]
- Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools: An Integrative Toolkit Developed for Interactive Analyses of Big Biological Data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar] [CrossRef]
- Wenli, D.U.; Zhongshan, C.; Duanxiang, X.U.; Tongwei, X.U.; Shan, G.A.O.; Qingfang, W.E.N. Physiological Response and Differentially Expressed Genes Analysis of Transcriptome in Momordica charantia L. Leaf Under Cold Stress. J. Nucl. Agric. Sci. 2021, 35, 338–348. [Google Scholar] [CrossRef]
- Arocho, A.; Chen, B.; Ladanyi, M.; Pan, Q. Validation of the 2-DeltaDeltaCt calculation as an alternate method of data analysis for quantitative PCR of BCR-ABL P210 transcripts. Diagn. Mol. Pathol. 2006, 15, 56–61. [Google Scholar] [CrossRef] [PubMed]
- Djavanshir, D.; Abolghasem, J.; Parastou, M. Volatile Organic Compounds Trapping from Gaseous Samples on the Basis of Co-Liquefaction with Organic Solvent for Gas Chromatographic Analysis. Curr. Anal. Chem. 2017, 13, 393–401. [Google Scholar] [CrossRef]
- Bai, J.; Baldwin, E.A.; Imahori, Y.; Kostenyuk, I.; Burns, J.; Brecht, J.K. Chilling and heating may regulate C6 volatile aroma production by different mechanisms in tomato (Solanum lycopersicum) fruit. Postharvest Biol. Technol. 2011, 60, 111–120. [Google Scholar] [CrossRef]
- Ties, P.; Barringer, S. Influence of lipid content and lipoxygenase on flavor volatiles in the tomato peel and flesh. J. Food Sci. 2012, 77, C830–C837. [Google Scholar] [CrossRef]
- Buescher, R.H.; Buescher, R.W.J.J.o.F.S. Production and Stability of (E, Z)-2, 6-Nonadienal, the Major Flavor Volatile of Cucumbers. J. Food Sci. 2010, 66, 357–361. [Google Scholar] [CrossRef]
- Echeverria, G.; Graell, J.; Lopez, M.L.; Lara, I.J.P.b. Volatile production, quality and aroma-related enzyme activities during maturation of ‘Fuji’ apples. Postharvest Biol. Technol. 2004, 31, 217–227. [Google Scholar] [CrossRef]
- Pérez, A.G.; Sanz, C.; Olías, R.; Olías, J.M. Lipoxygenase and Hydroperoxide Lyase Activities in Ripening Strawberry Fruits. Agric. Food Chem. 1999, 47, 249–253. [Google Scholar] [CrossRef]
- Wu, M.; Chen, K.S.; Zhang, S.L.J.A.H.S. Involvement of lipoxygenase in the postharvest ripening of peach fruit. Acta Hortic. Sin. 1999, 26, 227–231. [Google Scholar]
- Oliveira, I.; Guedes de Pinho, P.; Malheiro, R.; Baptista, P.; Pereira, J.A. Volatile profile of Arbutus unedo L. fruits through ripening stage. Food Chem. 2011, 128, 667–673. [Google Scholar] [CrossRef]
- Bannenberg, G.; Martínez, M.; Hamberg, M.; Castresana, C. Diversity of the enzymatic activity in the lipoxygenase gene family of Arabidopsis thaliana. Lipids 2009, 44, 85–95. [Google Scholar] [CrossRef]
- Bell, E.; Creelman, R.A.; Mullet, J.E. A chloroplast lipoxygenase is required for wound-induced jasmonic acid accumulation in Arabidopsis. Proc. Natl. Acad. Sci. USA 1995, 92, 8675–8679. [Google Scholar] [CrossRef]
- Melan, M.A.; Dong, X.; Endara, M.E.; Davis, K.R.; Ausubel, F.M.; Peterman, T.K. An Arabidopsis thaliana lipoxygenase gene can be induced by pathogens, abscisic acid, and methyl jasmonate. Plant Physiol. 1993, 101, 441–450. [Google Scholar] [CrossRef] [PubMed]
- Zhang, J.; Ng, C.; Jiang, Y.; Wang, X.; Wang, S.; Wang, S. Genome-wide identification and analysis of LOX genes in soybean cultivar “Zhonghuang 13”. Front. Genet. 2022, 13, 1020554. [Google Scholar] [CrossRef]
- Blee, E.; Joyard, J. Envelope Membranes from Spinach Chloroplasts Are a Site of Metabolism of Fatty Acid Hydroperoxides. Plant Physiol. 1996, 110, 445–454. [Google Scholar] [CrossRef] [PubMed]
- Feussner, I.; Wasternack, C. The lipoxygenase pathway. Annu. Rev. Plant Biol. 2002, 53, 275–297. [Google Scholar] [CrossRef]
- Dong, W.; Jiao, B.; Wang, J.; Sun, L.; Li, S.; Wu, Z.; Gao, J.; Zhou, S. Genome-Wide Identification and Expression Analysis of Lipoxygenase Genes in Rose (Rosa chinensis). Genes 2023, 14, 1957. [Google Scholar] [CrossRef]
- Wolters, H.; Jürgens, G. Survival of the flexible: Hormonal growth control and adaptation in plant development. Nat. Rev. Genet. 2009, 10, 305–317. [Google Scholar] [CrossRef]
- D’Onofrio, C.; Matarese, F.; Cuzzola, A. Effect of methyl jasmonate on the aroma of Sangiovese grapes and wines. Food Chem 2018, 242, 352–361. [Google Scholar] [CrossRef]
- Li, S.-t.; Zhang, M.; Fu, C.-h.; Xie, S.; Zhang, Y.; Yu, L.-j. Molecular Cloning and Characterization of Two 9-Lipoxygenase Genes from Taxus chinensis. Plant Mol. Biol. Report. 2012, 30, 1283–1290. [Google Scholar] [CrossRef]
- Park, Y.S.; Kunze, S.; Ni, X.; Feussner, I.; Kolomiets, M.V. Comparative molecular and biochemical characterization of segmentally duplicated 9-lipoxygenase genes ZmLOX4 and ZmLOX5 of maize. Planta 2010, 231, 1425–1437. [Google Scholar] [CrossRef]
- De La Fuente, G.N.; Murray, S.C.; Isakeit, T.; Park, Y.S.; Yan, Y.; Warburton, M.L.; Kolomiets, M.V. Characterization of genetic diversity and linkage disequilibrium of ZmLOX4 and ZmLOX5 loci in maize. PLoS ONE 2013, 8, e53973. [Google Scholar] [CrossRef]
- Gao, X.; Starr, J.; Göbel, C.; Engelberth, J.; Feussner, I.; Tumlinson, J.; Kolomiets, M. Maize 9-lipoxygenase ZmLOX3 controls development, root-specific expression of defense genes, and resistance to root-knot nematodes. Mol. Plant-Microbe Interact. MPMI 2008, 21, 98–109. [Google Scholar] [CrossRef]
- Nemchenko, A.; Kunze, S.; Feussner, I.; Kolomiets, M. Duplicate maize 13-lipoxygenase genes are differentially regulated by circadian rhythm, cold stress, wounding, pathogen infection, and hormonal treatments. J. Exp. Bot. 2006, 57, 3767–3779. [Google Scholar] [CrossRef]
- Christensen, S.A.; Nemchenko, A.; Borrego, E.; Murray, I.; Sobhy, I.S.; Bosak, L.; DeBlasio, S.; Erb, M.; Robert, C.A.; Vaughn, K.A.; et al. The maize lipoxygenase, ZmLOX10, mediates green leaf volatile, jasmonate and herbivore-induced plant volatile production for defense against insect attack. Plant J. Cell Mol. Biol. 2013, 74, 59–73. [Google Scholar] [CrossRef]
- Li, D.P.; Xu, Y.F.; Sun, L.P.; Liu, L.X.; Hu, X.L.; Li, D.Q.; Shu, H.R. Salicylic acid, ethephon, and methyl jasmonate enhance ester regeneration in 1-MCP-treated apple fruit after long-term cold storage. J. Agric. Food Chem. 2006, 54, 3887–3895. [Google Scholar] [CrossRef]
- Yang, C.; Wang, Y.; Wu, B.; Fang, J.; Li, S. Volatile compounds evolution of three table grapes with different flavour during and after maturation. Food Chem. 2011, 128, 823–830. [Google Scholar] [CrossRef]
- Eduardo, I.; Chietera, G.; Bassi, D.; Rossini, L.; Vecchietti, A. Identification of key odor volatile compounds in the essential oil of nine peach accessions. J. Sci. Food Agric. 2010, 90, 1146–1154. [Google Scholar] [CrossRef]
- Pichersky, E.; Noel, J.P.; Dudareva, N. Biosynthesis of plant volatiles: Nature’s diversity and ingenuity. Science 2006, 311, 808–811. [Google Scholar] [CrossRef]
- Tsao, R.; Yu, Q. Nematicidal Activity of Monoterpenoid Compounds against Economically Important Nematodes in Agriculture. J. Essent. Oil Res. 2000, 12, 350–354. [Google Scholar] [CrossRef]
- Wu, S.H.; Wu, D.G.; Chen, Y.W. Chemical constituents and bioactivities of plants from the genus Paeonia. Chem. Biodivers. 2010, 7, 90–104. [Google Scholar] [CrossRef]
- Zhang, B.; Shen, J.Y.; Wei, W.W.; Xi, W.P.; Xu, C.J.; Ferguson, I.; Chen, K. Expression of genes associated with aroma formation derived from the fatty acid pathway during peach fruit ripening. J. Agric. Food Chem. 2010, 58, 6157–6165. [Google Scholar] [CrossRef]
- Zhang, B.; Yin, X.R.; Li, X.; Yang, S.L.; Ferguson, I.B.; Chen, K.S. Lipoxygenase gene expression in ripening kiwifruit in relation to ethylene and aroma production. J. Agric. Food Chem. 2009, 57, 2875–2881. [Google Scholar] [CrossRef] [PubMed]
- Li, P.C.; Yu, S.W.; Shen, J.; Li, Q.Q.; Li, D.P.; Li, D.Q.; Zheng, C.C.; Shu, H.R. The transcriptional response of apple alcohol acyltransferase (MdAAT2) to salicylic acid and ethylene is mediated through two apple MYB TFs in transgenic tobacco. Plant Mol. Biol. 2014, 85, 627–638. [Google Scholar] [CrossRef] [PubMed]








| Gene Name. | Gene ID | Amino Acid | Molecular Weight (kDa) | PI | Gravy | Instability Index | Subcellular Localization |
|---|---|---|---|---|---|---|---|
| McLOX1 | MC02g0081 | 763 | 86.74 | 5.43 | −0.395 | 37.82 | Cytoplasm |
| McLOX2 | MC02g0083 | 902 | 102.56 | 6.03 | −0.466 | 41.39 | Cytoplasm |
| McLOX3 | MC07g0692 | 958 | 109.65 | 7.18 | −0.362 | 42.88 | Cytoplasm |
| McLOX4 | MC08g2254 | 895 | 101.42 | 6.18 | −0.33 | 40.53 | Cytoplasm |
| McLOX5 | MC08g2255 | 873 | 98.88 | 6.05 | −0.345 | 39.7 | Cytoplasm |
| McLOX6 | MC08g2256 | 880 | 99.67 | 6.02 | −0.365 | 41.88 | Cytoplasm |
| McLOX7 | MC08g_new0589 | 859 | 99.19 | 6.21 | −0.539 | 46.15 | Cytoplasm |
| McLOX8 | MC08g_new0591 | 862 | 97.52 | 5.85 | −0.42 | 42.85 | Cytoplasm |
| McLOX9 | MC08g2257 | 796 | 91.07 | 5.38 | −0.415 | 46.75 | Cytoplasm |
| McLOX10 | MC09g0182 | 910 | 102.96 | 6.91 | −0.411 | 43.25 | Cytoplasm |
| McLOX11 | MC09g0795 | 827 | 94.55 | 8.46 | −0.504 | 40.83 | Cytoplasm |
| McLOX12 | MC09g1854 | 926 | 104.91 | 7.19 | −0.451 | 47.32 | Cytoplasm |
| Gene Name | α-Helix/% | Extended Strand/% | β-Turn/% | Random Coil/% |
|---|---|---|---|---|
| McLOX1 | 31.59 | 19.92 | 9.83 | 38.66 |
| McLOX2 | 34.04 | 18.07 | 9.2 | 38.69 |
| McLOX3 | 38 | 16.18 | 9.19 | 36.64 |
| McLOX4 | 39.44 | 16.42 | 9.16 | 34.97 |
| McLOX5 | 36.08 | 18.21 | 10.08 | 35.62 |
| McLOX6 | 35 | 17.16 | 10.57 | 37.27 |
| McLOX7 | 39 | 16.65 | 8.03 | 36.32 |
| McLOX8 | 31.79 | 18.21 | 11.14 | 38.86 |
| McLOX9 | 37.56 | 15.58 | 10.93 | 35.93 |
| McLOX10 | 36.15 | 16.26 | 8.68 | 38.9 |
| McLOX11 | 38 | 15.72 | 8.46 | 37.73 |
| McLOX12 | 34.99 | 18.79 | 9.18 | 37.04 |
| Gene Name | Gene ID | PLAT/LH2 (IPR036392) | Lipoxygenase (IPR036226) | Iron Binding (IPR020833) |
|---|---|---|---|---|
| McLOX1 | MC02g0081 | 2–73 | 74–763 | 416–430 |
| McLOX2 | MC02g0083 | 72–210 | 211–902 | 555–569 |
| McLOX3 | MC07g0692 | 118–258 | 259–958 | 609–623 |
| McLOX4 | MC08g2254 | 53–200 | 201–895 | 551–565 |
| McLOX5 | MC08g2255 | 39–183 | 184–873 | 529–543 |
| McLOX6 | MC08g2256 | 40–184 | 185–880 | 536–550 |
| McLOX7 | MC08g_new0589 | 17–163 | 164–859 | 515–529 |
| McLOX8 | MC08g_new0591 | 18–165 | 167–862 | 518–532 |
| McLOX9 | MC08g2257 | 2–100 | 101–796 | 452–466 |
| McLOX10 | MC09g0182 | 77–219 | 221–910 | 564–578 |
| McLOX11 | MC09g0795 | 17–139 | 140–827 | 478–492 |
| McLOX12 | MC09g1854 | 90–230 | 231–926 | 579–593 |
| Gene Name | E-Value | Width | Sites | Best Possible Match |
|---|---|---|---|---|
| Motif1 | 8.40E-399 | 50 | 12 | DAGYHQLISHWLNTHAVIEPFVIATNRQLSVMHPIYKLLHPHFRDTMNIN |
| Motif2 | 1.10E-333 | 50 | 12 | DKKDEPWWPKMQTLQDLIESCTTIIWIASALHAAVNFGQYPYGGYVPNRP |
| Motif3 | 8.50E-322 | 50 | 12 | ALPADLIKRGVAVEDPSSPHGLRLLIEDYPFAVDGLEIWSAIKTWVTDYC |
| Motif4 | 9.60E-287 | 50 | 12 | IFFANKSYLPSETPEPLRKYREEELLNLRGBGKGERKEWDRIYDYDVYND |
| Motif5 | 5.10E-234 | 41 | 12 | AWRTDEEFARZMLAGVNPVIIRRLQEFPPLSKLDPEIYGDQ |
| Motif6 | 7.90E-178 | 50 | 8 | GIPGAFFIRNGHTSEFFLKSLTLEDVPGHGRIHFDCNSWVYPSRRYKKDR |
| Motif7 | 4.50E-152 | 31 | 12 | GLTVDEAJKQNKLYILDHHDALMPYLRRINS |
| Motif8 | 2.70E-208 | 50 | 12 | YKELESNPEKAFLRTJPSQLQALLGVSLIEILSRHSPDEVYLGQRASPEW |
| Motif9 | 1.50E-148 | 29 | 12 | TKTYATRTLLFLKEDGTLKPLAIELSLPH |
| Motif10 | 4.50E-140 | 29 | 12 | ALARQSLINADGIJESTHFPGKYSMELSS |
| Motif11 | 2.20E-139 | 36 | 12 | LKEIEERIMRRNKDPRLKNRTGPVVVPYTLLFPSSS |
| Motif12 | 7.40E-124 | 41 | 11 | IYVPRDERFGHLKMSDFLAYALKSLSHSJVPGLESLFDSTP |
| Motif13 | 6.40E-108 | 29 | 11 | GAISKVYFPAEEGVESSIWQLAKAYVAVN |
| Motif14 | 1.80E-105 | 21 | 12 | GGKZYPYPRRGRTGRPPSKKD |
| Motif15 | 6.30E-101 | 50 | 7 | EFDKFQDVHDLYEGGFPVPLNLLENLTENIPPPLFKEJLRSDGERFLKFP |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Ge, H.; Liu, S.; Zheng, H.; Chang, P.; Huang, W.; Lin, S.; Zheng, J.; Li, H.; Huang, Z.; Jia, Q.; et al. Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia). Genes 2024, 15, 1557. https://doi.org/10.3390/genes15121557
Ge H, Liu S, Zheng H, Chang P, Huang W, Lin S, Zheng J, Li H, Huang Z, Jia Q, et al. Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia). Genes. 2024; 15(12):1557. https://doi.org/10.3390/genes15121557
Chicago/Turabian StyleGe, Haicui, Shuang Liu, Hongzhe Zheng, Pengyan Chang, Weiqun Huang, Shanshan Lin, Jingyuan Zheng, Honglong Li, Zedong Huang, Qi Jia, and et al. 2024. "Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia)" Genes 15, no. 12: 1557. https://doi.org/10.3390/genes15121557
APA StyleGe, H., Liu, S., Zheng, H., Chang, P., Huang, W., Lin, S., Zheng, J., Li, H., Huang, Z., Jia, Q., & Zhong, F. (2024). Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia). Genes, 15(12), 1557. https://doi.org/10.3390/genes15121557
