Next Article in Journal
Honey Bee and Bumble Bee Antiviral Defense
Next Article in Special Issue
Unprecedented Diversity of ssDNA Phages from the Family Microviridae Detected within the Gut of a Protochordate Model Organism (Ciona robusta)
Previous Article in Journal
Induction of Oxidative DNA Damage in Bovine Herpesvirus 1 Infected Bovine Kidney Cells (MDBK Cells) and Human Tumor Cells (A549 Cells and U2OS Cells)
Previous Article in Special Issue
Genomic Analysis of 48 Paenibacillus larvae Bacteriophages
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Pectobacterium atrosepticum Phage vB_PatP_CB5: A Member of the Proposed Genus ‘Phimunavirus

1
Department of Biological Sciences, Cork Institute of Technology, T12 P928 Cork, Ireland
2
Department of Microbiology and Biotechnology, Max Rubner-Institut, 24103 Kiel, Germany
3
Department of Applied Sciences, University of the West of England, Bristol, Frenchay Campus, Coldharbour Lane, Bristol BS16 1QY, UK
4
Laboratory of Gene Technology, KU Leuven, 3001 Leuven, Belgium
5
APC Microbiome Institute, University College, T12 YT20 Cork, Ireland
*
Author to whom correspondence should be addressed.
Viruses 2018, 10(8), 394; https://doi.org/10.3390/v10080394
Submission received: 25 May 2018 / Revised: 23 July 2018 / Accepted: 24 July 2018 / Published: 26 July 2018
(This article belongs to the Special Issue Bacteriophage Genomes and Genomics: News from the Wild)

Abstract

Pectobacterium atrosepticum is a phytopathogen of economic importance as it is the causative agent of potato blackleg and soft rot. Here we describe the Pectobacterium phage vB_PatP_CB5 (abbreviated as CB5), which specifically infects the bacterium. The bacteriophage is characterized in detail and TEM micrographs indicate that it belongs to the Podoviridae family. CB5 shares significant pairwise nucleotide identity (≥80%) with P. atrosepticum phages φM1, Peat1, and PP90 and also shares common genome organization. Phylograms constructed using conserved proteins and whole-genome comparison-based amino acid sequences show that these phages form a distinct clade within the Autographivirinae. They also possess conserved RNA polymerase recognition and specificity loop sequences. Their lysis cassette resembles that of KP34virus, containing in sequential order a U-spanin, a holin, and a signal–arrest–release (SAR) endolysin. However, they share low pairwise nucleotide identity with the type phage of the KP34virus genus, Klebsiella phage KP34. In addition, phage KP34 does not possess several conserved proteins associated with these P. atrosepticum phages. As such, we propose the allocation of phages CB5, Peat1, φM1, and PP90 to a separate new genus designated Phimunavirus.

1. Introduction

In the post-genomic era, the number of bacteriophage (phage) genomes being deposited into public databases such as the NCBI GenBank has substantially increased, due in part to the ever-decreasing cost of DNA sequencing. This growing quantity of genomic data has led to increasing insights into the evolutionary relationships between phages. Originally, taxonomic phage classification was based on morphology, nucleic acid composition, and physico-chemical characteristics [1]. More recently, classification has developed to the point where nucleotide and protein homology can be usefully employed to tease out phylogenetic relationships. This has led to the creation of subfamilies within Myoviridae, Siphoviridae, and Podoviridae, such as the subfamily Autographivirinae. This subfamily encompasses what was previously known as the T7 supergroup [2]. Key defining features of the subfamily Autographivirinae include the presence of a single RNA polymerase (RNAP) gene and a typical genomic organization with genes positioned on the Watson strand [3]. To date, this subfamily encompasses seven genera: the T7virus, SP6virus, Phikmvvirus, Fri1virus, KP32virus, Pradovirus, and KP34virus [2,4].
The bacterial genera Pectobacterium and Dickeya, often referred to collectively as the soft rot Enterobacteriaceae, are phytopathogens that cause economically important losses in a wide range of arable crops, thus potentially impacting food biosecurity. They are Gram-negative, facultative anaerobic rod-shaped cells that are typified by the production of extracellular pectinolytic enzymes during the infection of plants [5,6]. Within the last two years, a limited number of Pectobacterium and Dickeya phages have been reported whose genome sequences have been described to resemble phages of KP34virus and Phikmvvirus. The first of these to have their genome described was Pectobacterium atrosepticum phage Peat1 (accession no. KR604693) by Kalischuk et al. [7]. Phage φM1 (accession no. JX290549) was subsequently described by Blower et al. [8], after isolation and characterization by Toth et al. [9]. Related phages have also been described for Pectobacterium carotovorum subsp. carotovorum (namely phage PPWS1, accession no. LC063634.2) and Dickeya (phage BF25/12, accession no. KT240186.1) [10,11]. In addition, a P. atrosepticum phage, PP90 (accession no. KX278419.1), has been deposited to the public databases, as well as P. carotovorum subsp. carotovorum phage PP16 (accession no. KX278418). The latter two display high level of amino acid sequence similarity and possess a similar genomic organization of genes to phages of KP34virus.
In this study, we describe the newly isolated P. atrosepticum phage vB_PatP_CB5 (abbreviated as CB5). Phylogenetic analysis of its genome shows a close evolutionary relationship with P. atrosepticum phages φM1, Peat1, and PP90 (termed the PhiM1-like phages from here onwards in this article). Based on these findings, we propose the formation of the bacteriophage genus ‘Phimunavirus’ to formally classify these phages, with the Pectobacterium phage φM1 designated as the type phage.

2. Materials and Methods

2.1. Bacterial and Phage Propagation Conditions

To cultivate bacterial strains and phage, Lysogeny broth (LB), LB agar (1.5% w/v agar), and LB overlays (0.4% w/v agar) were employed. All cultures were grown at 25 °C. Phage CB5 was propagated using P. atrosepticum strain DSM 30186 using the methods described previously [12].

2.2. Phage Isolation

Phage CB5 was isolated using an enrichment method, as previously described [13]. Briefly, five grams of soil were weighed out and placed into 30 mL of LB broth along with 300 µL of overnight culture of P. atrosepticum. This sample was incubated for 18 h at 25 °C followed by centrifugation to remove particulate matter, after which the supernatant was filter-sterilized (0.45-µm pore-size filter, Sarstedt, Nümbrecht, Germany). The supernatant was spotted (10 µL) on top of the overlay, which had been seeded with an overnight culture of P. atrosepticum. The phage was isolated by picking off an individual plaque and then re-plating and re-isolating to generate a pure culture of the phage [14].

2.3. Host Range and General Characterization

The host range of the phage was tested by spotting serial dilutions (neat to dilution 10−9) of a phage suspension onto LB overlays seeded with the appropriate bacterial host, as described previously [15]. Bacteria strains used in host study are listed in Supplementary Information 1, Table S1. A number of the Pectobacterium strains utilized in this study have previously been described by Buttimer et al. [13].
A similar approach to the one step growth curve assay described previously was used [16,17]. The host bacteria (strain DSM 30186) were grown to an OD600 of 0.20–0.23 (ca. 1 × 108 colony forming units (CFU)/mL), followed by centrifugation of 2 mL in a microfuge to pellet bacteria. The pellet was resuspended in 1 mL of phage suspension to yield an approximate multiplicity of infection (MOI) of 5 × 10−4 following incubation at 25 °C for 1 min. This was then centrifuged to pellet bacteria, and the supernatant was removed, thus separating bound from unbound phages. The bacterial pellet with bound phage was then resuspended in 10 mL of LB and incubated aerobically in a water bath at 25 °C with agitation at 60 rpm. At 5-min intervals, aliquots were removed to measure phage titer by the overlay method. Based on the number of PFU/mL of each replicate, the latent period and the burst size were determined by dividing the average PFU/mL of the latent period by the average PFU/mL of the last four time points of the experiment.

2.4. Transmission Electron Microscopy

Prior to electron microscopic analysis, phages were purified by CsCl density gradient centrifugation as previously described [13]. Phages adsorbed to freshly prepared ultra-thin carbon film were: (1) treated with 1% (v/v) EM-grade glutaraldehyde (20 min) for fixation; (2) negatively stained with 1% (w/v) uranyl acetate; and (3) subsequently analyzed using a Tecnai 10 transmission electron microscope (FEI Thermo Fisher, Eindhoven, The Netherlands) at an acceleration voltage of 80 kV. Digital micrographs were acquired with a MegaView G2 CCD camera (EMSIS, Muenster, Germany).

2.5. DNA Isolation and Sequencing

DNA extraction was performed as previously described [18]. Briefly, free nucleic acids were removed from phage lysates (ca. 1 × 1010 PFU/mL) with DNase and RNase, treated with 10% SDS and proteinase K followed by DNA extraction with phenol:chloroform:isoamyl alcohol (25:24:1 v/v) and chloroform:isoamyl alcohol (24:1 v/v). Prior to sequencing, DNA quality and quantity were assessed by using both a Nanodrop (ND-1000, Thermo Fisher, Waltham, MA, USA) and by visualization after agarose gel electrophoresis. DNA sequencing was outsourced to GATC Biotech (Konstanz, Germany). To conduct sequencing, DNA libraries were first created by DNA fragmentation, adapter ligation followed by a size selection and amplification. DNA libraries were then measured and quantified on a fragment analyzer before sequencing with 2 × 300 bp paired-end reads using the Illumina Hiseq system (Illumina, San Diego, CA, USA). The de novo assembly was performed using default parameters with CLC Genomics Workbench v8.0 (Qiagen, Aarhus, Denmark).

2.6. Bioinformatic Analysis

Open reading frames (ORFs) of CB5 were predicted with GLIMMER [19] and GenmarkS [20]. Functional inferences for predicted ORF gene products were obtained by searches conducted using BLASTP (http://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE=Proteins), Pfam (http://pfam.xfam.org/search#tabview=tab1; [21]), InterProScan (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3998142/; [22]) and HHpred (https://toolkit.tuebingen.mpg.de/#/tools/hhpred; [23]). Transmembrane domains and lipoprotein cleavage signal were identified using TMHMM v.2 (http://www.cbs.dtu.dk/services/TMHMM/; [24]) and LipoP v.1 (http://www.cbs.dtu.dk/services/LipoP/; [25]), respectively. The molecular weight of the predicted ORFs was estimated using the batch protein molecular weight determination of the sequence manipulation suite (http://www.bioinformatics.org/sms2/protein_mw.html). The presence of transfer RNA genes was investigated with the use of tRNAscan-SE (http://lowelab.ucsc.edu/tRNAscan-SE/; [26]) and ARAGORN (http://130.235.46.10/ARAGORN/; [27]).

2.7. Comparative Genomics

To determine shared proteins among phage proteomes, CoreGenes 3.5 (http://binf.gmu.edu:8080/CoreGenes3.5/; [28]) was used. Translated ORFs from phage φM1 were searched against hidden Markov model profiles downloaded from the prokaryotic Virus Orthologous Groups (pVOGs) database (PMID: 27789703, [29]) using hmmscan (PMID: 22039361, [30]) with an E-value cutoff of 1 × 10−3. Matches to pVOG profiles were considered significant at an E-value of ≤1 × 10−15 and ≥35% coverage of the profile HMM. The linear genomic comparison maps were created with the use of either BLASTN or TBLASTX, to determine similarity, and then visualized with Easyfig [31]. Phylograms were generated based on the amino acid sequences of the major capsid protein of phage CB5 and 52 members of Autographivirinae (Supplementary Information 1, Table S2) using MEGA7 [32], applying MUSCLE for sequence alignment [33] with the construction of phylograms using the maximum likelihood (ML) method based on the Whelan and Goldman substitution model [34], with the robustness of the trees assessed by bootstrapping (1000). VICTOR was employed using all pairwise comparisons of the amino acid sequences (same phages as described previously) which employs the Genome-BLAST Distance Phylogeny (GBDP) method [35] under settings recommended for prokaryotic viruses [36]. The resulting intergenomic distances (including 100 replicates each) were used to infer a balanced minimum evolution tree with branch support via FASTME, including SPR postprocessing [37] for each of the formulas D0, D4, and D6, respectively. The trees were rooted at the midpoint [38] and visualized with FigTree [39]. Taxon boundaries at the species, genus, subfamily, and family level were estimated with the OPTSIL program [40], recommended clustering thresholds [36], and an F value (fraction of links required for cluster fusion) of 0.5 [41]. The heat map comparing the genomes of phage CB5 and 31 phages of Autographivirinae was generated using Gegenees utilizing TBLASTX, with accurate parameters (fragment length: 200 bp; step size: 100 bp, threshold set to 5%) [42]. Alignment of the RNAP proteins for the examination of catalytic active residues and residues of the recognition and specificity loop was conducted using MUSCLE on MEGA7.

2.8. Accession Number

The genome sequence of phage CB5 was submitted to GenBank under accession number KY953156.

3. Results

3.1. Isolation, Host Range, Growth Characteristics and Morphology

Phage CB5 was isolated from soil samples collected from potato grading machinery on a farm in Co. Cork, Ireland, during the year 2013, as mentioned previously [13]. Host range was determined on 31 bacterial strains from five different species belonging to soft rot Enterobacteriaceae, namely P. atrosepticum (19 strains), P. carotovorum subsp. carotovorum (four strains), Dickeya chrysanthemi bv. chrysanthemi (one strain), Dickeya dianthicola (three strains), and Dickeya solani (four strains). The phage possesses a narrow host range, in that it is only capable of forming plaques on the phage’s host strain (DSM 30186) and two other strains of P. atrosepticum (Table 1). Additionally, spot tests showed that the phage had an inhibitory effect on 15 of the other 16 strains of P. atrosepticum tested with the observation of zones of clearing at high phage titers despite the absence of distinct plaques. No plaque formation or inhibition was detected for any other bacterial species tested. A similar narrow host range has also been reported for PhiM1-like Pectobacterium phage φM1, with a infectivity range confined to a small number of P. atrosepticum strains [9]. This limited host range has also been observed among phages of KP34virus and Phikmvvirus [43,44]. On the propagating host strain DSM 30186, CB5 was found to produce clear plaques with an approximate diameter of 3 mm (Supplementary Information 1, Figure S1). One-step-growth curve assay, under standard conditions using LB medium, demonstrated that phage CB5 possessed a latent period of 45 min with an approximate burst size of 44 ± 8 PFU/cell (Figure 1).
Examination of the morphology of the phage by transmission electron microscopy (Figure 2) shows it can be classified as a member of the Podoviridae family. It features a C1 morphotype [45] with an icosahedral head (63.1 ± 3.6 nm in diameter, n = 25) with clearly distinguishable hexagonal outlines and a short non-contractile tail (13.1 ± 1.8 nm, n = 11), and short appendices (length: ca. 10.1 ± 1.7 nm, n = 10) visible at the head/tail connection site. These head and tail dimensions are consistent with previously reported phages of KP34virus and Phikmvvirus [44,46]. The phage was formally named in accordance with the nomenclature set out by Kropinski et al. [47].

3.2. General Genome Information of CB5

The genome sequence size obtained for phage CB5 is 44,262 bp (coverage >1000×) and examination of sequence reads indicated the presence of direct terminal repeats (DTRs) with an estimated size of 287 bp. This estimation is based on the identification of a localized region with more than double the read depth compared to average read depth across the whole genome (Supplementary Information 1, Figure S2). This approach to detect DTRs has also been applied to a number of other phages [48,49,50]. Additionally, the average G + C% content of its genome was found to be 49%. This is close to the range that is typically expected for its host bacterium, P. atrosepticum, at 50–51% [51,52].
The genome of CB5 was predicted to contain 60 ORFs. These, apart from one, were found to read in the 5’ to 3’ direction, with GC skew correlating well with transcription [53]. Based on analysis using a combination of BLASTP, InterProScan, and HHpred, putative functions to 33 of the 60 predicted ORFs (55%) were assigned. These gene products can be categorized into DNA replication, virion structure, and host lysis functions (Supplementary Information 2, Table S3). Of the assigned ORFs, five are predicted to encode homing endonucleases of the HNH family (CB5_17, 23, 29, 41, 48) (IPR003615). No integrase, excisionase, nor repressor genes were detected, suggesting the phage has an exclusively lytic lifecycle. Furthermore, no tRNA genes were identified.

3.3. Comparative Genomics of PhiM1-Like Phages

The four phages within the proposed genus ‘Phimunavirus’ possess genomes of similar size that share a high degree of sequence similarity and share a large number of conserved proteins (Table 2). Genome sizes (excluding DTRs) range from 43,534 bp (φM1) to 45,633 bp (Peat1), with nucleotide pairwise identity between the four phages ranging from 82% to 86% (BLASTN). Total ORF numbers range from 52 (φM1) to 61 (Peat1), with CoreGenes analysis showing that they collectively share a minimum of 39 proteins, including 32 which were affiliated to a known pVOG (Table 3). These coding sequences are spread across the entire genome and are not associated/limited to particular genomic modules. Of the four phages, only φM1 possesses a tRNA gene (for isoleucine). G + C content among the four phages is highly similar, ranging from 48.7% to 49.2%. Additionally, these phages show limited similarity to Klebsiella phage KP34 (7% to 9% identity). Indeed, CoreGenes shows that phage KP34 shares 29 proteins with the PhiM1-like phages (Table 3). The major variations of conserved proteins of phage KP34 with these phages are five hypothetical proteins located in the DNA replication and nucleotide metabolism region. Also, additional hypothetical proteins were identified immediately downstream of the genes encoding the RNAP and large terminase proteins, as well as the ORFs for their predicted holin and tail spike.
The gene order is highly conserved among the PhiM1-like phages (Figure 3). Their genome architecture is arranged so that the predicted early and middle gene regions end with a RNAP gene (CB5_39), with ORFs within these regions involved in DNA replication and nucleotide metabolism, but also expected to be involved in host takeover. The position of ORFs for RNAP in the PhiM1-like phages is shared with phages of the genera KP34virus, Fri1virus, phiKMVvirus and Pradovirus, but not with those of the genera T7virus, SP6virus, and KP32virus where the RNAP is situated at the early gene region (Figure 4). The late gene region of the PhiM1-like phages is associated with virion morphogenesis and host lysis roles. Gene order between PhiM1-like phages and KP34-like phages is highly conserved apart from the position of an ORF encoding a conserved protein (CB5_36, PhiM1_27, AXI77_gp27, PP90_28) possessing a calcineurin-like phosphoesterase domain (IPR004843) (Figure 4).

3.4. Phimunavirus Evolutionary Position within the Autographivirinae

To determine the PhiM1-like phages’ evolutionary relationship to other phages within the Autographivirinae, a phylogenetic analysis was conducted using the amino acid sequence of the major capsid protein (Figure 5). The resulting phylogram showed that the PhiM1-like phages form their own clade on a branch containing an additional clade representing the P. carotovorum subsp. carotovorum phages PP16 and PPSW1 and Dickeya phage BF25/12. The branch that these phages form was found to be positioned close to phages of the KP34virus genus along with sister groups consisting of Vibrio phage VP93 and the Pantoea phage LIMElight, which have previously been described to possess a close evolutionary relationship to the KP34virus members [44]. This analysis was performed with the head–tail connector protein, a large terminase subunit, and tail tubular proteins A and B. These analyses produced tree exhibiting similar relationships, albeit with weaker bootstrap support values (Supplementary Information 1, Figure S3). Whole-genome comparison based on amino acid sequences was performed using VICTOR and the resulting phylogram (formula D4, yielding average support of 71%) presented a similar conclusion as that based on major head protein sequence (Figure 6). Additionally, analysis using VICTOR could cluster these 53 phage genomes into 13 genera and four subfamilies, with PhiM1-like phages being placed in their own genera with P. carotovorum subsp. carotovorum phages PP16 and PPSW1 and Dickeya phage BF25/12 (Supplementary Information 1, Table S4). Further analysis using Gegenees (TBLASTX), based on protein similarity, indicate the PhiM1-like phages form a clade with high identity values of ≥80%. Additionally, as seen in the phylograms, it was observed that P. carotovorum subsp. carotovorum phages PP16 and PPSW1 and Dickeya phage BF25/12 share an evolutionary relationship with PhiM1-like phages (identity values ≥54%) (Figure 7).

3.5. RNAP of the PhiM1-Like Phages

The RNAP protein has been used as a feature to establish genera within the subfamily of Autographivirinae. Within the amino acid sequence of the RNAP of phage T7, the key catalytic residues Asp537, Lys631, Tyr639 and Asp812 and the regions of functional importance, namely the recognition loop (93–101 aa) and the specificity loop (739–770 aa) are generally well conserved among different clades within Autographivirinae [43,44]. Analysis of PhiM1-like phages shows that they all have the catalytic residues Asp537, Lys631 and Asp812. Comparisons of the recognition loop and specificity loop of these phages show that they are vastly different to φKMV, with the recognition loop of KP34 and Fri1 possessing a small resemblance to that of these phages (Table 4). Furthermore, sequence variation is evident between the PhiM1-like phages and the closely related P. carotovorum subsp. carotovorum phages PP16 and PPSW1 and Dickeya phage BF25/12.

3.6. Early Gene Region

Early region ORFs are those that are expected to be transcribed immediately upon internalization of phage DNA within the host. In silico analysis of ORFs for hypothetical proteins within this region is typically limited (in the context of determining their functions) for the majority of phages due to their vast diversity. However, it can be expected that these ORFs are involved in the redirection of host proteins to a role in the phage infection cycle through stimulation or inhibition of protein–protein interactions [54]. Here, we define the early genes among the PhiM1-like phages as those positioned before the DNA primase ORF (Figure 3). Six ORFs were found to be conserved within this region using CoreGenes (Supplementary Information 1, Table S5). Of these six ORFs, only one could be assigned the putative function of a peptidase (IPR007484).

3.7. DNA Replication, Repair, and Related Metabolism

PhiM1-like phages encode ORFs for proteins involved in the replication and repair of DNA (Supplementary Information 1, Table S6), including a primase, helicase, DNA polymerase, endonuclease VII and a putative 5′ exonuclease. The order of these ORFs is conserved among the genomes of these phages with variation existing in the context of the presence of ORFs for hypothetical proteins and homing endonucleases among the primase, helicase, DNA polymerase and endonuclease VII. Additional variations identified were that CB5 possesses an ORF encoding a putative nucleatidyl transferase, which is absent among other PhiM1-like phages, and that CB5 and Peat1 lack an ORF encoding a putative polynucleotide 5′-kinase/3′-phosphatase that is shared between PP90 and φM1.

3.8. Structure-Related Genes

Discussion of these genes also includes those specifying large and small terminase (maturase) proteins which play a role in the packaging of DNA into the phage capsid. A total of 12 ORFs predicted to be involved in virion morphogenesis are shared among the PhiM1-like phages (Supplementary Information 1, Table S7). These include a head–tail connector protein, a virion scaffolding protein, major capsid protein, tail tubular proteins A and B, internal virion proteins A, B and C, a tail fiber, and a tail spike. The order in which the ORFs for these proteins occur in the genomes of these phages is highly conserved. Minor differences within this synthetic region were due to the presence of homing endonucleases among the ORFs or in some cases splitting ORFs, for example the head–tail connector protein of PP90 (PP90_39, 40). Additionally, it was noted that some structural proteins were encoded by split ORFs without the presence of homing endonucleases, as seen for the major capsid protein (AX177_gp38, 39), tubular protein A (AX177_gp41, 42) and internal virion protein C of Peat1 (AX177_gp46, 47).
The predicted tail spike protein of these phages possesses the P22 tailspike domain (IPR015331). The P22 tailspike is characterized by the right-handed beta helix architecture first observed for pectate lysase [55]. This protein is capable of breaking down saccharides upon binding to host cell surface [56], which may be the case also for the PhiM1-like tail spike. The internal virion protein B of these phages may also possess enzymatic activity, with HHpred analysis indicating homology to phage proteins with lysozyme activity (best hit against PhiM1_42; Escherichia phage P1 endolysin Lyz, PDB accession no. 1XJU_A). This suggests that this protein may play a role in the breakdown of cell wall peptidoglycan during injection of phage genomic DNA into its host cell, like Gp16 of phage T7 [57].

3.9. Lysis Cassette of PhiM1-Like Phages Resembles That of KP34virus

The PhiM1-like phages possess three proteins predicted to cause host lysis. These are arranged in a conserved order: a spanin, a holin and an endolysin (Supplementary Information 1, Table S8). The endolysins of these phages are predicted to possess a N-terminal transmembrane domain with lysozyme domain (IPR023347), indicating a likely function as a signal–arrest–release (SAR) endolysin, similar to that described for Pseudomonas phage φKMV [58]. SAR endolysins use the host sec translocon system to enable their transport to the cell’s inner membrane. The most likely holin of these phages is the pin-hole holin variety. These can provide narrow channels for ion movement causing membrane depolarization and activation of the SAR endolysin resulting in the degradation of cell wall peptidoglycan [58,59]. Spanins are proteins responsible for the destruction of the outer membrane of Gram-negative hosts allowing phage progeny release. The predicted spanin of these phages is comprised of a single protein with an N-terminal outer-membrane lipoprotein signal and a C-terminal transmembrane domain, classifying them of the u-spanin variety [60]. The lysis cassette configuration of the PhiM1-like phages resembles that of Klebsiella phage KP34, sharing the same gene variations with the type phage φKMV of Phikmvvirus. The spanin of φKMV is composed of a two protein component system, an i-spanin integral cytoplasmic membrane protein (Rz), and an o-spanin outer membrane lipoprotein (Rz1) [60,61]. Variation also exists with the order of occurrence of the genes for these proteins (holin, SAR endolysin, Rz, and Rz1) in the lysis cassette of φKMV in comparison to the PhiM1-like phages and phage KP34 (Figure 8).

4. Discussion

In silico analysis shows that the Pectobacterium phage CB5 belongs to a distinct group of phages (φM1, Peat1 and PP90) that infect P. atrosepticum and that can be classified as members of the subfamily Autographivirinae. In this article, we propose the creation of the genus ‘Phimunavirus’ to encompass these phages, the genus name is derived from the allocated type phage φM1, the first representative of these phages to be described. This proposal is supported due to these phages sharing a high DNA pairwise identity of ≥80% (BLASTN), with a highly conserved gene order (Figure 3) and a shared protein content of ≥60% (CoreGenes). They also form a distinct clade when compared to other phages of Autographivirinae on phylograms based on their major capsid protein sequences (Figure 5) and whole-genome comparison based on amino acid sequences employing VICTOR (Figure 6). Furthermore, Gegenees analysis (TBLASTX) based on amino acid sequences also indicates the existence of this clade (Figure 7). Additionally, the recognition and specificity loop of the RNAP between these phages is highly conserved (Table 4). These phages share a number of characteristics with members of the KP34virus genus. Such as a similar arrangement of genes (Figure 4) like that of the lysis cassette, arranged sequentially in the order of a u-spanin, holin and SAR endolysin (Figure 8). However, DNA pairwise identity of these phages with the type phage, Klebsiella phage KP34, is low at 7–9%. In addition, CoreGenes analysis showed that the PhiM1-like phages also possess a number of conserved proteins not shared with KP34 (39 vs. 29 proteins, respectively) (Table 3). Furthermore, the amino acid sequence of the recognition and specificity loop of the RNAP of KP34 differs to that of PhiM1-like phages (Table 4). Interestingly, phylograms of the conserved proteins (Figure 5 and Supplementary Information 1, Figure S3) and whole-genome comparison based on the amino acid sequence (Figure 6) show a more closely placed evolutionary relationship of Vibrio phage V93 and Pantoea phage LIMElight with the KP34virus genus than with the PhiM1-like phages. Features that exclude these phages from being incorporated into KP34virus genus were that phage V93 possesses a distinct lysis cassette and encodes two tail proteins, while phage LIMElight encodes a tail fiber protein with greater similarity to phages of SP6virus than to that of KP34 [44].
It is clear that P. carotovorum subsp. carotovorum phages PP16 and PPSW1 and Dickeya phage BF25/12 share a close evolutionary relationship with PhiM1-like phages, sharing DNA pairwise identity of between 47% and 55%. They also form a clade that sits on the same branch as that of PhiM1-like phages on phylograms comparing the major capsid protein and whole-genome comparison based on amino acid sequences of phages of Autographivirinae (Figure 5 and Figure 6). Furthermore, Gegenees analysis (TBLASTX) shows a shared identity of between 54% and 60% (Figure 7). However, the relationship is more distant than that between phages of the suggested ‘Phimunavirus’ genus. Thus, casting doubt on whether they should be placed in the genus, we have chosen to exclude phages PP16, PPSW1, and BF25/12 from the genus at this point in time until the availability of more data on related phages.
Not all Pectobacterium phages reported to date that have been classified as belonging to Autographivirinae resemble Pectobacterium phage φM1. For example, Pectobacterium carotovorum subsp. carotovorum phage PP2 possesses homology to Cronobacter phage vB_CsaP_Gap277, a phage that has been identified to represent a distinct genus within Autographivirinae [62,63].
Finally, it has been commented that the split of the Phikmvvirus genus into genera better reflecting evolutionary relationships is to date incomplete [64]. This concern was highlighted in phylograms constructed in this study with the observation that the phage LIMElight, which is currently classified as a member of the Phikmvvirus, is in fact placed between the genera Fri1virus and KP34virus (Figure 5 and Figure 6). Since the creation of the Autographivirinae subfamily, many more phages related to it have been sequenced. It is clear from the phylograms constructed in this study that a taxonomic reassessment of these phages is required to adequately reflect their genomic diversity.

Supplementary Materials

The following are available online at https://www.mdpi.com/1999-4915/10/8/394/s1, Supplementary Information 1, Table S1: Bacteria strains used in the isolation and the testing of host range of Pectobacterium phages CB5, Supplementary Information 1, Table S2: Details of proteins used in the phylogenetic analysis of 52 phages from the subfamily Autographivirinae and Pectobacterium phage CB5, Supplementary Information 2, Table S3: Annotation of Pectobacterium phage CB5, Supplementary Information 1, Table S4: Taxonomy output from VICTOR analysis of 52 phages from the subfamily Autographivirinae and Pectobacterium phage CB5, Supplementary Information 1, Table S5: Shared early region ORFs between PhiM1-like phages as determined by CoreGenes, Supplementary Information 1, Table S6: Proteins of PhiM1-like phage involved in DNA replication, repair and related metabolism, Supplementary Information 1, Table S7: Structural proteins of the PhiM1-like phages, Supplementary Information 1, Table S8: Proteins of lysis cassette of the PhiM1-like phages, Supplementary Information 1, Figure S1: Pectobacterium phage CB5 plaque morphology on 0.4% w/v LB overlay, Supplementary Information 1, Figure S2: Graphic showing the distribution of reads when mapped back to the contig representing the genome of Pectobacterium phage CB5 obtained from genome assembly, Supplementary Information 1, Figure S3: Phylogenetic analyses of amino sequences of the head–tail connecting protein, terminase, tail tube protein A, and tail tube protein B of Pectobacterium phage CB5 and 52 members of the Autographivirinae subfamily.

Author Contributions

Study conception and design: C.B., A.C.; Acquisition of data: C.B., A.L., H.N., C.M.A.P.F., D.T., R.L., A.C.; Drafting of manuscript: C.B., H.N., D.T., J.O., A.C.

Funding

This work was supported by Science Foundation Ireland Project Ref:12/R1/2335, R.L. is supported by the GOA grant “Phage Biosystems” from KU LEUVEN.

Acknowledgments

We would like to thank Andrew Kropinski for his assistance with phage taxonomy queries. We would also like to thank the West Cork farmers who provided soil samples for the study.

Conflicts of interest

The authors declare no conflict of interest.

Disclaimer

This paper is dedicated to the memory of Alan Lucid who passed away on 31 August 2017 during the preparation of the manuscript.

References

  1. Calendar, R. The Bacteriophages; Oxford University Press: Oxford, UK, 2006; ISBN 0195148509. [Google Scholar]
  2. Lavigne, R.; Seto, D.; Mahadevan, P.; Ackermann, H.-W.; Kropinski, A.M. Unifying classical and molecular taxonomic classification: Analysis of the Podoviridae using BLASTP-based tools. Res. Microbiol. 2008, 159, 406–414. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  3. King, A.M.Q.; Adams, M.J.; Carstens, E.B.; Lefknowitz, E.J. (Eds.) Virus Taxonomy: Ninth Report of the International Committee on Taxonomy of Viruses; Elsevier: New York, NY, USA, 2012; ISBN 9780123846846. [Google Scholar]
  4. Adriaenssens, E.M.; Clokie, M.R.; Sullivan, M.B.; Gillis, A.; Kuhn, J.H.; Kropinski, A.M. Taxonomy of prokaryotic viruses: 2016 update from the ICTV bacterial and archaeal viruses subcommittee. Arch. Virol. 2017, 162, 1153–1157. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  5. Toth, I.K.; van der Wolf, J.M.; Saddler, G.; Lojkowska, E.; Hélias, V.; Pirhonen, M.; Tsror Lahkim, L.; Elphinstone, J.G. Dickeya species: An emerging problem for potato production in Europe. Plant Pathol. 2011, 60, 385–399. [Google Scholar] [CrossRef] [Scilit]
  6. Pérombelon, M.C.M. Potato diseases caused by soft rot erwinias: An overview of pathogenesis. Plant Pathol. 2002, 51, 1–12. [Google Scholar] [CrossRef] [Scilit]
  7. Kalischuk, M.; Hachey, J.; Kawchuk, L. Complete genome sequence of phytopathogenic Pectobacterium atrosepticum bacteriophage Peat1. Genome Announc. 2015, 3. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  8. Blower, T.R.; Chai, R.; Przybilski, R.; Chindhy, S.; Fang, X.; Kidman, S.E.; Tan, H.; Luisi, B.F.; Fineran, P.C.; Salmond, G.P.C. Evolution of Pectobacterium bacteriophage ΦM1 to escape two bifunctional type III toxin-antitoxin and abortive infection systems through mutations in a single viral gene. Appl. Environ. Microbiol. 2017, 83. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  9. Toth, I.K.; Mulholland, V.; Cooper, V.; Bentley, S.; Shih, Y.; Perombelon, M.C.M.; Salmond, G.P.C. Generalized transduction in the potato blackleg pathogen Ewinia carotovora subsp. atroseptica by bacteriophage φM1. Microbiology 1997, 143, 2433–2438. [Google Scholar]
  10. Alič, Š.; Naglič, T.; Tušek-Žnidarič, M.; Ravnikar, M.; Rački, N.; Peterka, M.; Dreo, T. Newly isolated bacteriophages from the Podoviridae, Siphoviridae, and Myoviridae families have variable effects on putative novel Dickeya spp. Front. Microbiol. 2017, 8, 1870. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  11. Hirata, H.; Kashihara, M.; Horiike, T.; Suzuki, T.; Dohra, H.; Netsu, O.; Tsuyumu, S. Genome sequence of Pectobacterium carotovorum phage PPWS1, isolated from Japanese horseradish [Eutrema japonicum (Miq.) Koidz] showing soft-rot symptoms. Genome Announc. 2016, 4. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  12. Sambrook, J.; Russell, D.W. Preparing stocks of bacteriophage Lamda by plate lysis and elution. In Molecular Cloning: A Laboratory Manual; Cold Spring Harbor Laboratory Press: New York, NY, USA, 2001; Volume 1, p. 2.34. ISBN 0879695773. [Google Scholar]
  13. Buttimer, C.; Hendrix, H.; Lucid, A.; Neve, H.; Noben, J.-P.; Franz, C.; O’Mahony, J.; Lavigne, R.; Coffey, A. Novel N4-Like bacteriophages of Pectobacterium atrosepticum. Pharmaceuticals 2018, 11, 45. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  14. Sambrook, J.; Russell, D.W. Picking bacteriophage Lambda plaques. In Molecular Cloning: A Laboratory Manual; Cold Spring Harbor Laboratory Press: New York, NY, USA, 2001; Volume 1, p. 2.32. ISBN 0879695773. [Google Scholar]
  15. Sambrook, J.; Russell, D.W. Plating bacteriophage Lambda. In Molecular Cloning: A Laboratory Manual, 3rd ed.; Cold Spring Harbor Laboratory Press: New York, NY, USA, 2001; Volume 1, p. 2.25. ISBN 0879698773. [Google Scholar]
  16. Park, M.; Lee, J.-H.; Shin, H.; Kim, M.; Choi, J.; Kang, D.-H.; Heu, S.; Ryu, S. Characterization and comparative genomic analysis of a novel bacteriophage, SFP10, simultaneously inhibiting both Salmonella enterica and Escherichia coli O157:H7. Appl. Environ. Microbiol. 2012, 78, 58–69. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  17. Yang, H.; Liang, L.; Lin, S.; Jia, S. Isolation and characterization of a virulent bacteriophage AB1 of Acinetobacter baumannii. BMC Microbiol. 2010, 10, 131. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  18. Pickard, D.J.J. Preparation of bacteriophage lysates and pure DNA. Methods Mol. Biol. 2009, 502, 3–9. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  19. Delcher, A.L.; Harmon, D.; Kasif, S.; White, O.; Salzberg, S.L. Improved microbial gene identification with GLIMMER. Nucleic Acids Res. 1999, 27, 4636–4641. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  20. Besemer, J.; Lomsadze, A.; Borodovsky, M. GeneMarkS: A self-training method for prediction of gene starts in microbial genomes. Implications for finding sequence motifs in regulatory regions. Nucleic Acids Res. 2001, 29, 2607–2618. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  21. Finn, R.D.; Coggill, P.; Eberhardt, R.Y.; Eddy, S.R.; Mistry, J.; Mitchell, A.L.; Potter, S.C.; Punta, M.; Qureshi, M.; Sangrador-Vegas, A.; et al. The Pfam protein families database: Towards a more sustainable future. Nucleic Acids Res. 2015, 44, D279–D285. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  22. Mitchell, A.; Chang, H.-Y.; Daugherty, L.; Fraser, M.; Hunter, S.; Lopez, R.; McAnulla, C.; McMenamin, C.; Nuka, G.; Pesseat, S.; et al. The InterPro protein families database: The classification resource after 15 years. Nucleic Acids Res. 2014, 43, D213–D221. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  23. Söding, J.; Biegert, A.; Lupas, A.N. The HHpred interactive server for protein homology detection and structure prediction. Nucleic Acids Res. 2005, 33, W244–W248. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  24. Krogh, A.; Larsson, B.; von Heijne, G.; Sonnhammer, E.L. Predicting transmembrane protein topology with a hidden markov model: Application to complete genomes. J. Mol. Biol. 2001, 305, 567–580. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  25. Juncker, A.S.; Willenbrock, H.; von Heijne, G.; Brunak, S.; Nielsen, H.; Krogh, A. Prediction of lipoprotein signal peptides in Gram-negative bacteria. Protein Sci. 2003, 12, 1652–1662. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  26. Lowe, T.M.; Eddy, S.R. tRNAscan-SE: A program for improved detection of transfer RNA genes in genomic sequence. Nucleic Acids Res. 1997, 25, 955–964. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  27. Laslett, D.; Canback, B. ARAGORN, a program to detect tRNA genes and tmRNA genes in nucleotide sequences. Nucleic Acids Res. 2004, 32, 11–16. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  28. Turner, D.; Reynolds, D.; Seto, D.; Mahadevan, P. CoreGenes3.5: A webserver for the determination of core genes from sets of viral and small bacterial genomes. BMC Res. Notes 2013, 6, 140. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  29. Grazziotin, A.L.; Koonin, E.V.; Kristensen, D.M. Prokaryotic Virus Orthologous Groups (pVOGs): A resource for comparative genomics and protein family annotation. Nucleic Acids Res. 2017, 45, D491–D498. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  30. Eddy, S.R. Accelerated Profile HMM Searches. PLoS Comput. Biol. 2011, 7, e1002195. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  31. Sullivan, M.J.; Petty, N.K.; Beatson, S.A. Easyfig: A genome comparison visualizer. Bioinformatics 2011, 27, 1009–1010. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  32. Kumar, S.; Stecher, G.; Tamura, K. MEGA7: Molecular evolutionary genetics analysis Version 7.0 for bigger datasets. Mol. Biol. Evol. 2016, 33, 1870–1874. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  33. Edgar, R.C. MUSCLE: Multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res. 2004, 32, 1792–1797. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  34. Whelan, S.; Goldman, N. A general empirical model of protein evolution derived from multiple protein families using a maximum-likelihood approach. Mol. Biol. Evol. 2001, 18, 691–699. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  35. Meier-Kolthoff, J.P.; Auch, A.F.; Klenk, H.-P.; Göker, M. Genome sequence-based species delimitation with confidence intervals and improved distance functions. BMC Bioinform. 2013, 14, 60. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  36. Meier-Kolthoff, J.P.; Göker, M. VICTOR: Genome-based phylogeny and classification of prokaryotic viruses. Bioinformatics 2017, 33, 3396–3404. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  37. Lefort, V.; Desper, R.; Gascuel, O. FastME 2.0: A comprehensive, accurate, and fast distance-based phylogeny inference program. Mol. Biol. Evol. 2015, 32, 2798–2800. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  38. Farris, J.S. Estimating phylogenetic trees from distance matrices. Am. Nat. 1972, 106, 645–668. [Google Scholar] [CrossRef] [Scilit]
  39. Rambaut, A. FigTreeFigTree 1.4.3—A Graphical Viewer of Phylogenetic Trees and a Program for Producing Publication-Ready Figures. Available online: http://tree.bio.ed.ac.uk/software/figtree/ (accessed on 2 May 2018).
  40. Göker, M.; García-Blázquez, G.; Voglmayr, H.; Tellería, M.T.; Martín, M.P. Molecular taxonomy of phytopathogenic fungi: A case study in Peronospora. PLoS ONE 2009, 4, e6319. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  41. Meier-Kolthoff, J.P.; Hahnke, R.L.; Petersen, J.; Scheuner, C.; Michael, V.; Fiebig, A.; Rohde, C.; Rohde, M.; Fartmann, B.; Goodwin, L.A.; et al. Complete genome sequence of DSM 30083T, the type strain (U5/41T) of Escherichia coli, and a proposal for delineating subspecies in microbial taxonomy. Stand. Genom. Sci. 2014, 9, 2. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  42. Ågren, J.; Sundström, A.; Håfström, T.; Segerman, B. Gegenees: Fragmented alignment of multiple genomes for determining phylogenomic distances and genetic signatures unique for specified target groups. PLoS ONE 2012, 7, e39107. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  43. Ceyssens, P.-J.; Lavigne, R.; Mattheus, W.; Chibeu, A.; Hertveldt, K.; Mast, J.; Robben, J.; Volckaert, G. Genomic analysis of Pseudomonas aeruginosa phages LKD16 and LKA1: Establishment of the ϕKMV subgroup within the T7 supergroup. J. Bacteriol. 2006, 188, 6924–6931. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  44. Eriksson, H.; Maciejewska, B.; Latka, A.; Majkowska-Skrobek, G.; Hellstrand, M.; Melefors, Ö.; Wang, J.T.; Kropinski, A.M.; Drulis-Kawa, Z.; Nilsson, A.S. A suggested new bacteriophage genus, “Kp34likevirus”, within the Autographivirinae subfamily of Podoviridae. Viruses 2015, 7, 1804–1822. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  45. Ackermann, H.W. Frequency of morphological phage descriptions in the year 2000. Arch. Virol. 2001, 146, 843–857. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  46. Lavigne, R.; Burkal’tseva, M.V.; Robben, J.; Sykilinda, N.N.; Kurochkina, L.P.; Grymonprez, B.; Jonckx, B.; Krylov, V.N.; Mesyanzhinov, V.V.; Volckaert, G. The genome of bacteriophage phiKMV, a T7-like virus infecting Pseudomonas aeruginosa. Virology 2003, 312, 49–59. [Google Scholar] [CrossRef] [Scilit]
  47. Kropinski, A.M.; Prangishvili, D.; Lavigne, R. Position paper: The creation of a rational scheme for the nomenclature of viruses of Bacteria and Archaea. Environ. Microbiol. 2009, 11, 2775–2777. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  48. Li, S.; Fan, H.; An, X.; Fan, H.; Jiang, H.; Chen, Y.; Tong, Y. Scrutinizing virus genome termini by high-throughput sequencing. PLoS ONE 2014, 9, e85806. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  49. Fouts, D.E.; Klumpp, J.; Bishop-Lilly, K.A.; Rajavel, M.; Willner, K.M.; Butani, A.; Henry, M.; Biswas, B.; Li, M.; Albert, M.; et al. Whole genome sequencing and comparative genomic analyses of two Vibrio cholerae O139 Bengal-specific Podoviruses to other N4-like phages reveal extensive genetic diversity. Virol. J. 2013, 10, 165. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  50. Buttimer, C.; Hendrix, H.; Oliveira, H.; Casey, A.; Neve, H.; McAuliffe, O.; Ross, R.P.; Hill, C.; Noben, J.-P.; O’Mahony, J.; et al. Things are getting hairy: Enterobacteria bacteriophage vB_PcaM_CBB. Front. Microbiol. 2017, 8, 44. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  51. Bell, K.S.; Sebaihia, M.; Pritchard, L.; Holden, M.T.G.; Hyman, L.J.; Holeva, M.C.; Thomson, N.R.; Bentley, S.D.; Churcher, L.J.C.; Mungall, K.; et al. Genome sequence of the enterobacterial phytopathogen Erwinia carotovora subsp. atroseptica and characterization of virulence factors. Proc. Natl. Acad. Sci. USA 2004, 101, 11105–11110. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  52. Nikolaichik, Y.; Gorshkov, V.; Gogolev, Y.; Valentovich, L.; Evtushenkov, A. Genome sequence of Pectobacterium atrosepticum strain 21A. Genome Announc. 2014, 2. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  53. Marín, A.; Xia, X. GC skew in protein-coding genes between the leading and lagging strands in bacterial genomes: New substitution models incorporating strand bias. J. Theor. Biol. 2008, 253, 508–513. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  54. Roucourt, B.; Lavigne, R. The role of interactions between phage and bacterial proteins within the infected cell: A diverse and puzzling interactome. Environ. Microbiol. 2009, 11, 2789–2805. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  55. Jenkins, J.; Mayans, O.; Pickersgill, R. Structure and evolution of parallel β-helix proteins. J. Struct. Biol. 1998, 122, 236–246. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  56. Andres, D.; Baxa, U.; Hanke, C.; Seckler, R.; Barbirz, S. Carbohydrate binding of Salmonella phage P22 tailspike protein and its role during host cell infection. Biochem. Soc. Trans. 2010, 38, 1386–1389. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  57. Moak, M.; Molineux, I.J. Role of the Gp16 lytic transglycosylase motif in bacteriophage T7 virions at the initiation of infection. Mol. Microbiol. 2000, 37, 345–355. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  58. Briers, Y.; Peeters, L.M.; Volckaert, G.; Lavigne, R. The lysis cassette of bacteriophage ϕKMV encodes a signal-arrest-release endolysin and a pinholin. Bacteriophage 2011, 1, 25–30. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  59. Pang, T.; Savva, C.G.; Fleming, K.G.; Struck, D.K.; Young, R. Structure of the lethal phage pinhole. Proc. Natl. Acad. Sci. USA 2009, 106, 18966–18971. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  60. Young, R. Phage lysis: Three steps, three choices, one outcome. J. Microbiol. 2014, 52, 243–258. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  61. Berry, J.D.; Rajaure, M.; Young, R. Spanin function requires subunit homodimerization through intermolecular disulfide bonds. Mol. Microbiol. 2013, 88, 35–47. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  62. Lim, J.-A.; Heu, S.; Park, J.; Roh, E. Genomic characterization of bacteriophage vB_PcaP_PP2 infecting Pectobacterium carotovorum subsp. carotovorum, a new member of a proposed genus in the subfamily Autographivirinae. Arch. Virol. 2017, 162, 2441–2444. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  63. Abbasifar, R.; Kropinski, A.M.; Sabour, P.M.; Ackermann, H.-W.; Alanis Villa, A.; Abbasifar, A.; Griffiths, M.W. The genome of Cronobacter sakazakii bacteriophage vB_CsaP_GAP227 suggests a new genus within the Autographivirinae. Genome Announc. 2013, 1. [Google Scholar] [CrossRef] [Scilit] [PubMed]
  64. Nowicki, G.; Walkowiak-Nowicka, K.; Zemleduch-Barylska, A.; Mleczko, A.; Frąckowiak, P.; Nowaczyk, N.; Kozdrowska, E.; Barylski, J. Complete genome sequences of two novel autographiviruses infecting a bacterium from the Pseudomonas fluorescens group. Arch. Virol. 2017, 162, 2907–2911. [Google Scholar] [CrossRef] [Scilit] [PubMed]
Figure 1. One-step growth curve of Pectobacterium phage vB_PatP_CB5 infection of host bacterium DSM 30186. Assay was independently repeated in triplicate and the results were averaged.
Figure 1. One-step growth curve of Pectobacterium phage vB_PatP_CB5 infection of host bacterium DSM 30186. Assay was independently repeated in triplicate and the results were averaged.
Viruses 10 00394 g001
Figure 2. Transmission electron microscopy of negatively stained Pectobacterium phage CB5 using 1% (w/v) uranyl acetate. Triangle indicates the short conical tail structure, and arrows indicate short appendages (whiskers) beneath the capsid. Scale bars represent 50 nm.
Figure 2. Transmission electron microscopy of negatively stained Pectobacterium phage CB5 using 1% (w/v) uranyl acetate. Triangle indicates the short conical tail structure, and arrows indicate short appendages (whiskers) beneath the capsid. Scale bars represent 50 nm.
Viruses 10 00394 g002
Figure 3. Comparison of the genomes of the phages that form the proposed genus of ‘Phimunavirus’. Pectobacterium phage CB5 and Pectobacterium phages φM1, Peat1, and PP90 are shown using currently available annotations from Genbank, employing BLASTN and visualization with Easyfig. The genome maps display arrows indicating locations and orientation of ORFs among different phage genomes. Arrows have been color-coded describing their predicted roles (see key), and shading between the genome maps indicates the level of identity. Phage DTRs of unknown length marked with “?”.
Figure 3. Comparison of the genomes of the phages that form the proposed genus of ‘Phimunavirus’. Pectobacterium phage CB5 and Pectobacterium phages φM1, Peat1, and PP90 are shown using currently available annotations from Genbank, employing BLASTN and visualization with Easyfig. The genome maps display arrows indicating locations and orientation of ORFs among different phage genomes. Arrows have been color-coded describing their predicted roles (see key), and shading between the genome maps indicates the level of identity. Phage DTRs of unknown length marked with “?”.
Viruses 10 00394 g003
Figure 4. Pairwise comparison of the type phages representing six genera of the subfamily Autographivirinae; KP34virus, Phikmvvirus, Frivirus, SP6virus, Pradovirus and T7virus, and against Pectobacterium phage φM1. Genomic maps were created using currently available annotation from Genbank with comparisons employing TBLASTX and visualization with Easyfig. The genome maps display arrows indicating locations and orientation of ORFs. Lines between genome maps indicate the level of identity. The ORF of a conserved protein shared between φM1 and KP34 that does not mirror genomic position is color-coded green. The ORF encoding the RNAP shared between genera of Autographivirinae has been color-coded red. Phage DTRs of unknown length marked with “?”.
Figure 4. Pairwise comparison of the type phages representing six genera of the subfamily Autographivirinae; KP34virus, Phikmvvirus, Frivirus, SP6virus, Pradovirus and T7virus, and against Pectobacterium phage φM1. Genomic maps were created using currently available annotation from Genbank with comparisons employing TBLASTX and visualization with Easyfig. The genome maps display arrows indicating locations and orientation of ORFs. Lines between genome maps indicate the level of identity. The ORF of a conserved protein shared between φM1 and KP34 that does not mirror genomic position is color-coded green. The ORF encoding the RNAP shared between genera of Autographivirinae has been color-coded red. Phage DTRs of unknown length marked with “?”.
Viruses 10 00394 g004
Figure 5. Phylogenetic analyses of amino acid sequences of the major capsid proteins (log likelihood = 13,809.83) of Pectobacterium phage CB5 and 52 members of the Autographivirinae subfamily using maximum likelihood (Whelan and Goldman substitution model), with 1000 bootstrap replicates. Members of the T7virus, SP6virus, KP34virus, Frivirus, Pradovirus, KP32virus are illustrated.
Figure 5. Phylogenetic analyses of amino acid sequences of the major capsid proteins (log likelihood = 13,809.83) of Pectobacterium phage CB5 and 52 members of the Autographivirinae subfamily using maximum likelihood (Whelan and Goldman substitution model), with 1000 bootstrap replicates. Members of the T7virus, SP6virus, KP34virus, Frivirus, Pradovirus, KP32virus are illustrated.
Viruses 10 00394 g005
Figure 6. VICTOR-generated phylogenomic Genome-BLAST Distance Phylogeny (GBDP) trees of Pectobacterium phage CB5 and 52 members of the Autographivirinae subfamily inferred using the formula D4 and yielding average support of 71%. The numbers above branches are GBDP pseudo-bootstrap support values from 100 replications. Members of the T7virus, SP6virus, KP34virus, Frivirus, Pradovirus, and KP32virus are illustrated.
Figure 6. VICTOR-generated phylogenomic Genome-BLAST Distance Phylogeny (GBDP) trees of Pectobacterium phage CB5 and 52 members of the Autographivirinae subfamily inferred using the formula D4 and yielding average support of 71%. The numbers above branches are GBDP pseudo-bootstrap support values from 100 replications. Members of the T7virus, SP6virus, KP34virus, Frivirus, Pradovirus, and KP32virus are illustrated.
Viruses 10 00394 g006
Figure 7. TBLASTX heat map generated using Gegenees with accurate parameters—fragment length: 200 bp; and step size: 100 bp with the threshold set to 5%. The map includes the genomes of 32 phages of Autographivirinae with phages representing the genera Fri1virus (yellow), KP34virus (brown), Phikmvvirus (green) and the proposed genus of ‘Phimunavirus’ (blue). Plot colors reflect the identity, ranging from low (red) to high (green).
Figure 7. TBLASTX heat map generated using Gegenees with accurate parameters—fragment length: 200 bp; and step size: 100 bp with the threshold set to 5%. The map includes the genomes of 32 phages of Autographivirinae with phages representing the genera Fri1virus (yellow), KP34virus (brown), Phikmvvirus (green) and the proposed genus of ‘Phimunavirus’ (blue). Plot colors reflect the identity, ranging from low (red) to high (green).
Viruses 10 00394 g007
Figure 8. Lysis cassette scheme of (A) Klebsiella phage KP34 and PhiM1-like phages compared to (B) Pseudomonas phage φKMV.
Figure 8. Lysis cassette scheme of (A) Klebsiella phage KP34 and PhiM1-like phages compared to (B) Pseudomonas phage φKMV.
Viruses 10 00394 g008
Table 1. Host range of Pectobacterium phage vB_PatP_CB5 (CB5) on 31 strains of the soft rot Enterobacteriaceae, determined by spot testing with serial dilutions of phage.
Table 1. Host range of Pectobacterium phage vB_PatP_CB5 (CB5) on 31 strains of the soft rot Enterobacteriaceae, determined by spot testing with serial dilutions of phage.
SpeciesStrainSensitivity
Pectobacterium atrosepticumDSM 18077 (type strain)++
DSM 30184+
DSM 30185+
DSM 30186++ *
CB BL1-1+
CB BL2-1+
CB BL3-1+
CB BL4-1+
CB BL5-1+
CB BL7-1+
CB BL9-1+
CB BL11-1+
CB BL12-2++
CB BL13-1+
CB BL14-1+
CB BL15-1
CB BL16-1+
CB BL18-1+
CB BL19-1+
Pectobacterium carotovorum subsp. carotovorumDSM 30168 (type strain)
DSM 30169
DSM 30170
CB BL19-1-37
Dickeya chrysanthemi bv chrysanthemiLMG 2804
Dickeya dianthicolaPD 482
PD 2174
GBBC 1538
Dickeya solanisp. PRI 2222 (D36)
LMG 25865 (D10)
GBBC 1502
GBBC 1586
Results recorded as ++, sensitive; +, presence of clear spot with no plaque formation; −, no infection; * host strain of phage.
Table 2. Properties of the seven phages belonging to the proposed genus of ‘Phimunavirus’. ORF: open reading frame; DTR: direct terminal repeat.
Table 2. Properties of the seven phages belonging to the proposed genus of ‘Phimunavirus’. ORF: open reading frame; DTR: direct terminal repeat.
PhageGenome Size (bp)DTRs (bp)G + C Content, %ORFstRNADNA Identity, % *Homologous Proteins, % **
φM143,53429349.18521100100
CB544,26228748.986008473
Peat145,633NA48.866108687
PP9044,570NA48.895608680
* DNA identity in comparison to φM1 using BLASTN; ** Number of homologous proteins in comparison to φM1 using CoreGenes; NA, not available.
Table 3. Thirty-nine conserved genes among phages (φM1, Peat1, CB5, PP90) of the proposed genus ‘Phimunavirus’, as determined by CoreGenes, and their details with regard to the type phage φM1. Conserved proteins of these phages shared with Klebsiella phage KP34 are highlighted in bold. Additionally, prokaryotic Virus Orthologous Groups (pVOGs) determined from translated ORFs of φM1 of these conserved proteins are presented.
Table 3. Thirty-nine conserved genes among phages (φM1, Peat1, CB5, PP90) of the proposed genus ‘Phimunavirus’, as determined by CoreGenes, and their details with regard to the type phage φM1. Conserved proteins of these phages shared with Klebsiella phage KP34 are highlighted in bold. Additionally, prokaryotic Virus Orthologous Groups (pVOGs) determined from translated ORFs of φM1 of these conserved proteins are presented.
No.ProductφM1 Accession No.Φm1 Locus TagpVOG
1hypothetical proteinAFQ22488.1PhiM1_03VOG6006
2hypothetical proteinAFQ22489.1PhiM1_04VOG1073
3hypothetical proteinAFQ22493.1PhiM1_08VOG5528
4hypothetical proteinAFQ22494.1PhiM1_09-
5putative peptidaseAFQ22495.1PhiM1_10VOG5332
6hypothetical proteinAFQ22496.1PhiM1_11VOG5704
7putative DNA primaseAFQ22497.1PhiM1_12VOG4551
8putative DNA helicaseAFQ22499.1PhiM1_14VOG0025
9hypothetical proteinAFQ22501.1 PhiM1_16-
10hypothetical proteinAFQ22503.1 PhiM1_18-
11DNA polymeraseAFQ22505.1PhiM1_20VOG0026
12hypothetical proteinAFQ22506.1PhiM1_21VOG1076
13DNA exonucleaseAFQ22507.1PhiM1_22VOG0028
14hypothetical proteinAFQ22508.1 PhiM1_23-
15DNA endonuclease VIIAFQ22510.1PhiM1_25VOG8238
16putative metallophosphoesteraseAFQ22512.1PhiM1_27VOG1606
17hypothetical proteinAFQ22514.1 PhiM1_29VOG1254
18hypothetical proteinAFQ22515.1 PhiM1_30VOG9679
19putative RNA polymeraseAFQ22516.1PhiM1_31VOG0019
20hypothetical proteinAFQ22517.1 PhiM1_32VOG1406
21hypothetical proteinAFQ22518.1 PhiM1_33VOG9202
22putative structural proteinAFQ22519.1PhiM1_34VOG8332
23putative head–tail connector proteinAFQ22520.1PhiM1_35VOG0030
24putative scaffolding proteinAFQ22521.1PhiM1_36VOG0031
25putative endonucleaseAFQ22522.1PhiM1_37-
26putative capsid proteinAFQ22523.1PhiM1_38VOG4572
27putative tail tubular protein AAFQ22524.1PhiM1_39VOG4592
28putative tail tubular protein BAFQ22525.1PhiM1_40VOG0034
29putative internal core protein AAFQ22526.1PhiM1_41VOG1080
30putative internal core protein BAFQ22527.1PhiM1_42VOG3794
31putative internal core protein CAFQ22528.1PhiM1_43VOG0038
32putative tail fiber proteinAFQ22529.1PhiM1_44-
33putative DNA maturase AAFQ22530.1PhiM1_45VOG0041
34putative DNA maturase BAFQ22531.1PhiM1_46VOG4544
35hypothetical proteinAFQ22532.1 PhiM1_47-
36putative Rz1A proteinAFQ22534.1PhiM1_49VOG1082
37putative holinAFQ22535.1 PhiM1_50VOG0765
38endolysinAFQ22536.1PhiM1_51VOG4565
39phage tail spike proteinAFQ22537.1 PhiM1_52VOG4640
Table 4. Alignment of the recognition and specificity loops of the RNAP of PhiM1-like phages to phages φKMV and KP34. Underlined amino acids/residues show sites of substitutions in comparison to φM1.
Table 4. Alignment of the recognition and specificity loops of the RNAP of PhiM1-like phages to phages φKMV and KP34. Underlined amino acids/residues show sites of substitutions in comparison to φM1.
PhageRecognition LoopSpecificity Loop
φKMVHQEAKAAGPAAKLEEVRVRLRAEAVEYVTLYEAK-DE
KP34MRNVKAPGIGGKYEEVRVRIDCMNLSAVLVHNRDFKT
Fri1VKKQKIRGVGGKYVTKTVAIRSMGINNIAYRYPD-NQ
φM1ICSKGTRGVGGKYSITRVSLKALGVALNMRVFDD-HS
CB5ICSKGTRGVGGKYSITRVSLKALGVALNMRVFDD-HS
Peat1ICSKGTRGVGGKYSITRVSLKALGVALNMRVFDD-HS
PP90ICSKGTRGVGGKYSITRVSLKALGVALNMRVFDD-HS
BF25/12MCSTGSRGLGGKYDSTRINLNALGTQLVMRTFND-HL
PP16ICTTGNRGLNGKYDSTRIELRSLGIKLVMRTFDD-TQ
PPWS1ICTTGNRGLNGKYDSTRIELRSLGIKLVMRTFDD-TQ

Share and Cite

MDPI and ACS Style

Buttimer, C.; Lucid, A.; Neve, H.; Franz, C.M.A.P.; O’Mahony, J.; Turner, D.; Lavigne, R.; Coffey, A. Pectobacterium atrosepticum Phage vB_PatP_CB5: A Member of the Proposed Genus ‘Phimunavirus’. Viruses 2018, 10, 394. https://doi.org/10.3390/v10080394

AMA Style

Buttimer C, Lucid A, Neve H, Franz CMAP, O’Mahony J, Turner D, Lavigne R, Coffey A. Pectobacterium atrosepticum Phage vB_PatP_CB5: A Member of the Proposed Genus ‘Phimunavirus’. Viruses. 2018; 10(8):394. https://doi.org/10.3390/v10080394

Chicago/Turabian Style

Buttimer, Colin, Alan Lucid, Horst Neve, Charles M. A. P. Franz, Jim O’Mahony, Dann Turner, Rob Lavigne, and Aidan Coffey. 2018. "Pectobacterium atrosepticum Phage vB_PatP_CB5: A Member of the Proposed Genus ‘Phimunavirus’" Viruses 10, no. 8: 394. https://doi.org/10.3390/v10080394

APA Style

Buttimer, C., Lucid, A., Neve, H., Franz, C. M. A. P., O’Mahony, J., Turner, D., Lavigne, R., & Coffey, A. (2018). Pectobacterium atrosepticum Phage vB_PatP_CB5: A Member of the Proposed Genus ‘Phimunavirus’. Viruses, 10(8), 394. https://doi.org/10.3390/v10080394

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop