Peptide-Enabled Nanocomposites Offer Biomimetic Reconstruction of Silver Diamine Fluoride-Treated Dental Tissues
Abstract
1. Introduction
2. Materials and Methods
2.1. Materials
2.2. Peptide Design
2.3. Peptide Synthesis
2.4. Peptide Functionalization of Dental Tissue
2.5. Silver-Coated Silica Substrates
2.6. Preparation of Slabs of Dental Tissues
2.7. SDF Treatment Protocol
2.8. Enzyme-Mediated Biomineralization
2.9. Fluorescence and Optical Microscopy
2.10. Mineral Characterization
3. Results
3.1. Silver Binding Peptide Assembles onto SDF-Treated Dental Tissues
3.2. Bifunctional Peptide Design Targeting SDF-Treated Dental Tissues
3.2.1. Computational Analysis of Peptide Design
3.2.2. Functional Activity of sh-ADP5-AgBP2 on Ag-Coated Silica Substrates
3.3. Bifunctional Peptide-Enabled Mineralization on SDF-Treated Dental Tissues
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Balakrishnan, M.; Simmonds, R.S.; Tagg, J.R. Dental Caries Is a Preventable Infectious Disease. Aust. Dent. J. 2000, 45, 235–245. [Google Scholar] [CrossRef] [PubMed]
- Caufield, P.W.; Li, Y.; Dasanayake, A. Dental Caries: An Infectious and Transmissible Disease. Compend. Contin. Educ. Dent. 2005, 26, 10–16. [Google Scholar] [PubMed]
- Chu, C.; Lo, E. Promoting Caries Arrest in Children with Silver Diamine Fluoride: A Review. Oral Health Prev. Dent. 2008, 6, 315–321. [Google Scholar] [PubMed]
- Yee, R.; Holmgren, C.; Mulder, J.; Lama, D.; Walker, D.; Van Palenstein Helderman, W. Efficacy of Silver Diamine Fluoride for Arresting Caries Treatment. J. Dent. Res. 2009, 88, 644–647. [Google Scholar] [CrossRef]
- Çolak, H.; Dülgergil, Ç.T.; Dalli, M.; Hamidi, M.M. Early Childhood Caries Update: A Review of Causes, Diagnoses, and Treatments. J. Nat. Sci. Biol. Med. 2013, 4, 29. [Google Scholar] [PubMed]
- Dye, B.A.; Hsu, K.-L.C.; Afful, J. Prevalence and Measurement of Dental Caries in Young Children. Pediatr. Dent. 2015, 37, 200–216. [Google Scholar] [PubMed]
- Kassebaum, N.J.; Bernabe, E.; Dahiya, M.; Bhandari, B.; Murray, C.J.; Marcenes, W. Global Burden of Untreated Caries: A Systematic Review and Metaregression. J. Dent. Res. 2015, 94, 650–658. [Google Scholar] [CrossRef]
- Gao, S.S.; Zhao, I.S.; Hiraishi, N.; Duangthip, D.; Mei, M.; Lo, E.; Chu, C. Clinical Trials of Silver Diamine Fluoride in Arresting Caries among Children: A Systematic Review. JDR Clin. Transl. Res. 2016, 1, 201–210. [Google Scholar] [CrossRef]
- Anil, S.; Anand, P.S. Early Childhood Caries: Prevalence, Risk Factors, and Prevention. Front. Pediatr. 2017, 5, 157. [Google Scholar] [CrossRef]
- Institute of Medicine. Advancing Oral Health in America; The National Academies Press: Washington, DC, USA, 2011. [Google Scholar] [CrossRef]
- National Institutes of Health. Oral Health in America: Advances and Challenges; US Department of Health and Human Services, National Institute of Dental and Craniofacial Research: Bethesda, MD, USA, 2021. [Google Scholar]
- Dye, B.A.; Albino, J.; D’souza, R.N. Oral Health Problems Are Global and Need to Be Addressed in the USA. Lancet 2022, 399, 127–128. [Google Scholar] [CrossRef]
- Shiboski, C.H.; Gansky, S.A.; Ramos-Gomez, F.; Ngo, L.; Isman, R.; Pollick, H.F. The Association of Early Childhood Caries and Race/Ethnicity among California Preschool Children. J. Public Health Dent. 2003, 63, 38–46. [Google Scholar] [CrossRef] [PubMed]
- Ramos-Gomez, F.J.; Crystal, Y.O.; Ng, M.W.; Crall, J.J.; Featherstone, J.D.B. Pediatric Dental Care: Prevention and Management Protocols Based on Caries Risk Assessment. J. Calif. Dent. Assoc. 2010, 38, 746–761. [Google Scholar] [PubMed]
- Jain, M.; Namdev, R.; Bodh, M.; Dutta, S.; Singhal, P.; Kumar, A. Social and Behavioral Determinants for Early Childhood Caries among Preschool Children in India. J. Dent. Res. Dent. Clin. Dent. Prospect. 2015, 9, 115. [Google Scholar] [CrossRef] [PubMed]
- Horowitz, H.S. Research Issues in Early Childhood Caries. Community Dent. Oral Epidemiol. 1998, 26, 67–81. [Google Scholar] [CrossRef] [PubMed]
- Congiu, G.; Campus, G.; Lugliè, P.F. Early Childhood Caries (Ecc) Prevalence And Background Factors: A Review. Oral Health Prev. Dent. 2014, 12, 71–76. [Google Scholar]
- Berkowitz, R.J. Causes, Treatment and Prevention of Early Childhood Caries: A Microbiologic Perspective. J.-Can. Dent. Assoc. 2003, 69, 304–307. [Google Scholar]
- Holve, S.; Braun, P.; Irvine, J.D.; Nadeau, K.; Schroth, R.J.; Bell, S.L.; Calac, D.J.; Empey, A.; Nadeau, K.J.; Oski, J.A. Early Childhood Caries in Indigenous Communities. Pediatrics 2021, 147, e2021051481. [Google Scholar] [CrossRef]
- Casamassimo, P.S.; Thikkurissy, S.; Edelstein, B.L.; Maiorini, E. Beyond the Dmft: The Human and Economic Cost of Early Childhood Caries. J. Am. Dent. Assoc. 2009, 140, 650–657. [Google Scholar] [CrossRef]
- Chu, C.; Lo, E.; Lin, H. Effectiveness of Silver Diamine Fluoride and Sodium Fluoride Varnish in Arresting Dentin Caries in Chinese Pre-School Children. J. Dent. Res. 2002, 81, 767–770. [Google Scholar] [CrossRef]
- Marinho, V. Cochrane Reviews of Randomized Trials of Fluoride Therapies for Preventing Dental Caries. Eur. Arch. Paediatr. Dent. 2009, 10, 183–191. [Google Scholar] [CrossRef]
- Hiiri, A.; Ahovuo-Saloranta, A.; Nordblad, A.; Mäkelä, M. Pit and Fissure Sealants versus Fluoride Varnishes for Preventing Dental Decay in Children and Adolescents. Cochrane Database Syst. Rev. 2010. [Google Scholar] [CrossRef]
- Rosenblatt, A.; Stamford, T.; Niederman, R. Silver Diamine Fluoride: A Caries “Silver-Fluoride Bullet”. J. Dent. Res. 2009, 88, 116–125. [Google Scholar] [CrossRef] [PubMed]
- Horst, J.A.; Ellenikiotis, H.; Milgrom, P.L. UCSF Protocol For Caries Arrest Using Silver Diamine Fluoride: Rationale, Indications And Consent. J. Calif. Dent. Assoc. 2016, 44, 16–28. [Google Scholar] [PubMed]
- Zhao, I.S.; Gao, S.S.; Hiraishi, N.; Burrow, M.F.; Duangthip, D.; Mei, M.L.; Lo, E.C.-M.; Chu, C.-H. Mechanisms of Silver Diamine Fluoride on Arresting Caries: A Literature Review. Int. Dent. J. 2018, 68, 67–76. [Google Scholar] [CrossRef] [PubMed]
- Crystal, Y.O.; Niederman, R. Silver Diamine Fluoride Treatment Considerations in Children’s Caries Management. Pediatr. Dent. 2016, 38, 466–471. [Google Scholar] [PubMed]
- Contreras, V.; Toro, M.J.; Elías-Boneta, A.R.; Encarnación-Burgos, M.A. Effectiveness of Silver Diamine Fluoride in Caries Prevention and Arrest: A Systematic Literature Review. Gen. Dent. 2017, 65, 22. [Google Scholar]
- Mei, M.L.; Lo, E.C.M.; Chu, C.H. Arresting Dentine Caries with Silver Diamine Fluoride: What’s Behind It? J. Dent. Res. 2018, 97, 751–758. [Google Scholar] [CrossRef] [PubMed]
- Nizami, M.Z.I.; Xu, V.W.; Yin, I.X.; Yu, O.Y.; Chu, C.H. Metal and Metal Oxide Nanoparticles in Caries Prevention: A Review. Nanomaterials 2021, 11, 3446. [Google Scholar] [CrossRef]
- Seto, J.; Horst, J.A.; Parkinson, D.Y.; Frachella, J.C.; Derisi, J.L. Enhanced Tooth Structure via Silver Microwires Following Treatment with 38 Percent Silver Diamine Fluoride. Pediatr. Dent. 2020, 42, 226–231. [Google Scholar]
- Milgrom, P.; Horst, J.A.; Ludwig, S.; Rothen, M.; Chaffee, B.W.; Lyalina, S.; Pollard, K.S.; Derisi, J.L.; Mancl, L. Topical Silver Diamine Fluoride for Dental Caries Arrest in Preschool Children: A Randomized Controlled Trial and Microbiological Analysis of Caries Associated Microbes and Resistance Gene Expression. J. Dent. 2018, 68, 72–78. [Google Scholar] [CrossRef]
- Fung, H.; Wong, M.C.; Lo, E.C.; Chu, C. Arresting Early Childhood Caries with Silver Diamine Fluoride—A Literature Review. Oral Hyg. Health 2013, 1, 117. [Google Scholar]
- Horst, J. Silver Fluoride As A Treatment For Dental Caries. Adv. Dent. Res. 2018, 29, 135–140. [Google Scholar] [CrossRef] [PubMed]
- Peng, J.-Y.; Botelho, M.; Matinlinna, J. Silver Compounds Used in Dentistry for Caries Management: A Review. J. Dent. 2012, 40, 531–541. [Google Scholar] [CrossRef] [PubMed]
- Duangthip, D.; Jiang, M.; Chu, C.H.; Lo, E.C. Non-Surgical Treatment of Dentin Caries in Preschool Children–Systematic Review. BMC Oral Health 2015, 15, 1–10. [Google Scholar] [CrossRef] [PubMed]
- Duangthip, D.; Fung, M.; Wong, M.; Chu, C.; Lo, E. Adverse effects of silver diamine fluoride treatment among preschool children. J. Dent. Res. 2018, 97, 395–401. [Google Scholar] [CrossRef] [PubMed]
- Crystal, Y.O.; Janal, M.N.; Hamilton, D.S.; Niederman, R. Parental Perceptions and Acceptance of Silver Diamine Fluoride Staining. J. Am. Dent. Assoc. 2017, 148, 510–518.e4. [Google Scholar] [CrossRef] [PubMed]
- Crystal, Y.O.; Niederman, R. Evidence-Based Dentistry Update on Silver Diamine Fluoride. Dent. Clin. 2019, 63, 45–68. [Google Scholar] [CrossRef]
- Ko, A.K.; Matsui, N.; Nakamoto, A.; Ikeda, M.; Nikaido, T.; Burrow, M.F.; Tagami, J. Effect of Silver Diammine Fluoride Application on Dentin Bonding Performance. Dent. Mater. J. 2020, 39, 407–414. [Google Scholar] [CrossRef]
- Tamerler, C.; Sarikaya, M. Genetically Designed Peptide-Based Molecular Materials. ACS Nano 2009, 3, 1606–1615. [Google Scholar] [CrossRef]
- Hnilova, M.; So, C.R.; Oren, E.E.; Wilson, B.R.; Kacar, T.; Tamerler, C.; Sarikaya, M. Peptide-Directed Co-Assembly of Nanoprobes on Multimaterial Patterned Solid Surfaces. Soft Matter 2012, 8, 4327–4334. [Google Scholar] [CrossRef]
- Hnilova, M.; Karaca, B.T.; Park, J.; Jia, C.; Wilson, B.R.; Sarikaya, M.; Tamerler, C. Fabrication of Hierarchical Hybrid Structures Using Bio-Enabled Layer-By-Layer Self-Assembly. Biotechnol. Bioeng. 2012, 109, 1120–1130. [Google Scholar] [CrossRef] [PubMed]
- Gungormus, M.; Oren, E.E.; Horst, J.A.; Fong, H.; Hnilova, M.; Somerman, M.J.; Snead, M.L.; Samudrala, R.; Tamerler, C.; Sarikaya, M. Cementomimetics—Constructing A Cementum-Like Biomineralized Microlayer via Amelogenin-Derived Peptides. Int. J. Oral Sci. 2012, 4, 69–77. [Google Scholar] [CrossRef] [PubMed]
- Ye, Q.; Spencer, P.; Yuca, E.; Tamerler, C. Engineered Peptide Repairs Defective Adhesive-Dentin Interface. Macromol. Mater. Eng. 2017, 302, 1600487. [Google Scholar] [CrossRef] [PubMed]
- Wisdom, C.; Chen, C.; Yuca, E.; Zhou, Y.; Tamerler, C.; Snead, M.L. Repeatedly Applied Peptide Film Kills Bacteria on Dental Implants. JOM 2019, 71, 1271–1280. [Google Scholar] [CrossRef] [PubMed]
- Xie, S.-X.; Boone, K.; Vanoosten, S.K.; Yuca, E.; Song, L.; Ge, X.; Ye, Q.; Spencer, P.; Tamerler, C. Peptide Mediated Antimicrobial Dental Adhesive System. Appl. Sci. 2019, 9, 557. [Google Scholar] [CrossRef] [PubMed]
- Yuca, E.; Tamerler, C. Self-Assembled Recombinant Proteins On Metallic Nanoparticles as Bimodal Imaging Probes. JOM 2019, 71, 1281–1290. [Google Scholar] [CrossRef]
- Fischer, N.G.; Münchow, E.A.; Tamerler, C.; Bottino, M.C.; Aparicio, C. Harnessing Biomolecules for Bioinspired Dental Biomaterials. J. Mater. Chem. B 2020, 8, 8713–8747. [Google Scholar] [CrossRef]
- Xie, S.-X.; Song, L.; Yuca, E.; Boone, K.; Sarikaya, R.; Vanoosten, S.K.; Misra, A.; Ye, Q.; Spencer, P.; Tamerler, C. Antimicrobial Peptide–Polymer Conjugates For Dentistry. ACS Appl. Polym. Mater. 2020, 2, 1134–1144. [Google Scholar] [CrossRef]
- Yuca, E.; Xie, S.-X.; Song, L.; Boone, K.; Kamathewatta, N.; Woolfolk, S.K.; Elrod, P.; Spencer, P.; Tamerler, C. Reconfigurable Dual Peptide Tethered Polymer System Offers a Synergistic Solution for Next Generation Dental Adhesives. Int. J. Mol. Sci. 2021, 22, 6552. [Google Scholar] [CrossRef]
- Sarikaya, R.; Song, L.; Yuca, E.; Xie, S.-X.; Boone, K.; Misra, A.; Spencer, P.; Tamerler, C. Bioinspired Multifunctional Adhesive System for Next Generation Bio-Additively Designed Dental Restorations. J. Mech. Behav. Biomed. Mater. 2021, 113, 104135. [Google Scholar] [CrossRef]
- Hnilova, M.; Liu, X.; Yuca, E.; Jia, C.; Wilson, B.; Karatas, A.Y.; Gresswell, C.; Ohuchi, F.; Kitamura, K.; Tamerler, C. Multifunctional Protein-Enabled Patterning on Arrayed Ferroelectric Materials. ACS Appl. Mater. Interfaces 2012, 4, 1865–1871. [Google Scholar] [CrossRef] [PubMed]
- Vanoosten, S.K.; Yuca, E.; Karaca, B.T.; Boone, K.; Snead, M.L.; Spencer, P.; Tamerler, C. Biosilver Nanoparticle Interface Offers Improved Cell Viability. Surf. Innov. 2016, 4, 121–132. [Google Scholar] [CrossRef] [PubMed]
- Gibson, C.W.; Yuan, Z.A.; Hall, B.; Longenecker, G.; Chen, E.; Thyagarajan, T.; Sreenath, T.; Wright, J.T.; Decker, S.; Piddington, R.; et al. Amelogenin-Deficient Mice Display an Amelogenesis Imperfecta Phenotype. J. Biol. Chem. 2001, 276, 31871–31875. [Google Scholar] [CrossRef] [PubMed]
- Snead, M.L. Amelogenin Protein Exhibits a Modular Design: Implications for Form and Function. Connect. Tissue Res. 2003, 44 (Suppl. S1), 47–51. [Google Scholar] [CrossRef]
- Snead, M.L.; Zhu, D.H.; Lei, Y.; Luo, W.; Bringas, P.O., Jr.; Sucov, H.M.; Rauth, R.J.; Paine, M.L.; White, S.N. A Simplified Genetic Design for Mammalian Enamel. Biomaterials 2011, 32, 3151–3157. [Google Scholar] [CrossRef][Green Version]
- Moradian-Oldak, J.; Paine, M.L.; Lei, Y.P.; Fincham, A.G.; Snead, M.L. Self-Assembly Properties of Recombinant Engineered Amelogenin Proteins Analyzed by Dynamic Light Scattering and Atomic Force Microscopy. J. Struct. Biol. 2000, 131, 27–37. [Google Scholar] [CrossRef]
- Ungormus, M.; Fong, H.; Kim, I.W.; Evans, J.S.; Tamerler, C.; Sarikaya, M. Regulation of In Vitro Calcium Phosphate Mineralization by Combinatorially Selected Hydroxyapatite-Binding Peptides. Biomacromolecules 2008, 9, 966–973. [Google Scholar] [CrossRef]
- Oren, E.E.; Tamerler, C.; Sahin, D.; Hnilova, M.; Seke, U.O.; Sarikaya, M.; Samudrala, R. A Novel Knowledge-Based Approach to Design Inorganic Binding Peptides. Bioinformatics 2007, 23, 2816–2822. [Google Scholar] [CrossRef]
- Dogan, S.; Fong, H.; Yucesoy, D.T.; Cousin, T.; Gresswell, C.; Dag, S.; Huang, G.; Sarikaya, M. Biomimetic Tooth Repair: Amelogenin-Derived Peptide Enables In Vitro Remineralization Of Human Enamel. ACS Biomater. Sci. Eng. 2018, 4, 1788–1796. [Google Scholar] [CrossRef]
- Zhou, W.; Peng, X.; Zhou, X.; Bonavente, A.; Weir, M.D.; Melo, M.A.S.; Imazato, S.; Oates, T.W.; Cheng, L.; Xu, H.H.K. Novel Nanocomposite Inhibiting Caries at the Enamel Restoration Margins in an In Vitro Saliva-Derived Biofilm Secondary Caries Model. Int. J. Mol. Sci. 2020, 21, 6369. [Google Scholar] [CrossRef]
- Karaca, B.T.; Meyer, J.; Vanoosten, S.; Richter, M.; Tamerler, C. Modular Peptide-Based Hybrid Nanoprobes for Bio-Imaging and Bio-Sensing. MRS Online Proc. Libr. 2014, 1621, 155–161. [Google Scholar] [CrossRef]
- Zhang, S.; Karaca, B.T.; Vanoosten, S.K.; Yuca, E.; Mahalingam, S.; Edirisinghe, M.; Tamerler, C. Coupling Infusion and Gyration for the Nanoscale Assembly of Functional Polymer Nanofibers Integrated with Genetically Engineered Proteins. Macromol. Rapid Commun. 2015, 36, 1322–1328. [Google Scholar] [CrossRef] [PubMed]
- Lamiable, A.; Thevenet, P.; Rey, J.; Vavrusa, M.; Derreumaux, P.; Tuffery, P. Pep-Fold3: Faster De Novo Structure Prediction for Linear Peptides in Solution and in Complex. Nucleic Acids Res. 2016, 44, W449–W454. [Google Scholar] [CrossRef] [PubMed]
- Chen, J.E.; Huang, C.C.; Ferrin, T.E. Rrdistmaps: A UCSF Chimera Tool for Viewing and Comparing Protein Distance Maps. Bioinformatics 2015, 31, 1484–1486. [Google Scholar] [CrossRef]
- Wisdom, E.C.; Zhou, Y.; Chen, C.; Tamerler, C.; Snead, M.L. Mitigation of Peri-Implantitis by Rational Design of Bifunctional Peptides with Antimicrobial Properties. ACS Biomater. Sci. Eng. 2019, 6, 2682–2695. [Google Scholar] [CrossRef]
- Edwards, C.M.; Ulapane, S.B.; Kamathewatta, N.J.B.; Ashberry, H.M.; Berrie, C.L. Fabrication and Growth Control of Metal Nanostructures through Exploration of Atomic Force Microscopy-Based Patterning and Electroless Deposition Conditions. J. Phys. Chem. C 2020, 124, 25588–25601. [Google Scholar] [CrossRef]
- Ulapane, S.B.; Kamathewatta, N.J.B.; Ashberry, H.M.; Berrie, C.L. Controlled Electroless Deposition of Noble Metals on Silicon Substrates Using Self-Assembled Monolayers as Molecular Resists to Generate Nanopatterned Surfaces for Electronics and Plasmonics. ACS Appl. Nano Mater. 2019, 2, 7114–7125. [Google Scholar] [CrossRef]
- Hall Sedlak, R.; Hnilova, M.; Grosh, C.; Fong, H.; Baneyx, F.; Schwartz, D.; Sarikaya, M.; Tamerler, C.; Traxler, B. Engineered Escherichia Coli Silver-Binding Periplasmic Protein That Promotes Silver Tolerance. Appl. Environ. Microbiol. 2012, 78, 2289–2296. [Google Scholar] [CrossRef]
- Palafox-Hernandez, J.P.; Tang, Z.; Hughes, Z.E.; Li, Y.; Swihart, M.T.; Prasad, P.N.; Walsh, T.R.; Knecht, M.R. Comparative Study of Materials-Binding Peptide Interactions with Gold and Silver Surfaces and Nanostructures: A Thermodynamic Basis for Biological Selectivity of Inorganic Materials. Chem. Mater. 2014, 26, 4960–4969. [Google Scholar] [CrossRef]
- Wriggers, W.; Chakravarty, S.; Jennings, P.A. Control of Protein Functional Dynamics by Peptide Linkers. Pept. Sci. Orig. Res. Biomol. 2005, 80, 736–746. [Google Scholar] [CrossRef]
- Hnilova, M.; Khatayevich, D.; Carlson, A.; Oren, E.E.; Gresswell, C.; Zheng, S.; Ohuchi, F.; Sarikaya, M.; Tamerler, C. Single-Step Fabrication of Patterned Gold Film Array by an Engineered Multi-Functional Peptide. J. Colloid Interface Sci 2012, 365, 97–102. [Google Scholar] [CrossRef] [PubMed]
- Wisdom, C.; Vanoosten, S.K.; Boone, K.W.; Khvostenko, D.; Arnold, P.M.; Snead, M.L.; Tamerler, C. Controlling the Biomimetic Implant Interface: Modulating Antimicrobial Activity by Spacer Design. J. Mol. Eng. Mater. 2016, 4, 1640005. [Google Scholar] [CrossRef] [PubMed]
- Chen, X.; Zaro, J.L.; Shen, W.-C. Fusion Protein Linkers: Property, Design and Functionality. Adv. Drug Deliv. Rev. 2013, 65, 1357–1369. [Google Scholar] [CrossRef] [PubMed]
- Tan, S.F.; Chee, S.W.; Lin, G.H.; Mirsaidov, U. Direct Observation of Interactions between Nanoparticles and Nanoparticle Self-Assembly in Solution. Acc. Chem. Res. 2017, 50, 1303–1312. [Google Scholar] [CrossRef]
- Yazici, H.; Habib, G.; Boone, K.; Urgen, M.; Utku, F.S.; Tamerler, C. Self-Assembling Antimicrobial Peptides on Nanotubular Titanium Surfaces Coated with Calcium Phosphate for Local Therapy. Mater. Sci. Eng. C 2019, 94, 333–343. [Google Scholar] [CrossRef]
- Yucesoy, D.T. Peptide-Guided Dental Tissue Regeneration For Oral Care. Ph.D. Dissertation, University of Washington, Seattle, DC, USA, 2018. [Google Scholar]
- Legeros, R.Z.; Legeros, J.P. Calcium Phosphate Bioceramics: Past, Present and Future. In Key Engineering Materials; Trans Tech Publications Ltd.: Baech, Switzerland, 2003; Volume 240, pp. 3–10. [Google Scholar]
- Legeros, R.Z. Calcium Phosphate-Based Osteoinductive Materials. Chem. Rev. 2008, 108, 4742–4753. [Google Scholar] [CrossRef]
- Sheikh, Z.; Abdallah, M.-N.; Hanafi, A.A.; Misbahuddin, S.; Rashid, H.; Glogauer, M. Mechanisms of In Vivo Degradation and Resorption of Calcium Phosphate Based Biomaterials. Materials 2015, 8, 7913–7925. [Google Scholar] [CrossRef]
- Sulyanto, R.; Kang, M.; Srirangapatanam, S.; Berger, M.; Candamo, F.; Wang, Y.; Dickson, J.; Ng, M.; Ho, S. Biomineralization of Dental Tissues Treated with Silver Diamine Fluoride. J. Dent. Res. 2021, 100, 1099–1108. [Google Scholar] [CrossRef]
- Mei, M.; Nudelman, F.; Marzec, B.; Walker, J.; Lo, E.; Walls, A.; Chu, C. Formation of Fluorohydroxyapatite with Silver Diamine Fluoride. J. Dent. Res. 2017, 96, 1122–1128. [Google Scholar] [CrossRef]
- Roberts, A.; Bradley, J.; Merkley, S.; Pachal, T.; Gopal, J.; Sharma, D. Does Potassium Iodide Application Following Silver Diamine Fluoride Reduce Staining of Tooth? A Systematic Review. Aust. Dent. J. 2020, 65, 109–117. [Google Scholar] [CrossRef]
- Hamdy, D.; Giraki, M.; Abd Elaziz, A.; Badran, A.; Allam, G.; Ruettermann, S. Laboratory Evaluation of the Potential Masking of Color Changes Produced by Silver Diamine Fluoride in Primary Molars. BMC Oral Health 2021, 21, 337. [Google Scholar] [CrossRef] [PubMed]
- Fröhlich, T.T.; Gindri, L.D.O.; Pedrotti, D.; Cavalheiro, C.P.; Soares, F.Z.M.; Rocha, R.D.O. Evaluation of the Use of Potassium Iodide Application on Stained Demineralized Dentin under Resin Composite Following Silver Diamine Fluoride Application. Pediatr. Dent. 2021, 43, 57–61. [Google Scholar] [PubMed]
- Spencer, P.; Ye, Q.; Misra, A.; Goncalves, S.D.P.; Laurence, J. Proteins, Pathogens, and Failure at the Composite-Tooth Interface. J. Dent. Res. 2014, 93, 1243–1249. [Google Scholar] [CrossRef] [PubMed]
- Drummond, J.L. Degradation, Fatigue, and Failure of Resin Dental Composite Materials. J. Dent. Res. 2008, 87, 710–719. [Google Scholar] [CrossRef] [PubMed]
- Chisini, L.A.; Collares, K.; Cademartori, M.G.; De Oliveira, L.J.C.; Conde, M.C.M.; Demarco, F.F.; Correa, M.B. Restorations in Primary Teeth: A Systematic Review on Survival and Reasons for Failures. Int. J. Paediatr. Dent. 2018, 28, 123–139. [Google Scholar] [CrossRef]
- Elbahie, E.; Beitzel, D.; Mutluay, M.M.; Majd, H.; Yahyazadehfar, M.; Arola, D. Durability of Adhesive Bonds to Tooth Structure Involving the Dej. J. Mech. Behav. Biomed. Mater. 2018, 77, 557–565. [Google Scholar] [CrossRef]
- Spencer, P.; Ye, Q.; Song, L.; Parthasarathy, R.; Boone, K.; Misra, A.; Tamerler, C. Threats to Adhesive/Dentin Interfacial Integrity and Next Generation Bio-Enabled Multifunctional Adhesives. J. Biomed. Mater. Res. B Appl. Biomater. 2019, 107, 2673–2683. [Google Scholar] [CrossRef]
- Tripathi, P.; Mengi, R.; Gajare, S.M.; Nanda, S.S.; Wani, S.A.; Kochhar, A.S. Evaluation of Remineralizing Capacity of P11–4, Cpp-Acp, Silver Diamine Fluoride, and Novamin: An In Vitro Study. J. Contemp. Dent. Pract. 2021, 22, 357–360. [Google Scholar] [CrossRef]
Name | Sequence | Summed Backbone Change (%) |
---|---|---|
shADP5 | SYEKSHSQAINTDRT | N/A |
AgBP2 | EQLGVRKELRGV | N/A |
shADP5_EAAAK_AgBP2 | SYEKSHSQAINTDRTEAAAKEQLGVRKELRGV | 9.4 |
shADP5_AgBP2 (No Spacer) | SYEKSHSQAINTDRTEQLGVRKELRGV | 14 |
shADP5_APA_AgBP2 | SYEKSHSQAINTDRTAPAEQLGVRKELRGV | 17 |
shADP5_GGG_AgBP2 | SYEKSHSQAINTDRTGGGEQLGVRKELRGV | 18 |
shADP5_PAPAP_AgBP2 | SYEKSHSQAINTDRTPAPAPEQLGVRKELRGV | 23 |
shADP5_GSGGG_AgBP2 | SYEKSHSQAINTDRTGSGGGEQLGVRKELRGV | 25 |
Biomimetic Mineralization | ||||
---|---|---|---|---|
Untreated Control | SDF-Treated Control | SDF-Treated with No Peptide | SDF-Treated with Bifunctional Peptide | |
Enamel | 1.375 | 1.447 | 1.092 | 1.338 |
Dentin | 1.405 | 1.419 | 1.066 | 1.291 |
SDF-treated enamel | n/a | 1.540 | 1.100 | 1.257 |
SDF-treated dentin | n/a | 1.546 | 1.137 | 1.238 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Woolfolk, S.K.; Cloyd, A.K.; Ye, Q.; Boone, K.; Spencer, P.; Snead, M.L.; Tamerler, C. Peptide-Enabled Nanocomposites Offer Biomimetic Reconstruction of Silver Diamine Fluoride-Treated Dental Tissues. Polymers 2022, 14, 1368. https://doi.org/10.3390/polym14071368
Woolfolk SK, Cloyd AK, Ye Q, Boone K, Spencer P, Snead ML, Tamerler C. Peptide-Enabled Nanocomposites Offer Biomimetic Reconstruction of Silver Diamine Fluoride-Treated Dental Tissues. Polymers. 2022; 14(7):1368. https://doi.org/10.3390/polym14071368
Chicago/Turabian StyleWoolfolk, Sarah Kay, Aya Kirahm Cloyd, Qiang Ye, Kyle Boone, Paulette Spencer, Malcolm L. Snead, and Candan Tamerler. 2022. "Peptide-Enabled Nanocomposites Offer Biomimetic Reconstruction of Silver Diamine Fluoride-Treated Dental Tissues" Polymers 14, no. 7: 1368. https://doi.org/10.3390/polym14071368
APA StyleWoolfolk, S. K., Cloyd, A. K., Ye, Q., Boone, K., Spencer, P., Snead, M. L., & Tamerler, C. (2022). Peptide-Enabled Nanocomposites Offer Biomimetic Reconstruction of Silver Diamine Fluoride-Treated Dental Tissues. Polymers, 14(7), 1368. https://doi.org/10.3390/polym14071368