Next Article in Journal
Transcriptomic Characterization of Genes Harboring Markers Linked to Maize Yield
Previous Article in Journal
A Novel GBF1 Variant in a Charcot-Marie-Tooth Type 2: Insights from Familial Analysis
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia)

1
College of Horticulture, Fujian Agriculture and Forestry University, Fuzhou 350002, China
2
Fuzhou Smart Agriculture (Seed Industry) Industry Innovation Center, Fuzhou 350002, China
3
Subtropical Agriculture Research Institute, Fujian Academy of Agricultural Sciences, Zhangzhou 363005, China
4
Fujian Seed Station, Fuzhou 350003, China
5
Vegetable Research Institute, Hunan Academy of Agricultural Sciences, Changsha 410125, China
6
Fujian Tianmei Seed Industry Technology Co., Fuzhou 350109, China
7
Jiuquan Institute of Agricultural Sciences Research, Jiuquan 735000, China
*
Author to whom correspondence should be addressed.
These authors contributed equally to this work.
Genes 2024, 15(12), 1557; https://doi.org/10.3390/genes15121557
Submission received: 29 October 2024 / Revised: 19 November 2024 / Accepted: 28 November 2024 / Published: 29 November 2024
(This article belongs to the Section Plant Genetics and Genomics)

Abstract

:
Background: Lipoxygenases (LOXs) are key enzymes in the unsaturated fatty acid oxidation reaction pathway and play an important regulatory role in the synthesis of fruit aroma volatiles. Methods: LOX gene family members were identified in the whole genome database of bitter gourd and analyzed bioinformatically. An RT-qPCR was used to analyze the expression differences in different tissues. Monoterpenes were determined by gas chromatography-mass spectrometry (GC-MS) technique. Results: A total of 12 LOX gene family members were identified in the genome. The expression of LOX genes varied significantly among the tissues of roots, stems, leaves, flowers, fruits, seeds and tendrils. A total of 29 monoterpenes were detected in the fruits of five different fruit colors of bitter gourd, mainly containing six types of alcohols, aldehydes, terpenes, ketones, esters and alkynes, with the highest relative content of alcohols. Conclusions: The present study provides a reference for further elucidation of the biological functions of the LOX gene in the synthesis pathway of aroma volatiles in bitter gourd.

1. Introduction

LOXs are a class of non-heme ferritins that catalyze the oxygenation of polyunsaturated fatty acids containing pentadienyl structures to form hydroperoxides in plants [1]. LOXs are widely found in mammals, plants, bacteria, fungi and algae [2]. LOXs are mainly distributed in chloroplasts and some plasma membrane tissues in the cytoplasm of plants [3]. Based on the position of the carbon atom at which LOXs bind to the carbon chain of the substrate fatty acid, LOXs can be categorized into two families, 9-LOX and 13-LOX [4]. In addition, based on the similarity of sequence structure and the presence or absence of chloroplast-targeting peptides, LOXs can be categorized into I-LOXs and II-LOXs, with I-LOXs having as much as 75% similarity and containing no chloroplast-targeting peptides, and II-LOXs having lower similarity but containing chloroplast-targeting peptides [1].
The lipoxygenase pathway is involved in a variety of plant life activities, such as growth and development, stress response and fruit flavor production [5,6,7,8]. Arabidopsis AtLOX2 and AtLOX6 are involved in jasmonic acid (JA) synthesis induced by leaf damage [9]. Silencing CaLOX2 in chili plants leads to reduced JA accumulation and decreased disease resistance [10]. In the study of Cucumis sativus, a total of 23 LOX genes were identified, with 12 genes showing differential expression under abiotic stress and plant growth regulator treatment [11]. Among them, small molecule flavor actives, including volatile aldehydes, alcohols and esters produced during fatty acid metabolism, play their roles in plant growth and development by participating in the synthesis of volatile flavor compounds and the repair of damaged tissues in adversity [12]. The production of C6 aldehydes and corresponding alcohols in tomatoes is catalyzed by the 13-lipoxygenase TomloxC, which catalyzes the production of 13-HPOs, which constitute the major aromatic substances in tomato fruits [6,13]. The characteristic flavor of strawberries is associated with the LOX gene [14]. NaLOX2 is involved in the synthesis of tobacco hexanal and some green leaf volatiles [15]. In apples, MdLOX1a and MdLOX5e were identified as candidate genes involved in the production of fruit aroma volatiles, and MdLOX1a was associated with the biosynthesis of characteristic apple aroma esters [16]. In melons, CmLOX01, CmLOX03 and CmLOX18 were associated with the production of fruit aroma esters [17]. Six LOX genes in kiwifruits, including AdLOX3, AdLOX4 and AdLOX6, were categorized as 13-LOXs, and sequence structure analysis showed that they contain chloroplast transit peptide sequences, which were considered as possible candidate genes for the regulation of volatile compound synthesis in kiwifruits [18].
Volatiles of fruits are the key determinants of characteristic aroma and mainly include esters, alcohols, aldehydes, acids and terpenoids. Currently, studies have been conducted on the fruits of tomatoes and bell peppers [19,20]. Bitter gourds (Momordica charantia L.) are mainly consumed as young gourds with a refreshing bitter taste. Bitter gourd fruits contain vitamins, mineral elements, amino acids, flavonoids and bioactive substances such as saponins [21]. There are many varieties of bitter gourd, which are generally classified according to the shape of the fruit, color, surface tubercle protrusion and so on. For example, the color of the fruit can be divided into white, white-green, yellow-green, light green, green, and dark green [22,23]. Bitter gourd fruits have a unique aroma, and studies have shown that the flavor of different colored fruits is also slightly different, with differences in taste and nutrient content [24,25]. The results showed that the main volatile components of bitter gourd fruits produced in Gansu were aldehydes and alcohols, and different volatiles contributed differently to the aroma of bitter gourd fruits [26].
Aroma imparts unique flavor qualities to bitter gourd fruits and has an important impact on fruit quality. However, there are fewer studies on its aroma substance components and anabolism. Since lipoxygenase is the first key enzyme to initiate the LOX pathway, it was hypothesized that it might play a key role in the flavor formation of bitter melon fruit. The study of the function of metabolic enzyme genes of the lipoxygenase pathway is useful for understanding the aroma synthesis in bitter gourd. The determination of monoterpene volatiles in different bitter gourd fruit colors revealed the highest relative content of alcohols. The LOX genes were identified for family members, and 12 McLOX gene-encoded proteins were analyzed for bioinformatics and gene expression analysis. This provided a basis for studying the association between volatile substances and LOX genes in bitter gourd fruits.

2. Materials and Methods

2.1. Identification of the McLOX

Whole-genome data files and genome annotation files of bitter gourd were downloaded from the National Gene Bank Sequence Archiving System website (https://db.cngb.org/cnsa/download/, accessed on 14 August 2024), and Arabidopsis genome files were downloaded from the official Arabidopsis website (https://www.arabidopsis.org/, accessed on 14 August 2024). The protein sequences of the six identified AtLOXs in Arabidopsis were screened for candidate genes by comparing them with those of bitter gourd using BLASTP. Meanwhile, the hidden Markov model (HMM) of the Lyase aromatic structural domain (PF00305) specific to the LOX gene was downloaded from the Pfam database (http://pfam.xfam.org/, accessed on 14 August 2024). McLOX family members were screened from the bitter gourd genome database using the HMMER 3.0 [27] software with the screening criterion of E-value ≤ e−5, and redundant sequences between HMMsearch and BLASTP were removed. The InterProScan program (http://www.ebi.ac.uk/Tools/InterProScan/, accessed on 14 August 2024) was used to confirm the presence of the LOX structural domain and the PLAT/LH2 structural domain in the LOX gene sequences. Genes that contain both of these two characterized structural domains are LOX genes, and genes missing both the complete PLAT/LH2 structural domain and the LOX structural domain are in the Supplementary Table.

2.2. Physicochemical Analysis of McLOX Proteins

Physicochemical properties and subcellular localization prediction analyses were performed using the ExPASy (https://web.expasy.org, accessed on 22 August 2024) and Plant-mPLoc (http://www.csbio.sjtu.edu.cn/bioinf/plant-multi/, accessed on 22 August 2024). To further understand the structural features of the protein, secondary and tertiary structural analyses of the protein were performed using the online websites Prabi (https://npsa-prabi.ibcp.fr, accessed on 23 August 2024) and Swiss-model (https://swissmodel.expasy.org, accessed on 23 August 2024), respectively.

2.3. Phylogenetic Analysis of LOX Gene Family in Bitter Gourd

A phylogenetic tree was constructed by combining McLOX protein with four species, including Arabidopsis thaliana, Solanum lycopersicum and Populus trichocarpa. The evolutionary tree was then constructed by neighbor joining (NJ) using MEGA7 software with Bootstrap replications set to 1000 and other parameters defaulted. The constructed tree files were uploaded to the ITOL website (https://itol.embl.de/itol.cgi, accessed on 25 August 2024) for better presentation.

2.4. Gene Structure Analysis and Identification of Conserved Motifs

The gene structure and protein conserved motifs of the LOX gene family of bitter gourd were analyzed using the online websites NCBI (https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi, accessed on 1 September 2024) and MEME (https://meme-suite.org, accessed on 1 September 2024), respectively. We set the number of motifs parameter to 15, and the rest of the parameters were defaults. Graphs were drawn using Tbtools software v1.098775 [28].

2.5. Analysis of Promoter Cis-Acting Elements

The sequence of 2000 base pairs (bp) upstream of the start codon (ATG) of the McLOX gene in the whole genome of bitter gourd was obtained using TBtools software. The PlantCARE database (http://bioinformatics.psb.ugent.be/webtools/plantcare/html/, accessed on 3 September 2024) was used to search for cis-elements in the promoter. The prediction results were visualized by TBtools.

2.6. Material Handling

The test materials were harvested from Baysha Breeding Base of Fujian Tianmei Seed Industry Science and Technology Co. Bitter gourd seedlings were raised in hole trays at day/night temperatures of 25 °C/20 °C and light/dark cycles of 16 h/8 h. Seedlings were transplanted when they reached four true leaves. The bitter gourd fruits were selected 15 days after pollination. Roots, stems, leaves, flowers, fruits, seeds and tendrils of bitter gourd were collected and 0.5 g of each was sampled for tissue expression analysis. Five colors of fruits, including white bitter gourd, white-green bitter gourd, yellow-green bitter gourd, light green bitter gourd and green bitter gourd, were picked, and 0.5 g of each sample was used for volatile monoterpenes determination. Three biological replicates were set up, and all samples were wrapped in tin foil, immediately put into liquid nitrogen and stored in an ultra-low temperature refrigerator at −80 °C for spare.

2.7. Expression Analysis of LOX Gene in Bitter Gourd

The Plant RNA Rapid Extraction Kit was purchased from Novozymes (Nanjing, China) Biotechnology Co. Reverse transcription cDNA was synthesized using FastKing reagent from Tiangen Biochemical Technology Co. (Beijing, China). The fluorescence quantification reagent was 2 × RealStar Fas SYBR qPCR Mix from GenStar. The quantitative primers were designed using Primer 5.0 software (Supplementary Table S1). The expression of the McLOX gene was verified using the bitter gourd cyclin gene McCYP (GenBank accession number: HQ171897) as an internal reference gene [29]. The method used to calculate the relative expression of the gene was 2−ΔΔct method [30]. Three biological replicates and three technical replicates were set up.

2.8. Determination of Volatile Substances

Headspace solid-phase microextraction (HS-SPME) technique was used in this study. The 0.5 g sample was ground and transferred to a headspace vial with a sealed cap. The extraction head was placed in the GC-MS injector at 250 °C and resolved for 7 min, and then the Perkin Elmer Clarus SQ8T GC-MS was started to collect the data.
The GC-MS conditions were as follows: interface temperature 240 °C, electron bombardment ion source; electron energy 70 eV; ion source temperature 250 °C; acquisition range 50~550 m/z; carrier gas He (purity 99.999%); column flow rate: 1 mL/min; sampler temperature 250 °C; temperature increase program: initial temperature 50 °C, increased to 180 °C at 15 °C/min; 2 °C/min. The temperature increase program conditions were as follows: initial temperature 50 °C, increase to 180 °C at 15 °C/min, increased to 240 °C at 2 °C/min.
The plots of the determined fruit volatiles were analyzed, and each peak was searched using the NIST11 mass spectral library. A positive and negative match of more than 800 and a similarity higher than 80% were used as the basis for screening. The identified volatiles were finally characterized based on the CAS number of each component and comparison with data from the literature [31]. For quantification, the relative content of each component was calculated using peak area normalization.

3. Results

3.1. Genome-Wide Characterization of the McLOX

A total of 12 LOX genes were identified in bitter gourd using bioinformatics (Figure 1), unevenly distributed on four chromosomes, with two genes on chromosome Mc02, only one gene on chromosome Mc07, six genes on chromosome Mc08 and three genes on chromosome Mc09. According to the position on the chromosomes, they were named McLOX1McLOX12.

3.2. Physicochemical Characterization of the McLOX Gene

The physicochemical properties of the proteins of the 12 identified bitter gourd LOX genes were analyzed (Table 1). The number of amino acids of the proteins encoded by the family members ranged from 763 to 958; the molecular weights ranged from 86.74 to 109.65 kD. Except for three proteins, McLOX3, McLOX11 and McLOX12, which had isoelectric points greater than 7, the theoretical pIs of the rest of the proteins were less than 7, suggesting that most of the bitter gourd LOX proteins were acidic proteins. All McLOX proteins have hydrophilic coefficients less than 0 and are hydrophilic. None of the McLOX proteins have signal peptides and are non-secretory proteins. With the exception of McLOX1 and McLOX5, the other members of the family are unstable proteins with stability coefficients greater than 40. Subcellular localization prediction showed that all McLOX family members are localized to the cytoplasm.

3.3. Secondary and Tertiary Structure Analysis of McLOX

The sequence structure of a protein reflects the function of the protein and lays the foundation for the tertiary structure pattern of the protein. The secondary structure of the bitter gourd LOX protein was predicted (Table 2). The α-helix and irregular coil occupied the largest proportions of 31.59%–39.44% and 34.97%–38.9%, respectively. Next in order were extended strands (18.21%–20.71%) and β-turns (8.03%–11.14%) (Figure 2). The tertiary structure of bitter gourd LOX proteins was further analyzed (Figure 3), and the results showed that, except for McLOX11, which used 3pzw.1.A as a template, the rest of McLOX proteins had 8i6y.1.A as a template.

3.4. Phylogenetic Analysis

In order to clarify the phylogenetic relationship of LOX genes in bitter gourds, this study analyzed the phylogeny of LOX proteins from bitter gourds with A. thaliana, S. lycopersicum and P. trichocarpa (Figure 4). LOX proteins can be categorized into the subfamily 9-LOX and the subfamily 13-LOX, and 13-LOX proteins are further classified into two types, type I and type II, based on the protein structure; type I 13-LOX proteins lack plastid-targeting peptides and have more than 75% sequence similarity, while type II 13-LOX proteins have plastid-targeting peptides but have lower sequence similarity.
Phylogenetic analyses showed that bitter gourd and poplar genes were classified into three categories, whereas Arabidopsis and tomatoes were clustered only in the subfamily branches of 9-LOX and 13-LOXII. McLOX3-9 belongs to the 9-LOX subfamily and is clustered with AtLOX1 and AtLOX5 of Arabidopsis. The type I 13-LOX subfamily has fewer members and contains only McLOX11 of bitter gourd and PtLOX16 and PtLOX17 of poplar. Four genes, McLOX1, McLOX2, McLOX10 and McLOX12 of bitter gourd, are clustered into the type II 13-LOX subfamily, clustered with AtLOX2-4 and AtLOX6 of Arabidopsis.

3.5. Gene Structure and Conserved Motifs Analysis of McLOX

All 12 McLOX protein sequences identified contained the complete PLAT/LH2 (IPR036392) motif, the lipoxygenase structural domain (IPR036226) and a crucial iron binding site (IPR020833) (Table 3). Intron and exon analyses were performed on the members of the bitter gourd LOX gene family (Figure 5A). The results showed that, except for the McLOX1, McLOX6, McLOX7 and McLOX8 genes, which had no UTR region, the rest of the McLOX genes consisted of a CDS region and a UTR region. The CDS region of McLOX genes was segmented by 6–9 introns, except for McLOX1, McLOX3, McLOX9 and McLOX10 genes, which were all segmented by eight introns, suggesting functional differentiation during the evolutionary process.
The MEME online software (https://meme-suite.org, accessed on 1 September 2024) was used for the protein conserved motif analysis of LOX protein in bitter gourd (Figure 5B), and the conserved motifs of motif1–motif15 are shown in Table 4. The results showed that bitter gourd LOX proteins contain 13–15 motifs, while McLOX1, McLOX2 and McLOX11 contain 14 motif modules and lack motif15. McLOX10 and McLOX12 contain 13 motif modules and lack motif6 and motif15. McLOX3–McLOX9 contain motif 1–motif15, indicating that these seven motif modules are highly conserved.

3.6. Analysis of Cis-Acting Elements in Promoters of the LOX Gene Family in Bitter Gourd

A 2000 bp sequence upstream of the start codon ATG of bitter gourd LOX gene family members was obtained for the prediction of promoter transcription start sites. A total of 433 cis-acting elements were identified (Figure 6). A total of 131 stress-associated response regulators were identified, among which MYC, ARE and W-box were more frequent. Among them, McLOX10, McLOX11 and McLOX12 genes were related to low temperature, and McLOX6 and McLOX12 were related to drought. A total of 14 light-related response elements, including G-box, GT1-motif, Box 4 and GATA-motif. Each of the McLOX genes contained light-responsive elements. A total of 10 hormone-responsive elements were identified. A total of 25 salicylic acid-responsive regulatory elements (TCA-element and as-1), 33 gibberellin-responsive regulatory elements (ERE, P-box, and TATC-box) and 8 growth hormone-responsive elements (TGA-element). The methyl jasmonate and abscisic acid response elements were more numerous, including CGTCA-motif, TGACG-motif, ABRE and AAGAA-motif. McLOX genes were associated with plant growth, and the response elements were GCN4-motif, CAT-box, NON-box, RY-element, O2-site, MSA-like and circadian. McLOX genes all contain different cis-acting elements, suggesting possible involvement in different functions in plants.

3.7. Analysis of Expression Patterns in Different Tissues of the LOX Gene Family in Bitter Gourd

In this study, cDNAs from the root, stem, leaf, flower, fruit, seed and tendril tissue sites of bitter gourd were used as templates to investigate the specific expression of the bitter gourd McLOX gene in different tissues. The results showed (Figure 7) that members of the LOX gene family in bitter gourd were expressed differently in different tissues. The expression was relatively low in stems, leaves and tendrils. Most of the genes were most highly expressed in flowers, including the McLOX1, McLOX2, McLOX3, McLOX4, McLOX9, McLOX10, McLOX11 and McLOX12 genes, which were expressed 418.77, 74.89, 20.44, 416.84, 255.41, 2.17, 63.12 and 4.68 times. Secondly, the expression was relatively high in fruits, especially in McLOX2 and McLOX4 genes, which were 54.95 and 59.58 times higher compared to roots. This indicates that the expression of genes related to the synthesis of volatile monoterpene substances would be higher in the flowers and fruits of bitter gourd than in other tissue sites. The expression of bitter gourd McLOX5 and McLOX7 genes was higher in roots, followed by flowers, and very little expression was found in tissue parts such as stems, leaves, fruits and tendrils. The expression of bitter gourd McLOX6 and McLOX8 genes was higher in seeds, which were 3097.02 and 2.27 times higher than that in roots, respectively. This indicates that McLOX genes have different expression patterns in different tissue parts of bitter gourd, which presumably may affect the synthesis of volatile substances.

3.8. Analysis of Volatile Monoterpene Content of Bitter Gourd with Different Fruit Colors

The volatile monoterpenes of white bitter gourd, white-green bitter gourd, yellow-green bitter gourd, light green bitter gourd and green bitter gourd fruits were determined by the GC-MS technique. A total of 29 volatile monoterpenes were detected in the fruits (Figure 8A), which mainly contained six categories, including alcohols, aldehydes, terpenes, ketones, esters and alkynes, which accounted for 37.93%, 31.03%, 13.79%, 10.34%, 3.45% and 3.45% of the total categories, respectively. Alcohols and aldehydes had the most categories, indicating that alcohols and aldehydes were more abundant in the monoterpenes of bitter gourd fruit.
As can be seen in Figure 8B, white-green bitter gourd had the highest relative content of more than 70% and more than 60% of alcohols among the five colors of fruits. White and yellow-green bitter gourd had 60% relative content of volatile monoterpenes and more than 50% of alcohols. The relative content of light green and green bitter gourd was lower but also reached more than 40%. This indicates that the relative content of alcohols in bitter gourd fruits is the highest, and it is hypothesized that the “green flavor” of bitter gourd fruits mainly comes from alcohols.

4. Discussion

Most of the volatile substances in fruits are synthesized through the fatty acid pathway, and lipoxygenase, as a key enzyme in the oxidation reaction of unsaturated fatty acids, plays a very important regulatory role. Some of the lipoxides produced during fatty acid metabolism, which are important for fruit flavor, are mainly produced under the catalytic effect of lipoxygenase. It was found that the components indicative of fresh tomato flavor were hexanal and hexanol, and their contents were related to tomato freshness [32]. Exogenous LOX had no significant effect on the synthesis of postharvest flavor substances in tomatoes, whereas the addition of the LOX precursor linolenic acid significantly increased the content of hexanol and hexanal in the fruit [33]. The LOX pathway plays a key role in the formation of flavor substances in tomatoes. In cucumbers, the main characteristic aromatic substance was trans-cis-2,6-nonadienal catalyzed by 9-LOX [34]. In apples, strawberries and pears, LOX was also involved in the production of flavor substances [35,36,37]. A study on the factors affecting the production of flavor substances during the postharvest ripening of prunes found that the level of LOX activity affected the content of major flavor substances in prunes [38]. The LOX pathway holds a pivotal role in the formation of fruit flavor substances.
The results of the phylogenetic analysis showed that bitter gourd and poplar genes were divided into three categories, and the AtLOX genes in Arabidopsis belonged to the 9-LOX and type II 13-LOX subfamilies [39]. In the 9-LOX subfamily, McLOX4–9 cluster with AtLOX1, and McLOX3 clusters with AtLOX5. The expression of AtLOX1 is affected by pathogen infestation, abscisic acid (ABA) and methyl jasmonate (MeJA), and AtLOX2 plays a specific role in the biosynthesis of JA precursors [39,40,41]. Therefore, it can be hypothesized that MeJA induces the expression of the McLOX4–9 genes in bitter gourd. Subcellular predictions for members of the bitter gourd LOX gene family are localized in the cytoplasm. The vast majority of Glycine max LOX gene members are localized in the cytoplasm, which is consistent with the results of this study [42]. Most LOX are localized in the cytoplasm, but a large number of LOX genes have been detected in the spinach chloroplast envelope [43]. Different LOXs may have specific subcellular localization to function accordingly in different branches of the LOX pathway [44].
In the prediction of cis-acting elements of the McLOX gene promoter, the main cis-acting functions include four categories: abiotic stress, growth and development, hormone response and light response. The light response has the highest number of cis-acting elements. The study of buckwheat Lox gene expression patterns in response to light found that red and blue light induced the expression of FtLox1 and FtLox7 genes and suppressed the expression of FtLox4 and FtLox6 genes [45]. Phytohormones play an important role in regulating growth and development and response to adversity stress [46]. Aroma is one of the important quality characteristics of fruit, and its synthesis cannot be regulated without hormones. The topical application of MeJA on vines and leaves significantly enhances the aroma of grape berries and promotes the synthesis of bioactive substances [47]. In Picea abies, MeJA and ABA can upregulate TcLox1 gene expression, and ABA can upregulate TcLox2 gene expression [48]. Exogenous ethylene was able to inhibit the expression of kiwifruit AdLox2, AdLox3 and AdLox4 genes and reduce their expression levels [18]. In this study, the promoter region of the bitter gourd gene was found to contain hormone-responsive elements such as MeJA, salicylic acid, ABA, growth hormone and gibberellin, and it was hypothesized that the bitter gourd LOX gene might be induced by hormones. However, relatively few studies have been conducted on the primary genes through which hormones regulate the metabolism of aroma substances, and further related research work is needed.
LOX genes are widely distributed in plants with different specific functions in different parts. The fluorescence quantification of LOX genes in different tissues of bitter gourd was analyzed, and the results showed that the LOX gene family members were differentially expressed in tissue. Most LOX genes were most highly expressed in flowers, followed by those in fruits, especially McLOX2 and McLOX4 genes. Studies have shown that maize ZmLOX genes are expressed differently in different developmental stages and tissues, ZmLOX4 is expressed in the root and apical meristem of maize plants and is associated with drought resistance [49]. ZmLOX5 is expressed in the aboveground organs of maize plants, especially in the filamentous parts, and is associated with resistance to sticky insects [50]. ZmLOX6 is expressed in chloroplasts and is associated with the regulation of pathogen infestation. ZmLOX7 is expressed in the chloroplasts of maize plants [51], ZmLOX8 is expressed in the chloroplasts of maize plants and ZmLOX10 is expressed in non-chloroplast organelles of maize leaves and is associated with insect resistance and regulated by ZmLOX8 [52]. ZmLOX8 is expressed in chloroplasts of maize plants, and ZmLOX10 is expressed in non-chloroplast organelles in maize leaves and is associated with insect resistance and regulated by ZmLOX8 [53]. Currently, several LOX genes have been identified in apples, and their functions have been initially investigated. In the “Golden Crown” genome database, 23 LOX candidate genes were screened based on sequence similarity. MdLOX2 and MdLOX5 genes were expressed in fruit, leaf and flower tissues, while other LOX genes were differently expressed in the tissues [17]. Of the 22 LOX genes in “Jonagold” apples, 17 were expressed in the pericarp [54]. This indicates that the LOX gene family members were differentially expressed in tissue.
The determination and analysis of monoterpene volatiles in bitter gourd of different fruit colors showed that the relative content of monoterpenes was the highest in white-green bitter gourd, and the relative content of alcohols also accounted for the highest proportion. It was hypothesized that the “green flavor” of bitter gourd is mainly derived from alcohols. Monoterpenes have an important influence on the aroma and flavor quality of the fruit, mainly in Malus pumila [55], Prunus persica [56], Citrus reticulata [57] and other important flavor substances in plants, and they are widely used in food, agriculture and medicine [58,59]. The research results showed that the volatile substances of bitter gourd fruit are mainly alcohols and aldehydes, which have an important contributing role to the aroma of bitter gourd fruit [26].
Lipoxygenase is the first key enzyme that initiates the LOX pathway and is importantly linked to the synthesis of volatile substances in bitter gourd. The expression of the LOX gene is relatively high in bitter gourd fruits. The involvement of the LOX gene in the biosynthesis of C6 aldehyde volatiles has been demonstrated in Cucumis melo, S. lycopersicum and G. max [6]. It was found that the expression of PpLOX2 and PpLOX3 was reduced during peach fruit ripening, and the concentrations of hexanal and (E)-2-hexenol were decreased [60]. In kiwifruits, the expression of AdLOX2, AdLOX3, AdLOX4 and AdLOX6 was down-regulated during ripening, and a decrease in aldehyde correlated with reduced LOX expression levels [61]. In pears, the LOX gene expression levels were low during early development but peaked during mid-development, which is thought to reflect changes in volatile substances [62]. This indicates that LOX genes are significant in regulating the synthesis of volatile substances and are related to the degree of fruit development.

5. Conclusions

In this study, 12 bitter gourd LOX gene family members were identified and obtained. Bioinformatics methods were used to analyze the distribution, chromosomal localization, gene structure, evolutionary affinities and cis-acting elements of the LOX gene in the whole genome of bitter gourd. An analysis of McLOX gene expression by RT-qPCR indicated that McLOX gene family members were expressed differently in tissue. The determination of monoterpene volatiles in bitter gourd of different fruit colors by GC-MS showed that the “green” flavor of bitter gourd mainly originated from alcohols. This study further elucidated the impact of the LOX gene in the lipoxygenase pathway of bitter gourd.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/genes15121557/s1, Table S1. Primer sequences used for RT-qPCR amplification of McLOX. Table S2. McLOX nucleotide sequences of bitter gourd. Table S3. McLOX protein sequences of bitter gourd.

Author Contributions

Conceptualization, F.Z.; data curation, H.G., S.L. (Shuang Liu), H.Z., Q.J. and P.C.; investigation, W.H., S.L. (Shanshan Lin), H.L., Z.H. and J.Z.; writing—original draft preparation, H.G.; writing—review and editing, H.G. and S.L.; project administration, F.Z. All authors have read and agreed to the published version of the manuscript.

Funding

KFB23040 Collection and Evaluation of Vegetable Germplasm Resources in Marine Environment Facilities.

Data Availability Statement

The data presented in this study are available on request from the corresponding author.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Liavonchanka, A.; Feussner, I. Lipoxygenases: Occurrence, functions and catalysis. J. Plant Physiol. 2006, 163, 348–357. [Google Scholar] [CrossRef] [PubMed]
  2. Hildebrand, D.F. Lipoxygenases. Physiol. Plant. 1989, 76, 249–253. [Google Scholar] [CrossRef]
  3. Gigot, C.; Ongena, M.; Fauconnier, M.L.; Wathelet, J.P.; Du Jardin, P.; Thonart, P. The lipoxygenase metabolic pathway in plants: Potential for industrial production of natural green leaf volatiles. BASE 2010, 14, 451–460. [Google Scholar]
  4. Feussner, I.; Kühn, H.; Wasternack, C. Lipoxygenase-dependent degradation of storage lipids. Trends Plant Sci. 2001, 6, 268–273. [Google Scholar] [CrossRef]
  5. Acosta, I.F.; Laparra, H.; Romero, S.P.; Schmelz, E.; Hamberg, M.; Mottinger, J.P.; Moreno, M.A.; Dellaporta, S.L. tasselseed1 is a lipoxygenase affecting jasmonic acid signaling in sex determination of maize. Science 2009, 323, 262–265. [Google Scholar] [CrossRef]
  6. Chen, G.; Hackett, R.; Walker, D.; Taylor, A.; Lin, Z.; Grierson, D. Identification of a specific isoform of tomato lipoxygenase (TomloxC) involved in the generation of fatty acid-derived flavor compounds. Plant Physiol. 2004, 136, 2641–2651. [Google Scholar] [CrossRef] [PubMed]
  7. Chuck, G. Molecular Mechanisms of Sex Determination in Monoecious and Dioecious Plants. Adv. Bot. Res. 2010, 54, 53–83. [Google Scholar]
  8. Kolomiets, M.V.; Hannapel, D.J.; Chen, H.; Tymeson, M.; Gladon, R.J. Lipoxygenase is involved in the control of potato tuber development. Plant Cell 2001, 13, 613–626. [Google Scholar] [CrossRef]
  9. Chauvin, A.; Caldelari, D.; Wolfender, J.L.; Farmer, E.E. Four 13-lipoxygenases contribute to rapid jasmonate synthesis in wounded Arabidopsis thaliana leaves: A role for lipoxygenase 6 in responses to long-distance wound signals. New Phytol. 2013, 197, 566–575. [Google Scholar] [CrossRef]
  10. Sarde, S.J.; Bouwmeester, K.; Venegas-Molina, J.; David, A.; Boland, W.; Dicke, M. Involvement of sweet pepper CaLOX2 in jasmonate-dependent induced defence against Western flower thrips. J. Integr. Plant Biol. 2019, 61, 1085–1098. [Google Scholar] [CrossRef]
  11. Yang, X.Y.; Jiang, W.J.; Yu, H.J. The expression profiling of the lipoxygenase (LOX) family genes during fruit development, abiotic stress and hormonal treatments in cucumber (Cucumis sativus L.). Int. J. Mol. Sci. 2012, 13, 2481–2500. [Google Scholar] [CrossRef] [PubMed]
  12. Tsitsigiannis, D.I.; Keller, N.P. Oxylipins as developmental and host-fungal communication signals. Trends Microbiol. 2007, 15, 109–118. [Google Scholar] [CrossRef] [PubMed]
  13. Baldwin, I.T.; Schmelz, E.A.; Ohnmeiss, T.E. Wound-induced changes in root and shoot jasmonic acid pools correlate with induced nicotine synthesis inNicotiana sylvestris spegazzini and comes. J. Chem. Ecol. 1994, 20, 2139–2157. [Google Scholar] [CrossRef]
  14. Leone, A.; Bleve-Zacheo, T.; Gerardi, C.; Melillo, M.T.; Leo, L.; Zacheo, G. Lipoxygenase involvement in ripening strawberry. J. Agric. Food Chem. 2006, 54, 6835–6844. [Google Scholar] [CrossRef]
  15. Chang-Rong, G.; Yan-Mei, L.I.; Li-Jun, Y.J. Relationship Between LOX Activity, SA and JA Accumulation in Tobacco Leaves Under Water Stress. Agric. Sci. China 2003, 2, 624–628. [Google Scholar]
  16. Vogt, J.; Schiller, D.; Ulrich, D.; Schwab, W.; Dunemann, F. Identification of lipoxygenase (LOX) genes putatively involved in fruit flavour formation in apple (Malus × domestica). Tree Genet. Genomes 2013, 9, 1493–1511. [Google Scholar] [CrossRef]
  17. Zhang, C.; Jin, Y.; Liu, J.; Tang, Y.; Cao, S.; Qi, H.J.S.H. The phylogeny and expression profiles of the lipoxygenase (LOX) family genes in the melon (Cucumis melo L.) genome. Sci. Hortic. 2014, 170, 94–102. [Google Scholar] [CrossRef]
  18. Zhang, B.; Chen, K.; Bowen, J.; Allan, A.; Espley, R.; Karunairetnam, S.; Ferguson, I. Differential expression within the LOX gene family in ripening kiwifruit. J. Exp. Bot. 2006, 57, 3825–3836. [Google Scholar] [CrossRef]
  19. Cuevas-Glory, L.F.; Sosa-Moguel, O.; Pino, J.; Sauri-Duch, E.J.F.A.M. GC–MS Characterization of Volatile Compounds in Habanero Pepper (Capsicum chinense Jacq.) by Optimization of Headspace Solid-Phase Microextraction Conditions. Food Anal. Methods 2015, 8, 1005–1013. [Google Scholar] [CrossRef]
  20. Vogel, J.T.; Tieman, D.M.; Sims, C.A.; Odabasi, A.Z.; Clark, D.G.; Klee, H.J. Carotenoid content impacts flavor acceptability in tomato (Solanum lycopersicum). J. Sci. Food Agric. 2010, 90, 2233–2240. [Google Scholar] [CrossRef]
  21. Trierweiler, B.; Frechen, M.A.; Soukup, S.T.; Egert, B.; Baldermann, S.; Sanguansil, S.; Mccreight, J.D.; Kulling, S.E.; Dhillon, N.P.S. Bitter gourd, Momordica charantia L.; breeding lines differ in secondary metabolite content according to market type. J. Appl. Bot. Food Qual. 2019, 92, 106–115. [Google Scholar]
  22. Crops, G.S.L.B.S.M.F.I.o.V.; Shanghai, F.J.A.A. Correlation and Principal Component Analyses on Major Agronomic Characters of Balsam Pear (Momordica charantia L.). Acta Agric. Shanghai 2004, 20, 33–36. [Google Scholar]
  23. Yu-Sheng, L.U.; Zhi-Xiong, L.; Ji-Shui, Q.; Xiao-Xiao, C.; Jian-Ping, P.J.A.H.S. Fruit Character Diversity Analysis and Numerical Taxonomy of Wampee (Clausena lansium) Germplasm Resources. Acta Hortic. Sin. 2016, 43, 1903. [Google Scholar]
  24. Chambers, E.t.; Koppel, K. Associations of volatile compounds with sensory aroma and flavor: The complex nature of flavor. Molecules 2013, 18, 4887–4905. [Google Scholar] [CrossRef]
  25. Tieman, D.; Bliss, P.; McIntyre, L.M.; Blandon-Ubeda, A.; Bies, D.; Odabasi, A.Z.; Rodríguez, G.R.; van der Knaap, E.; Taylor, M.G.; Goulet, C.; et al. The chemical interactions underlying tomato flavor preferences. Curr. Biol. CB 2012, 22, 1035–1039. [Google Scholar] [CrossRef]
  26. Min, Y. SPME-GC-MS Analysis of Volatile Composition of Bitter Melon Fruits. Food Sci. 2010, 31, 171–174. [Google Scholar]
  27. Finn, R.D.; Clements, J.; Eddy, S.R. HMMER web server: Interactive sequence similarity searching. Nucleic Acids Res. 2011, 39, W29–W37. [Google Scholar] [CrossRef]
  28. Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools: An Integrative Toolkit Developed for Interactive Analyses of Big Biological Data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar] [CrossRef]
  29. Wenli, D.U.; Zhongshan, C.; Duanxiang, X.U.; Tongwei, X.U.; Shan, G.A.O.; Qingfang, W.E.N. Physiological Response and Differentially Expressed Genes Analysis of Transcriptome in Momordica charantia L. Leaf Under Cold Stress. J. Nucl. Agric. Sci. 2021, 35, 338–348. [Google Scholar] [CrossRef]
  30. Arocho, A.; Chen, B.; Ladanyi, M.; Pan, Q. Validation of the 2-DeltaDeltaCt calculation as an alternate method of data analysis for quantitative PCR of BCR-ABL P210 transcripts. Diagn. Mol. Pathol. 2006, 15, 56–61. [Google Scholar] [CrossRef] [PubMed]
  31. Djavanshir, D.; Abolghasem, J.; Parastou, M. Volatile Organic Compounds Trapping from Gaseous Samples on the Basis of Co-Liquefaction with Organic Solvent for Gas Chromatographic Analysis. Curr. Anal. Chem. 2017, 13, 393–401. [Google Scholar] [CrossRef]
  32. Bai, J.; Baldwin, E.A.; Imahori, Y.; Kostenyuk, I.; Burns, J.; Brecht, J.K. Chilling and heating may regulate C6 volatile aroma production by different mechanisms in tomato (Solanum lycopersicum) fruit. Postharvest Biol. Technol. 2011, 60, 111–120. [Google Scholar] [CrossRef]
  33. Ties, P.; Barringer, S. Influence of lipid content and lipoxygenase on flavor volatiles in the tomato peel and flesh. J. Food Sci. 2012, 77, C830–C837. [Google Scholar] [CrossRef]
  34. Buescher, R.H.; Buescher, R.W.J.J.o.F.S. Production and Stability of (E, Z)-2, 6-Nonadienal, the Major Flavor Volatile of Cucumbers. J. Food Sci. 2010, 66, 357–361. [Google Scholar] [CrossRef]
  35. Echeverria, G.; Graell, J.; Lopez, M.L.; Lara, I.J.P.b. Volatile production, quality and aroma-related enzyme activities during maturation of ‘Fuji’ apples. Postharvest Biol. Technol. 2004, 31, 217–227. [Google Scholar] [CrossRef]
  36. Pérez, A.G.; Sanz, C.; Olías, R.; Olías, J.M. Lipoxygenase and Hydroperoxide Lyase Activities in Ripening Strawberry Fruits. Agric. Food Chem. 1999, 47, 249–253. [Google Scholar] [CrossRef]
  37. Wu, M.; Chen, K.S.; Zhang, S.L.J.A.H.S. Involvement of lipoxygenase in the postharvest ripening of peach fruit. Acta Hortic. Sin. 1999, 26, 227–231. [Google Scholar]
  38. Oliveira, I.; Guedes de Pinho, P.; Malheiro, R.; Baptista, P.; Pereira, J.A. Volatile profile of Arbutus unedo L. fruits through ripening stage. Food Chem. 2011, 128, 667–673. [Google Scholar] [CrossRef]
  39. Bannenberg, G.; Martínez, M.; Hamberg, M.; Castresana, C. Diversity of the enzymatic activity in the lipoxygenase gene family of Arabidopsis thaliana. Lipids 2009, 44, 85–95. [Google Scholar] [CrossRef]
  40. Bell, E.; Creelman, R.A.; Mullet, J.E. A chloroplast lipoxygenase is required for wound-induced jasmonic acid accumulation in Arabidopsis. Proc. Natl. Acad. Sci. USA 1995, 92, 8675–8679. [Google Scholar] [CrossRef]
  41. Melan, M.A.; Dong, X.; Endara, M.E.; Davis, K.R.; Ausubel, F.M.; Peterman, T.K. An Arabidopsis thaliana lipoxygenase gene can be induced by pathogens, abscisic acid, and methyl jasmonate. Plant Physiol. 1993, 101, 441–450. [Google Scholar] [CrossRef] [PubMed]
  42. Zhang, J.; Ng, C.; Jiang, Y.; Wang, X.; Wang, S.; Wang, S. Genome-wide identification and analysis of LOX genes in soybean cultivar “Zhonghuang 13”. Front. Genet. 2022, 13, 1020554. [Google Scholar] [CrossRef]
  43. Blee, E.; Joyard, J. Envelope Membranes from Spinach Chloroplasts Are a Site of Metabolism of Fatty Acid Hydroperoxides. Plant Physiol. 1996, 110, 445–454. [Google Scholar] [CrossRef] [PubMed]
  44. Feussner, I.; Wasternack, C. The lipoxygenase pathway. Annu. Rev. Plant Biol. 2002, 53, 275–297. [Google Scholar] [CrossRef]
  45. Dong, W.; Jiao, B.; Wang, J.; Sun, L.; Li, S.; Wu, Z.; Gao, J.; Zhou, S. Genome-Wide Identification and Expression Analysis of Lipoxygenase Genes in Rose (Rosa chinensis). Genes 2023, 14, 1957. [Google Scholar] [CrossRef]
  46. Wolters, H.; Jürgens, G. Survival of the flexible: Hormonal growth control and adaptation in plant development. Nat. Rev. Genet. 2009, 10, 305–317. [Google Scholar] [CrossRef]
  47. D’Onofrio, C.; Matarese, F.; Cuzzola, A. Effect of methyl jasmonate on the aroma of Sangiovese grapes and wines. Food Chem 2018, 242, 352–361. [Google Scholar] [CrossRef]
  48. Li, S.-t.; Zhang, M.; Fu, C.-h.; Xie, S.; Zhang, Y.; Yu, L.-j. Molecular Cloning and Characterization of Two 9-Lipoxygenase Genes from Taxus chinensis. Plant Mol. Biol. Report. 2012, 30, 1283–1290. [Google Scholar] [CrossRef]
  49. Park, Y.S.; Kunze, S.; Ni, X.; Feussner, I.; Kolomiets, M.V. Comparative molecular and biochemical characterization of segmentally duplicated 9-lipoxygenase genes ZmLOX4 and ZmLOX5 of maize. Planta 2010, 231, 1425–1437. [Google Scholar] [CrossRef]
  50. De La Fuente, G.N.; Murray, S.C.; Isakeit, T.; Park, Y.S.; Yan, Y.; Warburton, M.L.; Kolomiets, M.V. Characterization of genetic diversity and linkage disequilibrium of ZmLOX4 and ZmLOX5 loci in maize. PLoS ONE 2013, 8, e53973. [Google Scholar] [CrossRef]
  51. Gao, X.; Starr, J.; Göbel, C.; Engelberth, J.; Feussner, I.; Tumlinson, J.; Kolomiets, M. Maize 9-lipoxygenase ZmLOX3 controls development, root-specific expression of defense genes, and resistance to root-knot nematodes. Mol. Plant-Microbe Interact. MPMI 2008, 21, 98–109. [Google Scholar] [CrossRef]
  52. Nemchenko, A.; Kunze, S.; Feussner, I.; Kolomiets, M. Duplicate maize 13-lipoxygenase genes are differentially regulated by circadian rhythm, cold stress, wounding, pathogen infection, and hormonal treatments. J. Exp. Bot. 2006, 57, 3767–3779. [Google Scholar] [CrossRef]
  53. Christensen, S.A.; Nemchenko, A.; Borrego, E.; Murray, I.; Sobhy, I.S.; Bosak, L.; DeBlasio, S.; Erb, M.; Robert, C.A.; Vaughn, K.A.; et al. The maize lipoxygenase, ZmLOX10, mediates green leaf volatile, jasmonate and herbivore-induced plant volatile production for defense against insect attack. Plant J. Cell Mol. Biol. 2013, 74, 59–73. [Google Scholar] [CrossRef]
  54. Li, D.P.; Xu, Y.F.; Sun, L.P.; Liu, L.X.; Hu, X.L.; Li, D.Q.; Shu, H.R. Salicylic acid, ethephon, and methyl jasmonate enhance ester regeneration in 1-MCP-treated apple fruit after long-term cold storage. J. Agric. Food Chem. 2006, 54, 3887–3895. [Google Scholar] [CrossRef]
  55. Yang, C.; Wang, Y.; Wu, B.; Fang, J.; Li, S. Volatile compounds evolution of three table grapes with different flavour during and after maturation. Food Chem. 2011, 128, 823–830. [Google Scholar] [CrossRef]
  56. Eduardo, I.; Chietera, G.; Bassi, D.; Rossini, L.; Vecchietti, A. Identification of key odor volatile compounds in the essential oil of nine peach accessions. J. Sci. Food Agric. 2010, 90, 1146–1154. [Google Scholar] [CrossRef]
  57. Pichersky, E.; Noel, J.P.; Dudareva, N. Biosynthesis of plant volatiles: Nature’s diversity and ingenuity. Science 2006, 311, 808–811. [Google Scholar] [CrossRef]
  58. Tsao, R.; Yu, Q. Nematicidal Activity of Monoterpenoid Compounds against Economically Important Nematodes in Agriculture. J. Essent. Oil Res. 2000, 12, 350–354. [Google Scholar] [CrossRef]
  59. Wu, S.H.; Wu, D.G.; Chen, Y.W. Chemical constituents and bioactivities of plants from the genus Paeonia. Chem. Biodivers. 2010, 7, 90–104. [Google Scholar] [CrossRef]
  60. Zhang, B.; Shen, J.Y.; Wei, W.W.; Xi, W.P.; Xu, C.J.; Ferguson, I.; Chen, K. Expression of genes associated with aroma formation derived from the fatty acid pathway during peach fruit ripening. J. Agric. Food Chem. 2010, 58, 6157–6165. [Google Scholar] [CrossRef]
  61. Zhang, B.; Yin, X.R.; Li, X.; Yang, S.L.; Ferguson, I.B.; Chen, K.S. Lipoxygenase gene expression in ripening kiwifruit in relation to ethylene and aroma production. J. Agric. Food Chem. 2009, 57, 2875–2881. [Google Scholar] [CrossRef] [PubMed]
  62. Li, P.C.; Yu, S.W.; Shen, J.; Li, Q.Q.; Li, D.P.; Li, D.Q.; Zheng, C.C.; Shu, H.R. The transcriptional response of apple alcohol acyltransferase (MdAAT2) to salicylic acid and ethylene is mediated through two apple MYB TFs in transgenic tobacco. Plant Mol. Biol. 2014, 85, 627–638. [Google Scholar] [CrossRef] [PubMed]
Figure 1. Chromosomal location of the McLOX.
Figure 1. Chromosomal location of the McLOX.
Genes 15 01557 g001
Figure 2. Analysis of protein secondary structure of bitter gourd LOX gene family.
Figure 2. Analysis of protein secondary structure of bitter gourd LOX gene family.
Genes 15 01557 g002
Figure 3. Tertiary structure of bitter gourd McLOX.
Figure 3. Tertiary structure of bitter gourd McLOX.
Genes 15 01557 g003
Figure 4. Phylogenetic tree analysis of bitter gourd McLOX proteins and LOX proteins from A. thaliana, S. lycopersicum and P. trichocarpa.
Figure 4. Phylogenetic tree analysis of bitter gourd McLOX proteins and LOX proteins from A. thaliana, S. lycopersicum and P. trichocarpa.
Genes 15 01557 g004
Figure 5. Distribution of conserved motifs and gene structure of McLOX. (A) Gene structure. (B) Protein conserved motifs.
Figure 5. Distribution of conserved motifs and gene structure of McLOX. (A) Gene structure. (B) Protein conserved motifs.
Genes 15 01557 g005
Figure 6. Type and number of cis-regulatory elements in the promoter of McLOX.
Figure 6. Type and number of cis-regulatory elements in the promoter of McLOX.
Genes 15 01557 g006
Figure 7. Expression pattern of McLOX gene in different tissue sites in bitter gourd. Error bars represent the standard errors (SEs). Different lowercase letters represent significant differences (p < 0.05).
Figure 7. Expression pattern of McLOX gene in different tissue sites in bitter gourd. Error bars represent the standard errors (SEs). Different lowercase letters represent significant differences (p < 0.05).
Genes 15 01557 g007
Figure 8. Types and relative contents of volatile monoterpenes in bitter gourd of different fruit colors. (A) Volatile monoterpene species. (B) Relative content of volatile monoterpenes per fruit color. Error bars represent the standard errors (SEs). Different lowercase letters represent significant differences (p < 0.05).
Figure 8. Types and relative contents of volatile monoterpenes in bitter gourd of different fruit colors. (A) Volatile monoterpene species. (B) Relative content of volatile monoterpenes per fruit color. Error bars represent the standard errors (SEs). Different lowercase letters represent significant differences (p < 0.05).
Genes 15 01557 g008
Table 1. Physico-chemical properties of McLOX.
Table 1. Physico-chemical properties of McLOX.
Gene Name.Gene IDAmino
Acid
Molecular Weight
(kDa)
PIGravyInstability IndexSubcellular
Localization
McLOX1MC02g008176386.745.43−0.39537.82Cytoplasm
McLOX2MC02g0083902102.566.03−0.46641.39Cytoplasm
McLOX3MC07g0692958109.657.18−0.36242.88Cytoplasm
McLOX4MC08g2254895101.426.18−0.3340.53Cytoplasm
McLOX5MC08g225587398.886.05−0.34539.7Cytoplasm
McLOX6MC08g225688099.676.02−0.36541.88Cytoplasm
McLOX7MC08g_new058985999.196.21−0.53946.15Cytoplasm
McLOX8MC08g_new059186297.525.85−0.4242.85Cytoplasm
McLOX9MC08g225779691.075.38−0.41546.75Cytoplasm
McLOX10MC09g0182910102.966.91−0.41143.25Cytoplasm
McLOX11MC09g079582794.558.46−0.50440.83Cytoplasm
McLOX12MC09g1854926104.917.19−0.45147.32Cytoplasm
Table 2. Secondary structures of McLOX.
Table 2. Secondary structures of McLOX.
Gene Nameα-Helix/%Extended Strand/%β-Turn/%Random Coil/%
McLOX131.5919.929.8338.66
McLOX234.0418.079.238.69
McLOX33816.189.1936.64
McLOX439.4416.429.1634.97
McLOX536.0818.2110.0835.62
McLOX63517.1610.5737.27
McLOX73916.658.0336.32
McLOX831.7918.2111.1438.86
McLOX937.5615.5810.9335.93
McLOX1036.1516.268.6838.9
McLOX113815.728.4637.73
McLOX1234.9918.799.1837.04
Table 3. Protein domain/s identified in bitter gourd lipoxygenase (LOX) proteins (N→C).
Table 3. Protein domain/s identified in bitter gourd lipoxygenase (LOX) proteins (N→C).
Gene NameGene IDPLAT/LH2
(IPR036392)
Lipoxygenase (IPR036226)Iron Binding (IPR020833)
McLOX1MC02g00812–7374–763416–430
McLOX2MC02g008372–210211–902555–569
McLOX3MC07g0692118–258259–958609–623
McLOX4MC08g225453–200201–895551–565
McLOX5MC08g225539–183184–873529–543
McLOX6MC08g225640–184185–880536–550
McLOX7MC08g_new058917–163164–859515–529
McLOX8MC08g_new059118–165167–862518–532
McLOX9MC08g22572–100101–796452–466
McLOX10MC09g018277–219221–910564–578
McLOX11MC09g079517–139140–827478–492
McLOX12MC09g185490–230231–926579–593
Table 4. Consensus sequence of predicted McLOX motifs in bitter gourd.
Table 4. Consensus sequence of predicted McLOX motifs in bitter gourd.
Gene NameE-ValueWidthSitesBest Possible Match
Motif18.40E-3995012DAGYHQLISHWLNTHAVIEPFVIATNRQLSVMHPIYKLLHPHFRDTMNIN
Motif21.10E-3335012DKKDEPWWPKMQTLQDLIESCTTIIWIASALHAAVNFGQYPYGGYVPNRP
Motif38.50E-3225012ALPADLIKRGVAVEDPSSPHGLRLLIEDYPFAVDGLEIWSAIKTWVTDYC
Motif49.60E-2875012IFFANKSYLPSETPEPLRKYREEELLNLRGBGKGERKEWDRIYDYDVYND
Motif55.10E-2344112AWRTDEEFARZMLAGVNPVIIRRLQEFPPLSKLDPEIYGDQ
Motif67.90E-178508GIPGAFFIRNGHTSEFFLKSLTLEDVPGHGRIHFDCNSWVYPSRRYKKDR
Motif74.50E-1523112GLTVDEAJKQNKLYILDHHDALMPYLRRINS
Motif82.70E-2085012YKELESNPEKAFLRTJPSQLQALLGVSLIEILSRHSPDEVYLGQRASPEW
Motif91.50E-1482912TKTYATRTLLFLKEDGTLKPLAIELSLPH
Motif104.50E-1402912ALARQSLINADGIJESTHFPGKYSMELSS
Motif112.20E-1393612LKEIEERIMRRNKDPRLKNRTGPVVVPYTLLFPSSS
Motif127.40E-1244111IYVPRDERFGHLKMSDFLAYALKSLSHSJVPGLESLFDSTP
Motif136.40E-1082911GAISKVYFPAEEGVESSIWQLAKAYVAVN
Motif141.80E-1052112GGKZYPYPRRGRTGRPPSKKD
Motif156.30E-101507EFDKFQDVHDLYEGGFPVPLNLLENLTENIPPPLFKEJLRSDGERFLKFP
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Ge, H.; Liu, S.; Zheng, H.; Chang, P.; Huang, W.; Lin, S.; Zheng, J.; Li, H.; Huang, Z.; Jia, Q.; et al. Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia). Genes 2024, 15, 1557. https://doi.org/10.3390/genes15121557

AMA Style

Ge H, Liu S, Zheng H, Chang P, Huang W, Lin S, Zheng J, Li H, Huang Z, Jia Q, et al. Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia). Genes. 2024; 15(12):1557. https://doi.org/10.3390/genes15121557

Chicago/Turabian Style

Ge, Haicui, Shuang Liu, Hongzhe Zheng, Pengyan Chang, Weiqun Huang, Shanshan Lin, Jingyuan Zheng, Honglong Li, Zedong Huang, Qi Jia, and et al. 2024. "Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia)" Genes 15, no. 12: 1557. https://doi.org/10.3390/genes15121557

APA Style

Ge, H., Liu, S., Zheng, H., Chang, P., Huang, W., Lin, S., Zheng, J., Li, H., Huang, Z., Jia, Q., & Zhong, F. (2024). Identification and Expression Analysis of Lipoxygenase Gene in Bitter Gourd (Momordica charantia). Genes, 15(12), 1557. https://doi.org/10.3390/genes15121557

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop