Abstract
Karyopherins, carrier proteins that recognize particular cargo protein patterns known as nuclear localization signals (NLSs), mediate the nuclear translocation of big proteins. In order to better understand the process of nuclear transport of proteins and create the groundwork for the development of innovative treatments that specifically target importins, it is imperative to clarify the intricate interactions between nuclear transporters and their cargo proteins. Until recently, very few NLSs have been documented. In the current work, an in silico method was used to identify NLSs for importin 8. It was determined that the sequence RRKLPVGRS serves as a recognition motif for importin 8 binding a karyopherin that is involved in the nuclear transportation of several important proteins like AGOs, SMADs, RPL23A, and TFE3. The sequence was validated in vitro in the breast cancer cell line T47D. This work subscribes to the effort to clarify the intricate relationships between nuclear transporters and their cargo proteins, in order to better understand the mechanism of nuclear transport of proteins and lay the groundwork for the development of novel therapeutics that target particular importins and have an immediate translational impact.
1. Introduction
Accurate cellular compartmentalization is essential to life in eukaryotic cells and a key component of their physiology is the shuttling of nucleo-cytoplasmic proteins [,,]. Large proteins must be imported into the nucleus through aided cytoplasmic-nuclear exchange, which is mediated by specialized protein carriers, while small proteins and peptides may translocate through the nuclear pore by passive diffusion []. These transporters, known as karyopherins, are a family of at least 20 different proteins that belong to three different classes: importins, involved in cytoplasmic-nuclear trafficking; exportins, which are in charge of translocating nucleo-cytoplasmic proteins through the nuclear pore; and adaptor proteins, frequently required for the formation of the importin-cargo protein complex [,].
The small Ras-related GTPase Ran, which regulates importin-cargo complex construction and disassembly, is essential to importin-mediated nuclear transport []. The GTP- versus GDP-bound forms of Ran in the cytoplasm and nucleus dictate the way of nuclear-cytoplasmic transport [,]. Importin-cargo complexes are bound by Ran-GDP, which controls their cytoplasmic-nuclear transport [,]. Once inside the nucleus, the exchange of GDP with GTP controls the release of the transferred protein [,,], which therefore regulates large protein transport to the nucleus and importin shuttle-tailing [,].
The Nuclear Localization Signal (NLS) is the recognition motif found in cargo proteins that allows them to attach to importins [,]. Until recently, only a few NLS motifs for importin α (IMPOα) and the M9 NLS (recognized by importin β2, also known as transportin) have been identified, despite significant scientific efforts [,,,,,,]. A great deal of work went into identifying NLS sequences in a growing number of proteins, creating online tools to predict these motifs, and eventually predicting the nuclear translocation of proteins via the RanGDP–Importin α–Importin β (IMPOβ) system [,,,,], which led to the development of particular medications [,,,]. Recently, the sequence EKRKI(E/R)(K/L/R/S/T) has been advanced as a recognition motif for binding with importin 7 through the use of a bio-informatics approach, based on bibliographic data, simulation, and experimental in vitro validation [], while the sequences LPPRS(G/P)P and KP(K/Y)LV [] were identified as recognition motifs for importins 4 and 5. Here, using a similar methodology, we report the sequence RRKLPVGRS as the recognition motif for importin 8. The importance of our research is in the identification of importin 8 as a key transporter that is involved in the nuclear import of certain proteins. Importin 8 differs from other importins in its cargo selectivity and biological functions []. In the present study, we present initial evidence that it mediates the nuclear import of functionally heterogeneous and clinically important proteins such as Argonaute proteins, SMADs, and zinc finger proteins []. The results of this study enhance the knowledge of nuclear transport mechanisms and may be relevant to therapeutic approaches targeting importin 8-mediated processes. Identification of RRKLPVGRS as an importin 8 recognition signal is a novel contribution, adding to the list of known NLS sequences and contributing to new knowledge on the molecular importin 8-mediated nuclear transport process.
2. Results
2.1. In Silico Characterization of Importin 8 NLSs
For the detection of importin 8 NLSs, we used the proteins AGO1 (Protein argonaute-1) [,,,,,], AGO2 (Protein argonaute-2) [,,,,,], AGO3 (Protein argonaute-3) [,,], AGO4 (Protein argonaute-4) [,,,], RPL23A (Large ribosomal subunit protein uL23) [,], SMAD1 (Mothers against decapentaplegic homolog 1) [,,], SMAD3 (Mothers against decapentaplegic homolog 3) [,,], SRP19 (Signal recognition particle 19 kDa protein) [,,], TFE3 (Transcription factor E3) [,,,], WT1 (Wilms tumor protein) [,,], ZFP2 (Zinc finger protein ZFP2) [], ZNF264 (Zinc finger protein 264) [], and ZNF774 (Zinc finger protein 774) [], previously reported to interact with importin 8 (Table 1).
The structures of the proteins were retrieved from the AlphaFold database (https://alphafold.ebi.ac.uk/, accessed on 2 May 2024) []. A comparison of the recently reported AlphaFold structures used here for binding with importin 8 with their previously reported crystal structures (Supplemental Table S1) [] confirms the correct conformation of the 3D prediction we have used here.
As shown in Figure 1A, importin 8 interacted with the cargo proteins at amino acids 650–750, whereas it bound to the small GTPase Ran at amino acids 50–150. After importin binding to the previously listed proteins (found using the HEX 8.0.8 tool), the interacting amino acids were extracted, and are shown in Table 1.
Figure 1A provides a specific illustration of importin 8 binding to AGO1, and Supplemental Figure S1 displays importin 8 interaction with all aforementioned proteins. We found the minimal sequence that each protein uses to interact with importin 8 (Figure 1B and Supplemental Figures S2–S14) by recursively removing one amino acid at a time from the N- or C-terminal of the identified importin interacting peptide (see Section 4 and Ref. [] for details).
The alignment of all identified motifs (Figure 1C) revealed the common sequence RRKLPVGRS as the NLS for importin 8 (Figure 1C), the deletion of which significantly reduces the protein–importin 8 binding affinity (Figure 1B). Figure 1D displays its three-dimensional configuration.
It is interesting to note that molecular docking study according to the above methodology (Supplemental Figure S15) showed that valine and glycine at positions 6 and 7, respectively, do not directly interfere with the binding of the cargo protein; however, their deletion results in a weaker binding to Importin 8. Nevertheless, as determined by in silico mutagenesis and alanine replacement, it appears that the presence of Leucine at position 4 interacts with and stabilizes the conformation of the NLS-related amino acids (particularly lysine and proline, at positions 3–5 of the NLS sequence).
Table 1.
Proteins interacting with Importin 8. The protein short names, their AlphaFold codes, the corresponding references, the in silico predicted amino acid sequences interacting with importin 8, and the related Gibbs free energy changes (ΔG) of the interaction, are reported.
Table 1.
Proteins interacting with Importin 8. The protein short names, their AlphaFold codes, the corresponding references, the in silico predicted amino acid sequences interacting with importin 8, and the related Gibbs free energy changes (ΔG) of the interaction, are reported.
| Cargo Protein | AlphaFold Code | References | Interacting Amino Acids | ΔG (Kcal/mol) |
|---|---|---|---|---|
| AGO1 | AF-Q9UL18-F1 | [] | 181SPPEGYYHPLGGGREVWFGF200 | −442.91 |
| 228VIEFMCEVLDIRN240 | −298.03 | |||
| 336YLPLEVCNIVAGQRC350 | −590.03 | |||
| AGO2 | AF-Q9UKV8-F1 | [,] | 166MRHLPSMRYTPVGRSFFT183 | −1106.31 |
| 185SEGCSNPLGGGREVWF200 | −470.15 | |||
| 380SKLMRSASFNTDPYVRE396 | −974.05 | |||
| AGO3 | AF-Q9H9G7-F1 | [] | 186PEGYDHPLGGGREVW200 | −302.12 |
| 359DNQTSTMIKAT369 | −446.97 | |||
| 373APDRQEEISRLVRSA387 | −592.07 | |||
| AGO4 | AF-Q9HCK5-F1 | [] | 162MRYTPVGRSF171 | −855.04 |
| 175PEGYYHPLGGG185 | −350.66 | |||
| 362APDRQEEISRLVKSNSMVGGPDPYLKE388 | −628.82 | |||
| RPL23A | AF-P62750-F1 | [] | 10PAPPKAEAKAKALKAKKAVLKGVHSHKKKK39 | −2127.57 |
| SMAD1 | AF-Q15797-F1 | [] | 187SPNSSYPNSPGSSS199 | −609.18 |
| SMAD3 | AF-P84022-F1 | [] | 251SQPSMTVDGFTDPSNSERFCLGL273 | −352.31 |
| SRP19 | AF-P09132-F1 | [] | 45TATEIQDVCSA55 | −226.35 |
| 63EKNKMYSREWNRDVQYRGRVRV84 | −1307.71 | |||
| 111MIPKLKTRTQKTGGAD126 | −1125.31 | |||
| TFE3 | AF-P19532-F1 | [] | 173PREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPKLASQ214 | −1319.95 |
| WT1 | AF-P19544-F1 | [] | 1MGSDVRDLN9 | −380.46 |
| 58PAPPPPPPPPPHSFIK73 | −661.45 | |||
| 365SRSDQLKRHQRRHT378 | −1123.92 | |||
| ZFP2 | AF-Q6ZN57-F1 | [] | 322GVKPFECNECGKAFSKNSSLTQHRRIHTGEKPYECMVCGKHFTGRSSLTVHQVIHTGEKPYECNECGKAFSQ393 | −1439.80 |
| 418AFIKNSSLTV427 | −655.69 | |||
| ZNF264 | AF-O43296-F1 | [] | 169SRIGQEQVSPGDRVRSH185 | −714.25 |
| 201NNFKCSECGKVFNKKHLLAGHEKIHSGVKPYEC233 | −1203.69 | |||
| 236CGKTFIKSTHLLQHH250 | −853.09 | |||
| 327RPGFLRHYVVHS338 | −922.59 | |||
| ZNF774 | AF-Q6NX45-F1 | [] | 261KPYACLECHKS271 | −779.05 |
| 280THQRTHTGVKPY291 | −865.15 | |||
| 373RPFKCENC380 | −724.34 |
Figure 1.
In silico identification of the importin 8-NLS motif. (A) Protein argonaute-1 (AGO1) (orange) docking on the blue-colored RanGDP-IPO8 heteroprotein complex (cyan). For additional information, see results. Following structure optimizations in the GalaxyWEB server [,,], protein interactions were computed using the HEX 8.0.8 tool [,]. The UCSF Chimera program was used to create the image []. (B) Adjustment of the relationship between the AGO1-extracted peptide sequence and importin 8 (displayed in Table 1), calculated using HEX 8.0.8 [,], and presented as ΔG (Kcal/mol) values. The ΔG values of N-terminally shortened sequences are displayed in black curves, whereas the ΔG values of C-terminally truncated sequences are displayed in red curves. The NLS sequence prediction uses the retained peptide sequences, which are displayed in the black box. For more information, see the text. (C) Using the web tool Jalview, the minimum amino acid sequences (shown in (B) and Table 1) were aligned []. At the bottom is the consensus sequence that was retrieved. (D) A three-dimensional depiction of the minimal consensus sequence identified as an importin 8-NLS recognition motif.
2.2. In Vitro Validation of RRKLPVGRS Sequence as the Importin 8 NLS
The in silico results for the NLS8 sequence were validated in vitro. For this, we constructed a plasmid that expressed the enhanced green fluorescent protein (EGFP) and had the NLS8 sequence attached to the protein’s C-terminus. We transfected T47D breast cancer cells which express importin 8 at high levels (MDA-MB-231 breast cancer cells and DU-145 prostate cancer cells had lower expression; Supplemental Figure S16), and observed EGFP cytoplasmic to nuclear presence by confocal microscopy (Figure 2). Confocal images clearly show a specific high EGFP fluorescence in the nucleus with the EGFP-NLS8 that is significantly reduced when importin 8 is knocked down with specific siRNAs (Supplemental Figure S17) (Figure 2A for representative confocal images and Figure 2B for the quantitation of nuclear and cytoplasmic staining).
Figure 2.
(A) Representative confocal pictures of T47D cells transfected with plasmid expressing the EGFP-NLS8 fusion (EGFP-NLS8), which is recognized by importin 8, in the presence of either a specific siRNA for importin 8 (IPO8) or a negative control siRNA. Nuclei were stained with DAPI (blue). Magnification 400×. (B) Mean fluorescence intensity in the nucleus and cytoplasm was quantified (see Section 4 for details) in at least 30 images with approximately 40 cells, per condition, and is given as the Nucleus/Cytoplasm fluorescence ratio. ** denotes statistical significance p < 0.01.
3. Discussion
Nuclear import is a very selective process, based on particular import signals [,]. With a few notable exceptions, nuclear import signals are usually short sequences of amino acids that are located in the relevant protein’s DNA or RNA binding regions [,,,]. However, not much progress has been made in identifying other importin recognition signals, other than from importin α [,] and the M9 (transportin) NLS [,,]. Here, we present the sequence RRKLPVGRS as a recognition site for importin 8, using the same in silico methodology followed by in vitro validation that we have previously applied for the identification of the NLS sequences for importin 4 ((L)PPRS(G/P)P), 5 (KP(K/Y)LV), and 7 (EKRKI(E/R)(K/L/R/S/T)) [,], with the latter also being verified by another group []. Here, we propose the sequence RRKLPVGRS as the protein recognition motif (NLS) for protein interactions with importin 8 (IPO8).
The identified importin 8 NLS mainly consists of polar amino acids like arginine, lysine, and serine; non-polar hydrophobic amino acids such as leucine; and aliphatic non-polar amino acids like valine. Additionally, it includes neutral amino acids like proline and glycine. As shown, this amino acid distribution suggests that the IPO8-NLS binding site recognizes polar sequences partially charged. It is worth noting that the NLS8 sequence shows binding selectivity to importin 8, because in corresponding in silico experiments, it was shown that its binding energy reached ΔG = −806.7 Kcal/mol, in contrast to importins α, β, 4, 5, 7, 9, 11, and 13, which showed no stable binding (ΔG > −250 Κcal/mol).
A structural analysis of NLSs allows us to understand the differences on the surface of importins. The presence of different positively charged amino acids at various positions may affect the interaction with the transported cargo, as well as the resistance or preference towards specific molecules or complexes. Indeed, NLS8 (RRKLPVGRS) contains a series of positively charged amino acids, such as arginine (R) and lysine (K), as well as a proline (P) residue, which appears to be characteristic of importin 8. This arrangement may affect the interaction with RNA–protein complexes, as reported in our study. NLS7 (EKRKI(E/R)(K/L/R/S/T)) contains a sequence that is more flexible due to multiple choices for the amino acid position at the end (E/R, K/L/R/S/T), which provides greater variety in the composition of the NLS. NLS4 (LPPRS(G/P)P) and NLS5 (KP(K/Y)LV) have fewer interactive characteristics than NLS8, with fewer positively charged amino acids and a more restricted sequence. The NLSα (KKKRK) is characteristic of many importins, with the presence of the positively charged KKKRK, which is often recognized by the transport system. The arrangement of positive amino acids (such as lysine and arginine) in NLSs can influence electrostatic interactions with the corresponding recognition protein systems. NLS8, as reported here, contains a denser cluster of positive charges, which may be important for the recognition of charges associated with small RNAs and protein complexes. In contrast, NLSα, which is used by many importins, has a more common electrostatic characteristic arrangement that may favor general charge recognition.
The proposed sequence of RRKLPVGRS as the protein recognition motif (NLS) for protein interactions with importin 8 (IPO8) was validated in vitro by using an EGFP protein construct containing in its C-terminal the proposed recognition sequence. Knocking down IPO8 with a specific siRNA, EGPF-NLS for importin 8 fluorescence in the nucleus was decreased, verifying the specificity of the proposed NLS sequence for IPO8.
We consider that this discovery might be of importance, as this karyopherin is implicated in major processes. IPO8, being a member of the importins family, plays an important role in transporting proteins into the cell nucleus [,]. More specifically, importin 8 functions as a receptor that recognizes and binds nuclear import sequence (NLS)-containing proteins, facilitating their passage through the nuclear pore and entry into the nucleus []. Additionally, IPO8 has unique characteristics that distinguishes it from other importins []. Among these are its involvement in the regulation of transcription and RNA processing, as well as the transport of specific regulatory proteins and RNA macromolecules []. For example, IPO8 has been found to be involved in the transport of complexes of small RNA molecules (miRNAs)—proteins involved in the regulation of gene expression []. While RNA molecules have negatively charged phosphate groups, the positively charged NLS of IPO8 likely facilitates the binding of IPO8 to other components of the RNA–protein complex, such as the associated regulatory proteins. This probably allows IPO8 to transport these complexes, rather than binding RNA directly.
Importin 8 mediates the nuclear import of several important proteins. Argonaute proteins 1–4 (AGO1–AGO4) [] play a crucial role in gene expression regulation through RNA-mediated gene silencing and regulation by microRNA and small interfering RNA []. Argonaute proteins bind and target small RNAs, forming RNA–protein complexes known as RISCs, which recognize and bind target mRNA with complementary sequences []. After binding, Argonaute proteins can repress gene expression through degrading the target mRNA, suppressing translation, or inducing epigenetic modifications []. Argonaute proteins are essential for gene regulation, cell differentiation, growth, and defense against viruses []. RPL23A is a ribosomal component essential for protein biosynthesis, with mutations leading to disorders like anemia and cancer []. SMAD1 and SMAD3 mediate TGF-β (Transforming Growth Factor-beta) [] signaling, influencing cell growth, differentiation, and apoptosis []. Mutations in SMAD3 are linked to Loeys–Dietz Syndrome, an inherited connective tissue disorder []. SRP19 is involved in the transport of newly synthesized proteins to the endoplasmic reticulum, with disturbances causing protein aggregation and organ dysfunction []. TFE3 regulates genes involved in autophagy and cell growth, with mutations associated with kidney cancer and Alveolar Soft Part Sarcoma (ASPS) []. WT1 is crucial for kidney and genital development, with mutations causing cancers like Wilms tumors and genital dysgenesis [,]. ZFP2 [] and ZNF264 [] are zinc finger proteins regulating gene expression; their dysfunctions can cause developmental abnormalities and cancer. ZNF774, another zinc finger protein, is linked to cell growth and neurological disorders when its function is disturbed [].
Our method, which is comparable to the one previously described for the discovery of recognition signals for importins 4, 5 [], and 7 [], was verified by contrasting the anticipated cargo protein structures with those obtained by an independent approach (AlphaFold []) (see Supplemental Table S1).
It is well known that importins’ binding to the small GTPase Ran is what causes importin complexes to form containing cargos such proteins, RNAs, or RNPs intended for nuclear import [,,,,]. The direction of importins’ movement—toward or out of the nucleus—is determined by the interaction between the GDP- and GTP-bound forms of Ran, bound to importins [,,,,].
IPO8 [,] has been reported to interact with Ran, which is indispensable for its action. Also, we have simulated Ran-GDP interaction with IPO8 (Figure 1A), in view of the 3D prediction of the structure of the importin, bound to Ran-GDP. As expected for protein-protein interactions, the ΔG value was very high (ΔG = −2625.2 Kcal/mol), suggesting a rather stable interaction. Ran-GDP interacts with importins with similar binding affinities, as evidenced by comparisons of its interactions with importin β [], importin 7 [], importin 4 [], importin 5 [], and here, importin 8. However, more experimental research is required to validate the stability of the proposed complex.
Although our research is strong evidence that RRKLPVGRS is a novel nuclear localization signal for importin 8, we recognize some limitations in our method. Computer docking programs like HEX 8.0.8 are useful for providing information about protein–protein interactions; however, they are limited in their accuracy. Different docking programs can provide variation in the prediction of binding affinity. Despite this, the in vitro confirmation of our predicted NLS validates the integrity of our results and highlights the importance of using complementary techniques to study nuclear import mechanisms.
4. Materials and Methods
4.1. Bioinformatics Methods for Identification of the Ιmportin 8 NLS Sequence
Our group previously released an extensive description of the bio-informatics approaches developed to identify NLS motifs on cargo proteins []. In summary, the steps mentioned below were carried out.
4.1.1. Selection and Generation of PDB Files
Protein sequences were imported into the Swiss Model Biospace (https://swissmodel.expasy.org/interactive, accessed on 2 May 2024) after being obtained in FASTA format from the NCBI protein database (https://www.ncbi.nlm.nih.gov/protein/, accessed on 2 May 2024) []. Protein databank (https://www.rcsb.org/, accessed on 2 May 2024) codes for the proteins were obtained []. The predicted model or models with 100% homology were the only ones retained. Small compounds that co-crystallized with the receptor in the single receptor crystal model were manually extracted from the PDB files using a text editor. The best model from the Swiss Model Biospace (https://swissmodel.expasy.org/interactive, accessed on 4 May 2024) was retained for proteins whose crystallized structures were unavailable []. This decision was made based on the sequence coverage homology (at least 70%) with a protein that has already been published. Structural templates were retrieved from the Protein Data Bank (PDB) without excluding NMR-derived structures, provided they met the criteria of sufficient sequence coverage (≥70%) and structural resolution appropriate for docking analyses.
Protein files (in PDB format) were refined in a fully flexible conformation and submitted to the Galaxy Refine server (https://galaxy.seoklab.org/, accessed on 6 May 2024; Routine REFINE) [,,]. Using molecular dynamics simulations as a guide, REFINE reconstructs and optimizes the structure of side chains, secondary structural components, and loops [].
The recently released AlphaFold database was compared with the 3D conformation of proteins []. To further evaluate the correctness of the predicted cargo protein structures, we compared the completed models derived using SwissModel and GalaxyRefine to the corresponding structures in the AlphaFold database. This extra validation was an independent verification of the overall fold and the accessibilities of critical surface regions that contribute to importin 8 binding. This cross-validation exercise enhanced our level of confidence in the structural compatibility of the identified NLS motifs and importin 8 binding interface. Whenever possible, Chimera software, version 1.14 (https://www.cgl.ucsf.edu/chimera/, accessed on 8 May 2024), was used to compare the flexible retained model with known crystals and AlphaFold published structures []. The three-dimensional structural differences were computed using Root Mean Square Differences (RMSDs) in Å for both individual areas and the entire molecule.
4.1.2. Flexible Refined Solutions of Proteins Models
The Galaxy server’s LigDock and GalaxyHeteromer routines were used to perform Ran-GDP complex and importin 8 complex with Ran-GDP. The REFINE routine at the Galaxy server was used to refine the retained change in Gibbs free energy (ΔG) values. LigDock predicts the 3D structure for protein-ligand complexes, while GalaxyHeteromer uses template-based and ab initio docking to make 3D structure predictions for protein–protein complexes [,,]. Both for importin and cargo proteins, the interaction (binding) interface was found, and the matching amino acids were obtained from the returned data. Using the GalaxyWeb server and routine TBM, the interacting amino acid structures in 3D for Importin 8 were modeled.
4.1.3. Protein–Protein Binding Simulations
The interacting cargo protein sequence was also modeled in GalaxyWeb (routine TBM), and the Hex 8.0.8 program (https://hex.loria.fr/, accessed on 10 May 2024), in PDB format, was used to execute the (rigid) binding of the sequence [,]. The value of ΔG, or the change in Gibbs free energy, was obtained and documented. Following the removal of one amino acid from either the N- or C-terminus of each peptide (and reconstructing the remaining peptide in GalaxyWeb), the binding of the retained cargo sequences was repeated.
Following the final step of the process, ΔG graphs were generated for each docking simulation. Amino acids were retained as part of the proposed NLS if their removal led to a sharp increase in ΔG (>50 Kcal/mol), indicating their critical contribution to the stability of the importin 8-cargo complex (see Section 2 and Supplemental Material for specific examples).
4.1.4. Peptide Sequence Alignment
Using the online resource Jalview (https://www.jalview.org, accessed on 26 May 2024), we finally aligned all of the preserved peptide sequences and obtained the consensus sequence for the binding of importin 8 [].
4.2. In Vitro Methods for Validation of Ιmportin 8 NLS Sequence
4.2.1. Cell Culture and Materials
The cell line T47D (purchased from DSMZ, Braunschweig, Germany) was cultured in RPMI-1640 (Gibco™, Thermo Fisher Scientific, Waltham, MA, USA) supplemented with 10% Fetal Bovine Serum and 1% penicillin-streptomycin (Qualified, Gibco™, Thermo Fischer Scientific), at 37 °C and 5% CO2. The selection of the T47D cell line was made as it has a high level of IPO8 (Importin 8) gene expression, as determined by real-time qPCR and The Human Protein Atlas Database (https://www.proteinatlas.org/, accessed on 17 October 2024). All media were purchased from Fisher Scientific (part of Thermo Fisher Scientific, Hampton, NH, USA), and all chemicals from Sigma (St. Louis, MO, USA), unless otherwise stated.
4.2.2. Preparation of GFP-NLS8 Plasmid
The putative importin 8 recognition sequence, i.e., RRKLPVGRS, was fused to the carboxy-terminus of EGFP (EGFP-NLS8) using a process similar to that described in our previous publications [,]. Specifically, two oligonucleotides encoding the sequence of the putative NLS8 were synthesized and annealed in vitro, as previously described. The sequences of the two oligonucleotides were as follows: NLS8-corF: 5′-tcgaAGAAAGCTGCCTGTGGGCAGAAGCG-3′ and rNLS8: 5′-gatcCGCTTCTGCCCACAGGCA-GCTTTCT-3′, and they were designed in such a way as to generate single-stranded overhangs following their annealing that would allow for directional cloning in vectors digested with the XhoI and BamHI restriction endonucleases. Note that these restriction enzyme site-compatible overhang sequences are in small letters. The annealed oligonucleotides carrying XhoI and BamHI overhangs were ligated with plasmid pEGFP-C1 (Clontech) that had been digested with XhoI/BamHI to generate plasmid pEGFP-C1-NLS8. The sequence of pEGFP-C1-NLS8, which expresses the putative NLS8 oligopeptide fused to the carboxy-terminus of EGFP, was verified by sequence analysis (CeMIA SA).
4.2.3. Cell Transfection for GFP-NLS8 and IPO8 Silencing
Cells were seeded and incubated for 24 h at 37 °C, at an initial of 35 × 105 cells/well in a 6-well plate, or 35 × 103 cells/chamber in an 8-chamber slide. The specific plasmid pEGFP-NLS8 that expresses the RRKLPVGRS sequence (NLS8) was co-transfected using Attractene Transfection Reagent (QIAGEN, Hilden, Germany), with specific siRNAs (2 μg siRNA, 0.10 μg plasmid and 0.60 μL Attractene Transfection Reagent/104 cells) for IPO8 (ID: 17813, Ambion, Thermo Fisher Scientific, Waltham, MA, USA) or negative control siRNAs (ID: 149,158 Silencer Select Negative Control #1 siRNA 4390843, Ambion, Thermo Fisher Scientific, Waltham, MA, USA). After 24 h, fresh medium was added, and, after another 24 h, cells were collected and analyzed with real time qPCR (plates) or fixed with 4% paraformaldehyde in PBS for 10 min (chamber slides).
4.2.4. RNA Isolation and Real-Time PCR
In order to evaluate the transfection efficiency of siRNA, the total IPO8 gene expression was determined through real-time qPCR. Total cell RNA was isolated with the RNA isolation Kit (Nucleospin, Macherey-Nagel, Düren, Germany), cDNA, synthesized using the PrimeScript™ RT Kit (TaKaRa Bio Inc., Kusatsu, Shiga, Japan), and real-time PCR was performed using the KAPA SYBR FAST qPCR Master Mix (Kapa Biosystems, Inc., Wilmington, MA, USA) as previously described []. The following primer pairs (synthesized by Eurofins Genomics, Ebersberg, Germany) were used (5′->3′): forward AGGATCAGAGGACAGCACTGCA and reverse AGGTGAAGCCTCCCTGTTGTTC.
4.2.5. Quantification of Nuclear Translocation
The cells co-transfected with GFP-NLS8 and siRNA for IPO8 or negative control siRNA were observed under a confocal microscope (SP8 LIGHTNING Confocal Microscope, Leica Microsystems, Wetzlar, Germany), and representative images were obtained. The fluorescence intensity ratio in the nucleus and the cytoplasm was quantified using ImageJ 1.54 software (Madison, WI, USA, https://imagej.nih.gov/, accessed on 15 January 2025). For each image, the nuclear area was determined in the blue channel of the RGB color system by setting the appropriate threshold area, and the mean fluorescence of the nucleus or cytoplasm was then measured in the green channel. At least 10 images with approximately 40 cells per condition, for three independent experiments, were analyzed. GraphPad Prism 8.0.1 (GraphPad Software Inc., San Diego, CA, USA) was used for statistical analysis. Τhe analysis was parametric and was displayed as mean ± SEM. p-values < 0.05 were considered statistically significant.
5. Conclusions
In conclusion, the present study highlights the critical RRKLPVGRS recognition motif of importin 8 (IPO8), which localizes to cargo proteins and plays a key role in their transport to the nucleus and their function there. Identification of this importin 8-specific NLS opens the way for future investigations into the development of targeted therapeutic interventions. Indeed, the importin 8-cargo interface could be an appealing target for small molecule- or peptide-based inhibitors in diseases in which importin 8 and its cargo proteins are implicated, including cancer and developmental disorders. This study stresses the necessity of a systematic mapping of NLS sequences among the importin family, as all importins have particular cargo affinities and biological roles. Our findings offer a pragmatic starting point for further endeavors to untangle the whole repertoire of importin–cargo relationships and to investigate their therapeutic potential.
Supplementary Materials
The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms26062814/s1.
Author Contributions
A.A.P.: Conceptualization, Methodology, Investigation, Writing—Review and Editing; K.K.: Investigation; A.A.: Investigation; D.D.: Investigation; C.A.P.: Validation, Investigation, Writing—Review and Editing; M.K.: Validation, Writing—Review and Editing; E.C.: Validation, Writing—Review and Editing. All authors have read and agreed to the published version of the manuscript.
Funding
This research received no external funding.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
All data and analysis are available within the manuscript and the Supplementary Materials, or upon request to the corresponding authors.
Conflicts of Interest
There are no conflicts of interest to declare.
References
- Çağatay, T.; Chook, Y.M. Karyopherins in cancer. Curr. Opin. Cell Biol. 2018, 52, 30–42. [Google Scholar] [CrossRef] [PubMed]
- Görlich, D.; Mattaj, I.W. Nucleocytoplasmic Transport. Science 1996, 271, 1513–1519. [Google Scholar] [CrossRef]
- Fontes, M.R.M.; Teh, T.; Kobe, B. Structural basis of recognition of monopartite and bipartite nuclear localization sequences by mammalian importin-α11Edited by K. Nagai. J. Mol. Biol. 2000, 297, 1183–1194. [Google Scholar] [CrossRef] [PubMed]
- Conti, E. Structures of importins. Results Probl. Cell Differ. 2002, 35, 93–113. [Google Scholar] [CrossRef] [PubMed]
- Güttler, T.; Görlich, D. Ran-dependent nuclear export mediators: A structural perspective. EMBO J. 2011, 30, 3457–3474. [Google Scholar] [CrossRef]
- Lonhienne, T.G.; Forwood, J.K.; Marfori, M.; Robin, G.; Kobe, B.; Carroll, B.J. Importin-β Is a GDP-to-GTP Exchange Factor of Ran: Implications for the Mechanism of Nuclear Import. J. Biol. Chem. 2009, 284, 22549–22558. [Google Scholar] [CrossRef]
- Moore, M.S.; Blobel, G. A G protein involved in nucleocytoplasmic transport: The role of Ran. Trends Biochem. Sci. 1994, 19, 211–216. [Google Scholar] [CrossRef]
- Soniat, M.; Chook, Y.M. Nuclear localization signals for four distinct karyopherin-β nuclear import systems. Biochem. J. 2015, 468, 353–362. [Google Scholar] [CrossRef]
- Chook, Y.M.; Süel, K.E. Nuclear import by karyopherin-βs: Recognition and inhibition. Biochim. Biophys. Acta (BBA) Mol. Cell Res. 2011, 1813, 1593–1606. [Google Scholar] [CrossRef]
- Kalderon, D.; Richardson, W.D.; Markham, A.F.; Smith, A.E. Sequence requirements for nuclear location of simian virus 40 large-T antigen. Nature 1984, 311, 33–38. [Google Scholar] [CrossRef]
- Kalderon, D.; Roberts, B.L.; Richardson, W.D.; Smith, A.E. A short amino acid sequence able to specify nuclear location. Cell 1984, 39, 499–509. [Google Scholar] [CrossRef] [PubMed]
- Iijima, M.; Suzuki, M.; Tanabe, A.; Nishimura, A.; Yamada, M. Two motifs essential for nuclear import of the hnRNP A1 nucleocytoplasmic shuttling sequence M9 core. FEBS Lett. 2006, 580, 1365–1370. [Google Scholar] [CrossRef]
- Izaurralde, E.; Jarmolowski, A.; Beisel, C.; Mattaj, I.W.; Dreyfuss, G.; Fischer, U. A Role for the M9 Transport Signal of hnRNP A1 in mRNA Nuclear Export. J. Cell Biol. 1997, 137, 27–35. [Google Scholar] [CrossRef] [PubMed]
- Bogerd, H.P.; Benson, R.E.; Truant, R.; Herold, A.; Phingbodhipakkiya, M.; Cullen, B.R. Definition of a Consensus Transportin-specific Nucleocytoplasmic Transport Signal*. J. Biol. Chem. 1999, 274, 9771–9777. [Google Scholar] [CrossRef]
- Terry, L.J.; Shows, E.B.; Wente, S.R. Crossing the Nuclear Envelope: Hierarchical Regulation of Nucleocytoplasmic Transport. Science 2007, 318, 1412–1416. [Google Scholar] [CrossRef] [PubMed]
- Robbins, J.; Dilwortht, S.M.; Laskey, R.A.; Dingwall, C. Two interdependent basic domains in nucleoplasmin nuclear targeting sequence: Identification of a class of bipartite nuclear targeting sequence. Cell 1991, 64, 615–623. [Google Scholar] [CrossRef]
- Miyamoto, Y.; Yamada, K.; Yoneda, Y. Importin α: A key molecule in nuclear transport and non-transport functions. J. Biochem. 2016, 160, 69–75. [Google Scholar] [CrossRef]
- Freitas, N.; Cunha, C. Mechanisms and Signals for the Nuclear Import of Proteins. Curr. Genom. 2009, 10, 550–557. [Google Scholar] [CrossRef]
- Marfori, M.; Mynott, A.; Ellis, J.J.; Mehdi, A.M.; Saunders, N.F.W.; Curmi, P.M.; Forwood, J.K.; Bodén, M.; Kobe, B. Molecular basis for specificity of nuclear import and prediction of nuclear localization. Biochim. Biophys. Acta (BBA)-Mol. Cell Res. 2011, 1813, 1562–1577. [Google Scholar] [CrossRef]
- Adam, S.A. Transport pathways of macromolecules between the nucleus and the cytoplasm. Curr. Opin. Cell Biol. 1999, 11, 402–406. [Google Scholar] [CrossRef]
- Seidel, M.; Romanov, N.; Obarska-Kosinska, A.; Becker, A.; Trevisan Doimo de Azevedo, N.; Provaznik, J.; Nagaraja, S.R.; Landry, J.J.M.; Benes, V.; Beck, M. Co-translational binding of importins to nascent proteins. Nat. Commun. 2023, 14, 3418. [Google Scholar] [CrossRef] [PubMed]
- Dickson, C.F.; Hertel, S.; Tuckwell, A.J.; Li, N.; Ruan, J.; Al-Izzi, S.C.; Ariotti, N.; Sierecki, E.; Gambin, Y.; Morris, R.G.; et al. The HIV capsid mimics karyopherin engagement of FG-nucleoporins. Nature 2024, 626, 836–842. [Google Scholar] [CrossRef]
- Vogel, O.A.; Forwood, J.K.; Leung, D.W.; Amarasinghe, G.K.; Basler, C.F. Viral Targeting of Importin Alpha-Mediated Nuclear Import to Block Innate Immunity. Cells 2023, 13, 71. [Google Scholar] [CrossRef]
- Bhambid, M.; Dey, V.; Walunj, S.; Patankar, S. Toxoplasma Gondii Importin α Shows Weak Auto-Inhibition. Protein J. 2023, 42, 327–342. [Google Scholar] [CrossRef] [PubMed]
- Panagiotopoulos, A.A.; Polioudaki, C.; Ntallis, S.G.; Dellis, D.; Notas, G.; Panagiotidis, C.A.; Theodoropoulos, P.A.; Castanas, E.; Kampa, M. The sequence [EKRKI(E/R)(K/L/R/S/T)] is a nuclear localization signal for importin 7 binding (NLS7). Biochim Biophys. Acta Gen. Subj. 2021, 1865, 129851. [Google Scholar] [CrossRef]
- Panagiotopoulos, A.A.; Kalyvianaki, K.; Tsodoulou, P.K.; Darivianaki, M.N.; Dellis, D.; Notas, G.; Daskalakis, V.; Theodoropoulos, P.A.; Panagiotidis, C.A.; Castanas, E.; et al. Recognition motifs for importin 4 [(L)PPRS(G/P)P] and importin 5 [KP(K/Y)LV] binding, identified by bio-informatic simulation and experimental in vitro validation. Comput. Struct. Biotechnol. J. 2022, 20, 5952–5961. [Google Scholar] [CrossRef]
- Van Gucht, I.; Meester, J.A.N.; Bento, J.R.; Bastiaansen, M.; Bastianen, J.; Luyckx, I.; Van Den Heuvel, L.; Neutel, C.H.G.; Guns, P.J.; Vermont, M.; et al. A human importin-β-related disorder: Syndromic thoracic aortic aneurysm caused by bi-allelic loss-of-function variants in IPO8. Am. J. Hum. Genet. 2021, 108, 1115–1125. [Google Scholar] [CrossRef]
- Moradimotlagh, A.; Chen, S.; Koohbor, S.; Moon, K.M.; Foster, L.J.; Reiner, N.; Nandan, D. Leishmania infection upregulates and engages host macrophage Argonaute 1, and system-wide proteomics reveals Argonaute 1-dependent host response. Front. Immunol. 2023, 14, 1287539. [Google Scholar] [CrossRef]
- Li, W.; Liu, M.; Feng, Y.; Xu, Y.F.; Che, J.P.; Wang, G.C.; Zheng, J.H.; Gao, H.J. Evaluation of Argonaute protein as a predictive marker for human clear cell renal cell carcinoma. Int. J. Clin. Exp. Pathol. 2013, 6, 1086–1094. [Google Scholar]
- Kim, D.H.; Villeneuve, L.M.; Morris, K.V.; Rossi, J.J. Argonaute-1 directs siRNA-mediated transcriptional gene silencing in human cells. Nat. Struct. Mol. Biol. 2006, 13, 793–797. [Google Scholar] [CrossRef]
- Zhang, Q.; Higginbotham, J.N.; Jeppesen, D.K.; Yang, Y.P.; Li, W.; McKinley, E.T.; Graves-Deal, R.; Ping, J.; Britain, C.M.; Dorsett, K.A.; et al. Transfer of Functional Cargo in Exomeres. Cell Rep. 2019, 27, 940–954.e946. [Google Scholar] [CrossRef]
- Gómez Acuña, L.I.; Nazer, E.; Rodríguez-Seguí, S.A.; Pozzi, B.; Buggiano, V.; Marasco, L.E.; Agirre, E.; He, C.; Alló, M.; Kornblihtt, A.R. Nuclear role for human Argonaute-1 as an estrogen-dependent transcription coactivator. J. Cell Biol. 2020, 219, e201908097. [Google Scholar] [CrossRef]
- Jeppesen, D.K.; Fenix, A.M.; Franklin, J.L.; Higginbotham, J.N.; Zhang, Q.; Zimmerman, L.J.; Liebler, D.C.; Ping, J.; Liu, Q.; Evans, R.; et al. Reassessment of Exosome Composition. Cell 2019, 177, 428–445.e418. [Google Scholar] [CrossRef] [PubMed]
- Mori, R.; Tanaka, K.; Shimokawa, I. Identification and functional analysis of inflammation-related miRNAs in skin wound repair. Dev. Growth Differ. 2018, 60, 306–315. [Google Scholar] [CrossRef]
- Elkayam, E.; Kuhn, C.D.; Tocilj, A.; Haase, A.D.; Greene, E.M.; Hannon, G.J.; Joshua-Tor, L. The structure of human argonaute-2 in complex with miR-20a. Cell 2012, 150, 100–110. [Google Scholar] [CrossRef]
- Schmidt, M.F.; Korb, O.; Abell, C. MicroRNA-specific argonaute 2 protein inhibitors. ACS Chem. Biol. 2013, 8, 2122–2126. [Google Scholar] [CrossRef]
- Ferreira, R.; Santos, T.; Amar, A.; Gong, A.; Chen, T.C.; Tahara, S.M.; Giannotta, S.L.; Hofman, F.M. Argonaute-2 promotes miR-18a entry in human brain endothelial cells. J. Am. Heart Assoc. 2014, 3, e000968. [Google Scholar] [CrossRef]
- Lopez-Orozco, J.; Fayad, N.; Khan, J.Q.; Felix-Lopez, A.; Elaish, M.; Rohamare, M.; Sharma, M.; Falzarano, D.; Pelletier, J.; Wilson, J.; et al. The RNA Interference Effector Protein Argonaute 2 Functions as a Restriction Factor Against SARS-CoV-2. J Mol Biol 2023, 435, 168170. [Google Scholar] [CrossRef]
- Zoulikha, M.; Xiao, Q.; Boafo, G.F.; Sallam, M.A.; Chen, Z.; He, W. Pulmonary delivery of siRNA against acute lung injury/acute respiratory distress syndrome. Acta Pharm. Sinica. B 2022, 12, 600–620. [Google Scholar] [CrossRef]
- Alizada, A.; Hannon, G.J.; Nicholson, B.C. Transcriptional regulation of the piRNA pathway by Ovo in animal ovarian germ cells. Genes Dev. 2025, 3, 221–241. [Google Scholar] [CrossRef]
- Winter, J.; Diederichs, S. Argonaute-3 activates the let-7a passenger strand microRNA. RNA Biol. 2013, 10, 1631–1643. [Google Scholar] [CrossRef] [PubMed]
- Pan, L.; Xu, C.; Mei, J.; Chen, Y.; Wang, D. Argonaute 3 (AGO3) promotes malignancy potential of cervical cancer via regulation of Wnt/β-catenin signaling pathway. Reprod. Biol. 2021, 21, 100479. [Google Scholar] [CrossRef] [PubMed]
- Wang, Q.; Zhang, W.; Xu, W.; Zhang, H.; Liu, X.; Chen, X.; Chen, H. Genome-Wide Association Study and Identification of Candidate Genes Associated with Seed Number per Pod in Soybean. Int. J. Mol. Sci. 2024, 25, 2536. [Google Scholar] [CrossRef]
- Till, S.; Ladurner, A.G. RNA Pol IV plays catch with Argonaute 4. Cell 2007, 131, 643–645. [Google Scholar] [CrossRef] [PubMed]
- Potenza, N.; Papa, U.; Russo, A. Differential expression of Dicer and Argonaute genes during the differentiation of human neuroblastoma cells. Cell Biol. Int. 2009, 33, 734–738. [Google Scholar] [CrossRef]
- Chalertpet, K.; Pin-On, P.; Aporntewan, C.; Patchsung, M.; Ingrungruanglert, P.; Israsena, N.; Mutirangura, A. Argonaute 4 as an Effector Protein in RNA-Directed DNA Methylation in Human Cells. Front. Genet. 2019, 10, 645. [Google Scholar] [CrossRef]
- Jiang, H.; Lin, J.J.; Tao, J.; Fisher, P.B. Suppression of human ribosomal protein L23A expression during cell growth inhibition by interferon-beta. Oncogene 1997, 14, 473–480. [Google Scholar] [CrossRef]
- Ramos-Sáenz, A.; González-Álvarez, D.; Rodríguez-Galán, O.; Rodríguez-Gil, A.; Gaspar, S.G.; Villalobo, E.; Dosil, M.; de la Cruz, J. Pol5 is an essential ribosome biogenesis factor required for 60S ribosomal subunit maturation in Saccharomyces cerevisiae. RNA 2019, 25, 1561–1575. [Google Scholar] [CrossRef]
- Humeres, C.; Venugopal, H.; Frangogiannis, N.G. Smad-dependent pathways in the infarcted and failing heart. Curr. Opin. Pharmacol. 2022, 64, 102207. [Google Scholar] [CrossRef]
- Nickel, J.; Mueller, T.D. Specification of BMP Signaling. Cells 2019, 8, 1579. [Google Scholar] [CrossRef]
- Chen, D.; Zhao, M.; Mundy, G.R. Bone morphogenetic proteins. Growth Factors 2004, 22, 233–241. [Google Scholar] [CrossRef]
- Wu, W.; Wang, X.; Yu, X.; Lan, H.Y. Smad3 Signatures in Renal Inflammation and Fibrosis. Int. J. Biol. Sci. 2022, 18, 2795–2806. [Google Scholar] [CrossRef]
- Jeon, H.Y.; Pornour, M.; Ryu, H.; Khadka, S.; Xu, R.; Jang, J.; Li, D.; Chen, H.; Hussain, A.; Fazli, L.; et al. SMAD3 promotes expression and activity of the androgen receptor in prostate cancer. Nucleic Acids Res 2023, 51, 2655–2670. [Google Scholar] [CrossRef]
- Habeeb, O.; Korty, K.E.; Azzato, E.M.; Astbury, C.; Farkas, D.H.; Ko, J.S.; Billings, S.D. EWSR1-SMAD3 rearranged fibroblastic tumor: Case series and review. J. Cutan. Pathol. 2021, 48, 255–262. [Google Scholar] [CrossRef]
- Linder, M.I.; Mizoguchi, Y.; Hesse, S.; Csaba, G.; Tatematsu, M.; Łyszkiewicz, M.; Ziȩtara, N.; Jeske, T.; Hastreiter, M.; Rohlfs, M.; et al. Human genetic defects in SRP19 and SRPRA cause severe congenital neutropenia with distinctive proteome changes. Blood 2023, 141, 645–658. [Google Scholar] [CrossRef] [PubMed]
- Sakamoto, T.; Morita, S.; Tabata, K.; Nakamura, K.; Kawai, G. Solution structure of a SRP19 binding domain in human SRP RNA. J. Biochem. 2002, 132, 177–182. [Google Scholar] [CrossRef] [PubMed]
- Faoro, C.; Ataide, S.F. Noncanonical Functions and Cellular Dynamics of the Mammalian Signal Recognition Particle Components. Front. Mol. Biosci. 2021, 8, 679584. [Google Scholar] [CrossRef] [PubMed]
- Di Malta, C.; Zampelli, A.; Granieri, L.; Vilardo, C.; De Cegli, R.; Cinque, L.; Nusco, E.; Pece, S.; Tosoni, D.; Sanguedolce, F.; et al. TFEB and TFE3 drive kidney cystogenesis and tumorigenesis. EMBO Mol. Med. 2023, 15, e16877. [Google Scholar] [CrossRef]
- Takamatsu, D.; Kohashi, K.; Kiyozawa, D.; Kinoshita, F.; Ieiri, K.; Baba, M.; Eto, M.; Oda, Y. TFE3-immunopositive papillary renal cell carcinoma: A clinicopathological, immunohistochemical, and genetic study. Pathol. Res. Pract. 2023, 242, 154313. [Google Scholar] [CrossRef]
- Kmeid, M.; Akgul, M. TFE3 Rearrangement and Expression in Renal Cell Carcinoma. Int. J. Surg. Pathol. 2023, 31, 509–520. [Google Scholar] [CrossRef]
- Zhou, K.; Zheng, Z.; Li, Y.; Han, W.; Zhang, J.; Mao, Y.; Chen, H.; Zhang, W.; Liu, M.; Xie, L.; et al. TFE3, a potential therapeutic target for Spinal Cord Injury via augmenting autophagy flux and alleviating ER stress. Theranostics 2020, 10, 9280–9302. [Google Scholar] [CrossRef]
- Salvatorelli, L.; Parenti, R.; Leone, G.; Musumeci, G.; Vasquez, E.; Magro, G. Wilms tumor 1 (WT1) protein: Diagnostic utility in pediatric tumors. Acta Histochem. 2015, 117, 367–378. [Google Scholar] [CrossRef] [PubMed]
- Petrosyan, A.; Villani, V.; Aguiari, P.; Thornton, M.E.; Wang, Y.; Rajewski, A.; Zhou, S.; Cravedi, P.; Grubbs, B.H.; De Filippo, R.E.; et al. Identification and Characterization of the Wilms Tumor Cancer Stem Cell. Adv. Sci. 2023, 10, e2206787. [Google Scholar] [CrossRef]
- Ogasawara, M. Wilms’ tumor 1-targeting cancer vaccine: Recent advancements and future perspectives. Hum. Vaccines Immunother. 2024, 20, 2296735. [Google Scholar] [CrossRef]
- Mörking, P.A.; Rampazzo Rde, C.; Walrad, P.; Probst, C.M.; Soares, M.J.; Gradia, D.F.; Pavoni, D.P.; Krieger, M.A.; Matthews, K.; Goldenberg, S.; et al. The zinc finger protein TcZFP2 binds target mRNAs enriched during Trypanosoma cruzi metacyclogenesis. Mem. Inst. Oswaldo Cruz 2012, 107, 790–799. [Google Scholar] [CrossRef] [PubMed]
- Wu, Y.M.; Guo, Y.; Yu, H.; Guo, T. RNA editing affects cis-regulatory elements and predicts adverse cancer survival. Cancer Med. 2021, 10, 6114–6127. [Google Scholar] [CrossRef]
- Guan, C.; He, L.; Chang, Z.; Gu, X.; Liang, J.; Liu, R. ZNF774 is a potent suppressor of hepatocarcinogenesis through dampening the NOTCH2 signaling. Oncogene 2020, 39, 1665–1680. [Google Scholar] [CrossRef] [PubMed]
- Senior, A.W.; Evans, R.; Jumper, J.; Kirkpatrick, J.; Sifre, L.; Green, T.; Qin, C.; Žídek, A.; Nelson, A.W.R.; Bridgland, A.; et al. Improved protein structure prediction using potentials from deep learning. Nature 2020, 577, 706–710. [Google Scholar] [CrossRef]
- Weinmann, L.; Höck, J.; Ivacevic, T.; Ohrt, T.; Mütze, J.; Schwille, P.; Kremmer, E.; Benes, V.; Urlaub, H.; Meister, G. Importin 8 Is a Gene Silencing Factor that Targets Argonaute Proteins to Distinct mRNAs. Cell 2009, 136, 496–507. [Google Scholar] [CrossRef]
- Höck, J.; Weinmann, L.; Ender, C.; Rüdel, S.; Kremmer, E.; Raabe, M.; Urlaub, H.; Meister, G. Proteomic and functional analysis of Argonaute-containing mRNA–protein complexes in human cells. EMBO Rep. 2007, 8, 1052–1060. [Google Scholar] [CrossRef]
- Dean, K.A.; von Ahsen, O.; Görlich, D.; Fried, H.M. Signal recognition particle protein 19 is imported into the nucleus by importin 8 (RanBP8) and transportin. J. Cell Sci. 2001, 114, 3479–3485. [Google Scholar] [CrossRef]
- Xu, L.; Yao, X.; Chen, X.; Lu, P.; Zhang, B.; Ip, Y.T. Msk is required for nuclear import of TGF-β/BMP-activated Smads. J. Cell Biol. 2007, 178, 981–994. [Google Scholar] [CrossRef] [PubMed]
- Perera, R.M.; Stoykova, S.; Nicolay, B.N.; Ross, K.N.; Fitamant, J.; Boukhali, M.; Lengrand, J.; Deshpande, V.; Selig, M.K.; Ferrone, C.R.; et al. Transcriptional control of autophagy–lysosome function drives pancreatic cancer metabolism. Nature 2015, 524, 361–365. [Google Scholar] [CrossRef] [PubMed]
- Luck, K.; Kim, D.-K.; Lambourne, L.; Spirohn, K.; Begg, B.E.; Bian, W.; Brignall, R.; Cafarelli, T.; Campos-Laborie, F.J.; Charloteaux, B.; et al. A reference map of the human binary protein interactome. Nature 2020, 580, 402–408. [Google Scholar] [CrossRef]
- Woong-Hee, S.; Gyu Rie, L.; Lim, H.; Hasup, L.; Chaok, S. Prediction of Protein Structure and Interaction by GALAXY Protein Modeling Programs. Bio Des. 2014, 2, 1–11. [Google Scholar]
- Ko, J.; Park, H.; Heo, L.; Seok, C. GalaxyWEB server for protein structure prediction and refinement. Nucleic Acids Res. 2012, 40, W294–W297. [Google Scholar] [CrossRef] [PubMed]
- Lee, G.R.; Heo, L.; Seok, C. Effective protein model structure refinement by loop modeling and overall relaxation. Proteins Struct. Funct. Bioinform. 2016, 84, 293–301. [Google Scholar] [CrossRef]
- Ritchie, D.W.; Grudinin, S. Spherical polar Fourier assembly of protein complexes with arbitrary point group symmetry. J. Appl. Crystallogr. 2016, 49, 158–167. [Google Scholar] [CrossRef]
- Ritchie, D.W. Evaluation of protein docking predictions using Hex 3.1 in CAPRI rounds 1 and 2. Proteins Struct. Funct. Bioinform. 2003, 52, 98–106. [Google Scholar] [CrossRef]
- Pettersen, E.F.; Goddard, T.D.; Huang, C.C.; Couch, G.S.; Greenblatt, D.M.; Meng, E.C.; Ferrin, T.E. UCSF Chimera—A visualization system for exploratory research and analysis. J. Comput. Chem. 2004, 25, 1605–1612. [Google Scholar] [CrossRef]
- Waterhouse, A.M.; Procter, J.B.; Martin, D.M.A.; Clamp, M.; Barton, G.J. Jalview Version 2—A multiple sequence alignment editor and analysis workbench. Bioinformatics 2009, 25, 1189–1191. [Google Scholar] [CrossRef]
- Lin, K.C.; Lin, M.W.; Hsu, M.N.; Yu-Chen, G.; Chao, Y.C.; Tuan, H.Y.; Chiang, C.S.; Hu, Y.C. Graphene oxide sensitizes cancer cells to chemotherapeutics by inducing early autophagy events, promoting nuclear trafficking and necrosis. Theranostics 2018, 8, 2477–2487. [Google Scholar] [CrossRef] [PubMed]
- Conforti, F.; Zhang, X.; Rao, G.; De Pas, T.; Yonemori, Y.; Rodriguez, J.A.; McCutcheon, J.N.; Rahhal, R.; Alberobello, A.T.; Wang, Y.; et al. Therapeutic Effects of XPO1 Inhibition in Thymic Epithelial Tumors. Cancer Res. 2017, 77, 5614–5627. [Google Scholar] [CrossRef] [PubMed]
- Conforti, F.; Wang, Y.; Rodriguez, J.A.; Alberobello, A.T.; Zhang, Y.W.; Giaccone, G. Molecular Pathways: Anticancer Activity by Inhibition of Nucleocytoplasmic Shuttling. Clin. Cancer Res. Off. J. Am. Assoc. Cancer Res. 2015, 21, 4508–4513. [Google Scholar] [CrossRef]
- Saenz-Ponce, N.; Pillay, R.; de Long, L.M.; Kashyap, T.; Argueta, C.; Landesman, Y.; Hazar-Rethinam, M.; Boros, S.; Panizza, B.; Jacquemyn, M.; et al. Targeting the XPO1-dependent nuclear export of E2F7 reverses anthracycline resistance in head and neck squamous cell carcinomas. Sci. Transl. Med. 2018, 10, 1–12. [Google Scholar] [CrossRef]
- García-García, M.; Sánchez-Perales, S.; Jarabo, P.; Calvo, E.; Huyton, T.; Fu, L.; Ng, S.C.; Sotodosos-Alonso, L.; Vázquez, J.; Casas-Tintó, S.; et al. Mechanical control of nuclear import by Importin-7 is regulated by its dominant cargo YAP. Nat. Commun. 2022, 13, 1174. [Google Scholar] [CrossRef]
- Nganou, G.; Silva, C.G.; Gladwyn-Ng, I.; Engel, D.; Coumans, B.; Delgado-Escueta, A.V.; Tanaka, M.; Nguyen, L.; Grisar, T.; de Nijs, L.; et al. Importin-8 Modulates Division of Apical Progenitors, Dendritogenesis and Tangential Migration During Development of Mouse Cortex. Front. Mol. Neurosci. 2018, 11, 234. [Google Scholar] [CrossRef]
- Yang, Y.; Guo, L.; Chen, L.; Gong, B.; Jia, D.; Sun, Q. Nuclear transport proteins: Structure, function, and disease relevance. Signal Transduct. Target. Ther. 2023, 8, 425. [Google Scholar] [CrossRef]
- Wei, Y.; Li, L.; Wang, D.; Zhang, C.Y.; Zen, K. Importin 8 regulates the transport of mature microRNAs into the cell nucleus. J. Biol. Chem. 2014, 289, 10270–10275. [Google Scholar] [CrossRef]
- Kobayashi, H.; Tomari, Y. RISC assembly: Coordination between small RNAs and Argonaute proteins. Biochim. Biophys. Acta 2016, 1859, 71–81. [Google Scholar] [CrossRef]
- Meister, G. Argonaute proteins: Functional insights and emerging roles. Nat. Rev. Genet. 2013, 14, 447–459. [Google Scholar] [CrossRef] [PubMed]
- Nowak, I.; Sarshad, A.A. Argonaute Proteins Take Center Stage in Cancers. Cancers 2021, 13, 788. [Google Scholar] [CrossRef] [PubMed]
- Cheng, L.; Cao, H.; Xu, J.; Xu, M.; He, W.; Zhang, W.; Dong, L.; Chen, D. Circ_RPL23A acts as a miR-1233 sponge to suppress the progression of clear cell renal cell carcinoma by promoting ACAT2. J. Bioenerg. Biomembr. 2021, 53, 415–428. [Google Scholar] [CrossRef]
- Meng, X.M.; Nikolic-Paterson, D.J.; Lan, H.Y. TGF-β: The master regulator of fibrosis. Nat. Rev. Nephrol. 2016, 12, 325–338. [Google Scholar] [CrossRef]
- Lai, L.Y.S.; Gracie, N.P.; Gowripalan, A.; Howell, L.M.; Newsome, T.P. SMAD proteins: Mediators of diverse outcomes during infection. Eur. J. Cell Biol. 2022, 101, 151204. [Google Scholar] [CrossRef] [PubMed]
- Padmakumar, D.; Chandraprabha, V.R.; Gopinath, P.; Vimala Devi, A.R.T.; Anitha, G.R.J.; Sreelatha, M.M.; Padmakumar, A.; Sreedharan, H. A concise review on the molecular genetics of acute myeloid leukemia. Leuk. Res. 2021, 111, 106727. [Google Scholar] [CrossRef]
- Jiang, Y.; Lv, X.; Ge, X.; Qu, H.; Zhang, Q.; Lu, K.; Lu, Y.; Xue, C.; Zhang, L.; Wang, X. Wilms tumor gent 1 (WT1)-specific adoptive immunotherapy in hematologic diseases. Int. Immunopharmacol. 2021, 94, 107504. [Google Scholar] [CrossRef]
- Stroggilos, R.; Frantzi, M.; Zoidakis, J.; Mokou, M.; Moulavasilis, N.; Mavrogeorgis, E.; Melidi, A.; Makridakis, M.; Stravodimos, K.; Roubelakis, M.G.; et al. Gene Expression Monotonicity across Bladder Cancer Stages Informs on the Molecular Pathogenesis and Identifies a Prognostic Eight-Gene Signature. Cancers 2022, 14, 2542. [Google Scholar] [CrossRef]
- Bahramy, A.; Zafari, N.; Izadi, P.; Soleymani, F.; Kavousi, S.; Noruzinia, M. The Role of miRNAs 340-5p, 92a-3p, and 381-3p in Patients with Endometriosis: A Plasma and Mesenchymal Stem-Like Cell Study. BioMed Res. Int. 2021, 2021, 5298006. [Google Scholar] [CrossRef]
- Dahlberg, J.E.; Lund, E.; Goodwin, E.B. Nuclear translation: What is the evidence? RNA 2003, 9, 1–8. [Google Scholar] [CrossRef]
- Nagai, M.; Yoneda, Y. Small GTPase Ran and Ran-binding proteins. Biomol. Concepts 2012, 3, 307–318. [Google Scholar] [CrossRef] [PubMed]
- Görlich, D.; Dabrowski, M.; Bischoff, F.R.; Kutay, U.; Bork, P.; Hartmann, E.; Prehn, S.; Izaurralde, E. A novel class of RanGTP binding proteins. J. Cell Biol. 1997, 138, 65–80. [Google Scholar] [CrossRef] [PubMed]
- Arnold, K.; Bordoli, L.; Kopp, J.; Schwede, T. The SWISS-MODEL workspace: A web-based environment for protein structure homology modelling. Bioinformatics 2005, 22, 195–201. [Google Scholar] [CrossRef] [PubMed]
- Berman, H.M.; Westbrook, J.; Feng, Z.; Gilliland, G.; Bhat, T.N.; Weissig, H.; Shindyalov, I.N.; Bourne, P.E. The Protein Data Bank. Nucleic Acids Res. 2000, 28, 235–242. [Google Scholar] [CrossRef]
- Heo, L.; Park, H.; Seok, C. GalaxyRefine: Protein structure refinement driven by side-chain repacking. Nucleic Acids Res. 2013, 41, W384–W388. [Google Scholar] [CrossRef]
- Baek, M.; Shin, W.-H.; Chung, H.W.; Seok, C. GalaxyDock BP2 score: A hybrid scoring function for accurate protein–ligand docking. J. Comput.-Aided Mol. Des. 2017, 31, 653–666. [Google Scholar] [CrossRef]
- Shin, W.-H.; Kim, J.-K.; Kim, D.-S.; Seok, C. GalaxyDock2: Protein–ligand docking using beta-complex and global optimization. J. Comput. Chem. 2013, 34, 2647–2656. [Google Scholar] [CrossRef]
- Park, T.; Won, J.; Baek, M.; Seok, C. GalaxyHeteromer: Protein heterodimer structure prediction by template-based and ab initio docking. Nucleic Acids Res. 2021, 49, W237–W241. [Google Scholar] [CrossRef]
- Malamos, P.; Kalyvianaki, K.; Panagiotopoulos, A.A.; Vogiatzoglou, A.P.; Tsikalaki, A.A.; Katifori, A.; Polioudaki, H.; Darivianaki, M.N.; Theodoropoulos, P.A.; Panagiotidis, C.A.; et al. Nuclear translocation of the membrane oxoeicosanoid/androgen receptor, OXER1: Possible mechanisms involved. Mol. Cell. Endocrinol. 2024, 594, 112357. [Google Scholar] [CrossRef]
- Kalyvianaki, K.; Drosou, I.; Notas, G.; Castanas, E.; Kampa, M. Enhanced OXER1 expression is indispensable for human cancer cell migration. Biochem. Biophys. Res. Commun. 2021, 584, 95–100. [Google Scholar] [CrossRef]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).