Genomic Insights into and In Vitro Evaluation of Antimicrobial Combination Therapies for Carbapenem-Resistant Acinetobacter baumannii
Abstract
1. Introduction
2. Materials and Methods
2.1. Isolation and Phenotypic Characterization of CRAB
2.2. Molecular Detection of Resistant Genes
2.3. Phylogenetic Analysis of Carbapenemase- and MBL-Encoding Genes of CRAB
2.4. Mutational Analysis of Carbapenemase-Encoding Genes of CRAB
2.5. Combination Synergy Testing
- An FIC index ≤ 0.5 indicates synergy
- An FIC index within 0.5–1 indicates partial synergy
- An FIC index ≥ 1–<4 indicates indifference
- An FIC index ≥ 4 indicates antagonism.
3. Results
3.1. Phenotypic Characterization
3.2. Molecular Characterization of MBL- and Carbapenemase-Encoding Genes of CRAB
3.3. Phylogenetic Studies
3.4. Mutational Analysis of blaOXA Genes of CRAB Isolates
3.5. Synergistic Effects of Antimicrobial Agents
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Munoz-Price, L.S.; Weinstein, R.A. Acinetobacter infection. N. Engl. J. Med. 2008, 358, 1271–1281. [Google Scholar] [CrossRef] [PubMed]
- Peleg, A.Y.; Seifert, H.; Paterson, D.L. Acinetobacter baumannii: Emergence of a successful pathogen. Clin. Microbiol. Rev. 2008, 21, 538–582. [Google Scholar] [CrossRef]
- Cheikh, H.B.; Domingues, S.; Silveira, E.; Kadri, Y.; Rosário, N.; Mastouri, M.; Da Silva, G.J. Molecular characterization of carbapenemases of clinical Acinetobacter baumannii–calcoaceticus complex isolates from a University Hospital in Tunisia. 3 Biotech 2018, 8, 297. [Google Scholar] [CrossRef]
- Nwabor, O.F.; Terbtothakun, P.; Voravuthikunchai, S.P.; Chusri, S. Evaluation of the synergistic antibacterial effects of fosfomycin in combination with selected antibiotics against carbapenem–resistant Acinetobacter baumannii. Pharmaceuticals 2021, 14, 185. [Google Scholar] [CrossRef] [PubMed]
- Lolans, K.; Rice, T.W.; Munoz-Price, L.S.; Quinn, J.P. Multicity outbreak of carbapenem-resistant Acinetobacter baumannii isolates producing the carbapenemase OXA-40. Antimicrob. Agents Chemother. 2006, 50, 2941–2945. [Google Scholar] [CrossRef] [PubMed]
- Leite, G.C.; Oliveira, M.S.; Perdigao-Neto, L.V.; Rocha, C.K.D.; Guimaraes, T.; Rizek, C.; Levin, A.S.; Costa, S.F. Antimicrobial combinations against pan-resistant Acinetobacter baumannii isolates with different resistance mechanisms. PLoS ONE 2016, 11, e0151270. [Google Scholar] [CrossRef] [PubMed]
- Ustundag, G.; Oncel, E.K.; Sahin, A.; Keles, Y.E.; Aksay, A.K.; Ciftdogan, D.Y. Colistin treatment for multidrug-resistant gram-negative infections in children: Caution required for nephrotoxicity. Med. Bull. Sisli Etfal Hosp. 2022, 56, 427–434. [Google Scholar] [CrossRef]
- Tamma, P.D.; Aitken, S.L.; Bonomo, R.A.; Mathers, A.J.; van Duin, D.; Clancy, C.J. Infectious Diseases Society of America 2023 guidance on the treatment of antimicrobial resistant gram-negative infections. Clin. Infect. Dis. 2023, ciad428. [Google Scholar] [CrossRef]
- Lee, C.-R.; Lee, J.H.; Park, M.; Park, K.S.; Bae, I.K.; Kim, Y.B.; Cha, C.-J.; Jeong, B.C.; Lee, S.H. Biology of Acinetobacter baumannii: Pathogenesis, antibiotic resistance mechanisms, and prospective treatment options. Front. Cell. Infect. Microbiol. 2017, 7, 55. [Google Scholar] [CrossRef]
- Geisinger, E.; Huo, W.; Hernandez-Bird, J.; Isberg, R.R. Acinetobacter baumannii: Envelope determinants that control drug resistance, virulence, and surface variability. Annu. Rev. Microbiol. 2019, 73, 481–506. [Google Scholar] [CrossRef]
- Pournajaf, A.; Rajabnia, R.; Razavi, S.; Solgi, S.; Ardebili, A.; Yaghoubi, S.; Khodabandeh, M.; Yahyapour, Y.; Emadi, B.; Irajian, G. Molecular characterization of carbapenem-resistant Acinetobacter baumannii isolated from pediatric burns patients in an Iranian hospital. Trop. J. Pharm. Res. 2018, 17, 135–141. [Google Scholar] [CrossRef]
- Vrancianu, C.O.; Gheorghe, I.; Czobor, I.B.; Chifiriuc, M.C. Antibiotic resistance profiles, molecular mechanisms and innovative treatment strategies of Acinetobacter baumannii. Microorganisms 2020, 8, 935. [Google Scholar] [CrossRef]
- Al-Kadmy, I.M.; Ibrahim, S.A.; Al-Saryi, N.; Aziz, S.N.; Besinis, A.; Hetta, H.F. Prevalence of genes involved in colistin resistance in Acinetobacter baumannii: First report from Iraq. Microb. Drug Resist. 2020, 26, 616–622. [Google Scholar] [CrossRef]
- Di Venanzio, G.; Flores-Mireles, A.L.; Calix, J.J.; Haurat, M.F.; Scott, N.E.; Palmer, L.D.; Potter, R.F.; Hibbing, M.E.; Friedman, L.; Wang, B. Urinary tract colonization is enhanced by a plasmid that regulates uropathogenic Acinetobacter baumannii chromosomal genes. Nat. Commun. 2019, 10, 2763. [Google Scholar] [CrossRef]
- Khurshid, M.; Rasool, M.H.; Siddique, M.H.; Azeem, F.; Naeem, M.; Sohail, M.; Sarfraz, M.; Saqalein, M.; Taj, Z.; Nisar, M.A. Molecular mechanisms of antibiotic co-resistance among carbapenem resistant Acinetobacter baumannii. J. Infect. Dev. Ctries. 2019, 13, 899–905. [Google Scholar] [CrossRef]
- Bellio, P.; Segatore, B.; Mancini, A.; Di Pietro, L.; Bottoni, C.; Sabatini, A.; Brisdelli, F.; Piovano, M.; Nicoletti, M.; Amicosante, G. Interaction between lichen secondary metabolites and antibiotics against clinical isolates methicillin-resistant Staphylococcus aureus strains. Phytomedicine 2015, 22, 223–230. [Google Scholar] [CrossRef]
- Nageeb, W.; Metwally, L.; Kamel, M.; Zakaria, S. In vitro antimicrobial synergy studies of carbapenem-resistant Acinetobacter baumannii isolated from intensive care units of a tertiary care hospital in Egypt. J. Infect. Public Health 2015, 8, 593–602. [Google Scholar] [CrossRef]
- Pongpech, P.; Amornnopparattanakul, S.; Panapakdee, S.; Fungwithaya, S.; Nannha, P.; Dhiraputra, C.; Leelarasamee, A. Antibacterial activity of carbapenem-based combinations againts multidrug-resistant Acinetobacter baumannii. J. Med. Assoc. Thail. 2011, 93, 161. [Google Scholar]
- Choi, M.-J.; Yohannes, S.B.; Lee, S.-J.; Damte, D.; Reza, M.A.; Rhee, M.-H.; Kim, T.-H.; Park, S.-C. The in vitro Antibacterial Activity of Enrofloxacin-Trimethoprim Combination against Five Bacterial species. Pak. Vet. J. 2012, 32, 363–366. [Google Scholar]
- Ijaz, S.; Ansari, F.; Nawaz, M.; Anjum, A.A.; Rasool, K. Genetic Characterization of Carbapenem Resistant Acinetobacter baumannii in Tertiary care settings of Lahore, Pakistan. Adv. Life Sci. 2023, 10, 479–485. [Google Scholar]
- Whitman, W.B.; Rainey, F.; Kämpfer, P.; Trujillo, M.; Chun, J.; DeVos, P.; Hedlund, B.; Dedysh, S. Bergey’s Manual of Systematics of Archaea and Bacteria; Wiley Online Library: Hoboken, NJ, USA, 2015; Volume 410. [Google Scholar]
- Hudzicki, J. Kirby-Bauer disk diffusion susceptibility test protocol. Am. Soc. Microbiol. 2009, 15, 1–23. [Google Scholar]
- CLSI. Performance standards for antimicrobial susceptibility testing. In CLSI Document M100; Clinical and Laboratory Standards Institute: Wayne, PA, USA, 2024. [Google Scholar]
- Amjad, A.; Mirza, I.A.; Abbasi, S.; Farwa, U.; Malik, N.; Zia, F. Modified Hodge test: A simple and effective test for detection of carbapenemase production. Iran. J. Microbiol. 2011, 3, 189. [Google Scholar]
- Yong, D.; Lee, K.; Yum, J.H.; Shin, H.B.; Rossolini, G.M.; Chong, Y. Imipenem-EDTA disk method for differentiation of metallo-β-lactamase-producing clinical isolates of Pseudomonas spp. and Acinetobacter spp. J. Clin. Microbiol. 2002, 40, 3798–3801. [Google Scholar] [CrossRef]
- Capriotti, E.; Fariselli, P.; Casadio, R. I-Mutant2. 0: Predicting stability changes upon mutation from the protein sequence or structure. Nucleic Acids Res. 2005, 33, W306–W310. [Google Scholar] [CrossRef]
- Cheng, J.; Randall, A.; Baldi, P. Prediction of protein stability changes for single-site mutations using support vector machines. Proteins Struct. Funct. Bioinform. 2006, 62, 1125–1132. [Google Scholar] [CrossRef] [PubMed]
- Capriotti, E.; Calabrese, R.; Casadio, R. Predicting the insurgence of human genetic diseases associated to single point protein mutations with support vector machines and evolutionary information. Bioinformatics 2006, 22, 2729–2734. [Google Scholar] [CrossRef] [PubMed]
- Benamri, I.; Azzouzi, M.; Moussa, A.; Radouani, F. An in silico analysis of rpoB mutations to affect Chlamydia trachomatis sensitivity to rifamycin. J. Genet. Eng. Biotechnol. 2022, 20, 146. [Google Scholar] [CrossRef]
- Moody, J. Synergism testing: Broth microdilution checkerboard and broth macrodilution method. In Clinical Microbiology Procedures Handbook; Garcia, L.S., Isenberg, H., Eds.; ASM Press: Washington, DC, USA, 2004; pp. 1–23. [Google Scholar]
- Wayne, P. Performance standards for antimicrobial susceptibility testing. In CLSI Supplement M100; Clinical Laboratory Standard Institute: Wayne, PA, USA, 2018. [Google Scholar]
- Almutairi, M.M. Synergistic activities of colistin combined with other antimicrobial agents against colistin-resistant Acinetobacter baumannii clinical isolates. PLoS ONE 2022, 17, e0270908. [Google Scholar] [CrossRef]
- Humphries, R.; Bobenchik, A.M.; Hindler, J.A.; Schuetz, A.N. Overview of changes to the clinical and laboratory standards institute performance standards for antimicrobial susceptibility testing, M100. J. Clin. Microbiol. 2021, 59, e0021321. [Google Scholar] [CrossRef]
- Sopirala, M.M.; Mangino, J.E.; Gebreyes, W.A.; Biller, B.; Bannerman, T.; Balada-Llasat, J.-M.; Pancholi, P. Synergy testing by Etest, microdilution checkerboard, and time-kill methods for pan-drug-resistant Acinetobacter baumannii. Antimicrob. Agents Chemother. 2010, 54, 4678–4683. [Google Scholar] [CrossRef] [PubMed]
- Woodford, N.; Ellington, M.J.; Coelho, J.M.; Turton, J.F.; Ward, M.E.; Brown, S.; Amyes, S.G.; Livermore, D.M. Multiplex PCR for genes encoding prevalent OXA carbapenemases in Acinetobacter spp. Int. J. Antimicrob. Agents 2006, 27, 351–353. [Google Scholar] [CrossRef] [PubMed]
- Ellington, M.J.; Kistler, J.; Livermore, D.M.; Woodford, N. Multiplex PCR for rapid detection of genes encoding acquired metallo-β-lactamases. J. Antimicrob. Chemother. 2007, 59, 321–322. [Google Scholar] [CrossRef]
- Perry, J.D.; Naqvi, S.H.; Mirza, I.A.; Alizai, S.A.; Hussain, A.; Ghirardi, S.; Orenga, S.; Wilkinson, K.; Woodford, N.; Zhang, J. Prevalence of faecal carriage of Enterobacteriaceae with NDM-1 carbapenemase at military hospitals in Pakistan, and evaluation of two chromogenic media. J. Antimicrob. Chemother. 2011, 66, 2288–2294. [Google Scholar] [CrossRef] [PubMed]
- Zahra, N.; Zeshan, B.; Qadri, M.M.A.; Ishaq, M.; Afzal, M.; Ahmed, N. Phenotypic and genotypic evaluation of antibiotic resistance of Acinetobacter baumannii bacteria isolated from surgical intensive care unit patients in Pakistan. Jundishapur J. Microbiol. 2021, 14, e113008. [Google Scholar] [CrossRef]
- Leungtongkam, U.; Thummeepak, R.; Wongprachan, S.; Thongsuk, P.; Kitti, T.; Ketwong, K.; Runcharoen, C.; Chantratita, N.; Sitthisak, S. Dissemination of bla OXA-23, bla OXA-24, bla OXA-58, and bla NDM-1 Genes of Acinetobacter baumannii Isolates from Four Tertiary Hospitals in Thailand. Microb. Drug Resist. 2018, 24, 55–62. [Google Scholar] [CrossRef]
- Vijayakumar, S.; Mathur, P.; Kapil, A.; Das, B.K.; Ray, P.; Gautam, V.; Sistla, S.; Parija, S.C.; Walia, K.; Ohri, V. Molecular characterization & epidemiology of carbapenem-resistant Acinetobacter baumannii collected across India. Indian J. Med. Res. 2019, 149, 240–246. [Google Scholar]
- Sharma, S.; Banerjee, T.; Yadav, G.; Kumar, A. Susceptibility profile of blaOXA-23 and metallo-β-lactamases co-harbouring isolates of carbapenem resistant Acinetobacter baumannii (CRAB) against standard drugs and combinations. Front. Cell. Infect. Microbiol. 2023, 12, 1068840. [Google Scholar] [CrossRef]
- Zhao, F.; Liu, H.; Yao, Y.; Zhang, L.; Zhou, Z.; Leptihn, S.; Yu, Y.; Hua, X.; Fu, Y. Description of a rare pyomelanin-producing carbapenem-resistant Acinetobacter baumannii strain coharboring chromosomal OXA-23 and NDM-1. Microbiol. Spectr. 2022, 10, e02144-22. [Google Scholar] [CrossRef]
- Anane, Y.A.; Apalata, T.; Vasaikar, S.; Okuthe, G.E.; Songca, S. Molecular detection of carbapenemase-encoding genes in multidrug-resistant Acinetobacter baumannii clinical isolates in South Africa. Int. J. Microbiol. 2020, 2020, 7380740. [Google Scholar] [CrossRef]
- Ibrahim, M.E. Prevalence of Acinetobacter baumannii in Saudi Arabia: Risk factors, antimicrobial resistance patterns and mechanisms of carbapenem resistance. Ann. Clin. Microbiol. Antimicrob. 2019, 18, 1. [Google Scholar] [CrossRef] [PubMed]
- Nowak, J.; Zander, E.; Stefanik, D.; Higgins, P.G.; Roca, I.; Vila, J.; McConnell, M.J.; Cisneros, J.M.; Seifert, H.; WP4, M.W.G. High incidence of pandrug-resistant Acinetobacter baumannii isolates collected from patients with ventilator-associated pneumonia in Greece, Italy and Spain as part of the MagicBullet clinical trial. J. Antimicrob. Chemother. 2017, 72, 3277–3282. [Google Scholar] [CrossRef] [PubMed]
- Adjei, A.Y.; Vasaikar, S.D.; Apalata, T.; Okuthe, E.G.; Songca, S.P. Phylogenetic analysis of carbapenem-resistant Acinetobacter baumannii isolated from different sources using Multilocus Sequence Typing Scheme. Infect. Genet. Evol. 2021, 96, 105132. [Google Scholar] [CrossRef] [PubMed]
- Nogbou, N.-D.; Nkawane, G.M.; Ntshane, K.; Wairuri, C.K.; Phofa, D.T.; Mokgokong, K.K.; Ramashia, M.; Nchabeleng, M.; Obi, L.C.; Musyoki, A.M. Efflux pump activity and mutations driving multidrug resistance in Acinetobacter baumannii at a Tertiary Hospital in Pretoria, South Africa. Int. J. Microbiol. 2021, 2021, 9923816. [Google Scholar] [CrossRef] [PubMed]
- Sun, B.; Liu, H.; Jiang, Y.; Shao, L.; Yang, S.; Chen, D. New mutations involved in colistin resistance in Acinetobacter baumannii. Msphere 2020, 5, e00895-19. [Google Scholar] [CrossRef] [PubMed]
- Chan, K.-W.; Liu, C.-Y.; Wong, H.-Y.; Chan, W.-C.; Wong, K.-Y.; Chen, S. Specific Amino Acid Substitutions in OXA-51-Type β-Lactamase Enhance Catalytic Activity to a Level Comparable to Carbapenemase OXA-23 and OXA-24/40. Int. J. Mol. Sci. 2022, 23, 4496. [Google Scholar] [CrossRef]
- Moradi, J.; Hashemi, F.B.; Bahador, A. Antibiotic resistance of Acinetobacter baumannii in Iran: A systemic review of the published literature. Osong Public Health Res. Perspect. 2015, 6, 79–86. [Google Scholar] [CrossRef] [PubMed]
- Tewari, R.; Chopra, D.; Wazahat, R.; Dhingra, S.; Dudeja, M. Antimicrobial susceptibility patterns of an emerging multidrug resistant nosocomial pathogen: Acinetobacter baumannii. Malays. J. Med. Sci. MJMS 2018, 25, 129. [Google Scholar] [CrossRef] [PubMed]
- Lin, M.-F.; Lan, C.-Y. Antimicrobial resistance in Acinetobacter baumannii: From bench to bedside. World J. Clin. Cases WJCC 2014, 2, 787. [Google Scholar] [CrossRef]
- Jiang, Z.; He, X.; Li, J. Synergy effect of meropenem-based combinations against Acinetobacter baumannii: A systematic review and meta-analysis. Infect. Drug Resist. 2018, 11, 1083–1095. [Google Scholar] [CrossRef]
- Gunalan, A.; Sarumathi, D.; Sastry, A.S.; Ramanathan, V.; Rajaa, S.; Sistla, S. Effect of combined colistin and meropenem against meropenem resistant Acinetobacter baumannii and Pseudomonas aeruginosa by checkerboard method: A cross sectional analytical study. Indian J. Pharmacol. 2021, 53, 207–212. [Google Scholar] [PubMed]
- Wan, G.; Ruan, L.; Yin, Y.; Yang, T.; Ge, M.; Cheng, X. Effects of silver nanoparticles in combination with antibiotics on the resistant bacteria Acinetobacter baumannii. Int. J. Nanomed. 2016, 11, 3789–3800. [Google Scholar] [CrossRef] [PubMed]
- Temocin, F.; Erdinc, F.S.; Tulek, N.; Demirelli, M.; Ertem, G.; Kinikli, S.; Koksal, E. Synergistic effects of sulbactam in multi-drug-resistant Acinetobacter baumannii. Braz. J. Microbiol. 2015, 46, 1119–1124. [Google Scholar] [CrossRef] [PubMed]
- Arafa, A.A.; Kandil, M.M. Antimicrobial Activity of Zinc Oxide Nanoparticles against ESBL Producing Klebsiella pneumoniae Isolated from Equines in Egypt. Pak. Vet. J. 2023, 44, 176–182. [Google Scholar]







| Sample ID | Source | Specimen | TZP 110 μg | FEP 30 μg | CAZ 30 μg | IPM 10 μg | MEM 10 μg | AK 30 μg | CN 10 μg | TOB 10 μg | DOX 30 μg | CIP 5 μg | LEV 5 μg | SXT 25 ug | CT * | Genes Detected | Genes Sequenced |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| S-10 | LGH | Tracheal secretions | R | R | R | R | R | R | R | R | S | R | R | R | S | OXA-51, OXA-23, and VIM | OXA-23 and OXA-51 |
| S-67 | JHL | Tracheal secretions | R | R | R | R | R | R | R | R | R | R | R | R | S | OXA-24,OXA-23, OXA-51, and VIM | OXA-24 |
| S-84 | SHL | Blood | R | R | R | R | R | R | R | R | S | R | R | S | S | OXA-51, OXA-58, and NDM-1 | NDM-1 |
| S-96 | SHL | Tracheal secretions | R | R | R | R | R | R | R | R | R | R | R | S | S | OXA-23, OXA-58, OXA-51, and VIM | OXA-58 |
| S-97 | CIP | Tracheal secretions | R | R | R | R | R | R | R | R | R | R | R | S | S | OXA-58,OXA-51, and VIM | OXA-58 |
| S-98 | CIP | Tissue | R | R | R | R | R | R | R | R | R | R | R | R | S | OXA-23, OXA-58,OXA-51, and VIM | OXA-58 |
| Strain | Gene | Mutation | Amino Acid Change | Normal Protein Sequence |
|---|---|---|---|---|
| S-10 | blaOXA-51 | E11Q | Position 11: Glutamic acid (E) replaced by Glutamine (Q) | TTTEVFKWDGEKRLFPEWEKNMTLGDAMKASAIPVYQDLARRIGLELMSKEVKRVGYGNADIGTQVDNFWLVGPLKITPQQEAQFAYKLANKTLPFSQKVQDEVQS |
| K50N | Position 50: Lysine (K) replaced by Asparagine (N) | |||
| blaOXA-23 | No mutations | No mutations | No mutations | |
| S-67 | blaOXA-24 | M69L | Position 69: Methionine (M) replaced by Leucine (L) | FADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMDVTPQVGWLTGWVEQANGKKIPFSLNM |
| S-84 | blaNDM-1 | The mutational analysis was only performed on blaOXA genes | ||
| S-96 | blaOXA-58 | I59M | Position 59: Isoleucine (I) replaced by Methionine (M) | TSTIPQVNNSIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRG |
| A60L | Position 60: Alanine (A) replaced by Leucine (L) | |||
| P116L | Position 116: Proline (P) replaced by Leucine (L) | |||
| S121Q | Position 121: Serine (S) replaced by Glutamine (Q) | |||
| F167P | Position 167: Phenylalanine (F) replaced by Proline (P) | |||
| S-97 | blaOXA-58 | Q2K | Position 2: Glutamine (Q) replaced by Lysine (K) | EQTGTIPQVNNSIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYVERRG |
| G4S | Position 4: Glycine (G) replaced by Serine (S) | |||
| I61M | Position 61: Isoleucine (I) replaced by Methionine (M) | |||
| A62L | Position 62: Alanine (A) replaced by Leucine (L) | |||
| S-98 | blaOXA-58 | I59M | Position 59: Isoleucine (I) replaced by Methionine (M) | TSTIPQVNNSIIDQNVQALFNEISADAVFVTYDGQNIKKYGTHLDRAKTAYIPASTFKIANALIGLENHKATSTEIFKWDGKPRFFKAWDKDFTLGEAMQASTVPVYQELARRIGPSLMQSELQRIGYGNMQIGTEVDQFWLKGPLTITPIQEVKFVYDLAQGQLPFKPEVQQQVKEMLYV |
| Position 60: Alanine (A) replaced by Leucine (L) | ||||
| A60L | Position 121: Serine (S) replaced by Lysine (L) | |||
| Position 181: Valine (V) replaced by Isoleucine (I) | ||||
| S121K | ||||
| V181I | ||||
| Strain | Gene | Mutation | MUpro | I-MUTANT | PhD SNP | Gene Expression |
|---|---|---|---|---|---|---|
| S10 | OXA-51 | E11Q | Decrease | Decrease | Neutral | No Change |
| K50N | Decrease | Decrease | Neutral | No Change | ||
| S96 | OXA-58 | A60L | Decrease | Decrease | Disease | No Change |
| I59M | Decrease | Decrease | Disease | No Change | ||
| P116L | Increase | Increase | Neutral | Change | ||
| S121Q | Decrease | Increase | Neutral | No Change | ||
| F167P | Decrease | Decrease | Disease | No Change | ||
| S97 | OXA-58 | Q2K | Decrease | Decrease | Neutral | No Change |
| G4S | Decrease | Decrease | Neutral | No Change | ||
| I61M | Decrease | Decrease | Disease | No Change | ||
| A62L | Decrease | Decrease | Disease | No Change | ||
| S98 | OXA-58 | A60L | Decrease | Decrease | Disease | No Change |
| I59M | Decrease | Decrease | Disease | No Change | ||
| S121K | Decrease | Increase | Neutral | No Change | ||
| V181I | Increase | Decrease | Neutral | No Change | ||
| S67 | OXA-24 | M69L | Increase | Decrease | Neutral | No Change |
| Sample ID | Genes Detected | Rifampicin | Colistin | Azithromycin | Meropenem |
|---|---|---|---|---|---|
| CLSI Breakpoint | R ≥ 4 μg | R ≥ 4 μg | R ≥ 32 μg | R ≥ 8 μg | |
| S-10 | OXA-23, OXA-51, and VIM | 128 | 2 | >256 | 64 |
| S-67 | OXA-23, OXA-24, OXA-51, and VIM | 128 | 2 | >256 | 64 |
| S-84 | OXA-51, OXA-58, and NDM-1 | 128 | 2 | >256 | 64 |
| S-96 | VIM, OXA-23, OXA-58, and OXA-51 | 128 | 2 | >256 | 64 |
| S-97 | OXA-51, OXA-58, and VIM | 128 | 2 | >256 | 64 |
| S-98 | VIM, OXA-58, OXA-51, and OXA-23 | 128 | 2 | >256 | 64 |
| Antimicrobial Combinations | Synergy | Partial Synergy | Indifference | Antagonism |
|---|---|---|---|---|
| FICI Index | ≤0.5 | 0.5–1 | ≥1–<4 | ≥4 |
| MEM combined with CT | - | - | S-10, S-67, S-84, S-96, S-97, and S-98 | - |
| MEM combined with RIF | - | - | S-10, S-67, S-84, S-96, S-97, and S-98 | - |
| MEM combined with AZM | - | - | S-10, S-67, S-84, S-96, S-97, and S-98 | - |
| AZM combined with CT | - | - | S-10, S-67, S-84, S-96, S-97, and S-98 | - |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Ijaz, S.; Ansari, F.; Nawaz, M.; Ejaz, H.; Anjum, A.A.; Saeed, A.; Ali, T.; Rehman, O.U.; Fatima, E.; Ijaz, T. Genomic Insights into and In Vitro Evaluation of Antimicrobial Combination Therapies for Carbapenem-Resistant Acinetobacter baumannii. Medicina 2024, 60, 1086. https://doi.org/10.3390/medicina60071086
Ijaz S, Ansari F, Nawaz M, Ejaz H, Anjum AA, Saeed A, Ali T, Rehman OU, Fatima E, Ijaz T. Genomic Insights into and In Vitro Evaluation of Antimicrobial Combination Therapies for Carbapenem-Resistant Acinetobacter baumannii. Medicina. 2024; 60(7):1086. https://doi.org/10.3390/medicina60071086
Chicago/Turabian StyleIjaz, Saadia, Farheen Ansari, Muhammad Nawaz, Hasan Ejaz, Aftab Ahmad Anjum, Aqib Saeed, Tehreem Ali, Obaid Ur Rehman, Eeshal Fatima, and Tayyaba Ijaz. 2024. "Genomic Insights into and In Vitro Evaluation of Antimicrobial Combination Therapies for Carbapenem-Resistant Acinetobacter baumannii" Medicina 60, no. 7: 1086. https://doi.org/10.3390/medicina60071086
APA StyleIjaz, S., Ansari, F., Nawaz, M., Ejaz, H., Anjum, A. A., Saeed, A., Ali, T., Rehman, O. U., Fatima, E., & Ijaz, T. (2024). Genomic Insights into and In Vitro Evaluation of Antimicrobial Combination Therapies for Carbapenem-Resistant Acinetobacter baumannii. Medicina, 60(7), 1086. https://doi.org/10.3390/medicina60071086

