Next Article in Journal
Tuning Immobilized Enzyme Features by Combining Solid-Phase Physicochemical Modification and Mineralization
Next Article in Special Issue
Anti-Bacterial Effect of Cannabidiol against the Cariogenic Streptococcus mutans Bacterium: An In Vitro Study
Previous Article in Journal
The Lattice Model of Particles with Orientation-Dependent Interactions at Solid Surfaces: Wetting Scenarios
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Antagonization of OX1 Receptor Potentiates CB2 Receptor Function in Microglia from APPSw/Ind Mice Model

by
Iu Raïch
1,2,3,†,
Joan Biel Rebassa
1,2,3,†,
Jaume Lillo
2,3,
Arnau Cordomi
4,
Rafael Rivas-Santisteban
2,3,
Alejandro Lillo
1,2,3,
Irene Reyes-Resina
1,2,3,
Rafael Franco
1,5,‡ and
Gemma Navarro
1,2,3,*,‡
1
Molecular Neuropharmacology Laboratory, Department of Biochemistry and Physiology, School of Pharmacy and Food Science, Universitat de Barcelona, 08007 Barcelona, Spain
2
CiberNed, Network Center for Neurodegenerative Diseases, National Spanish Health Institute Carlos III, 28029 Madrid, Spain
3
Neurosciences Institut, University of Barcelona (NeuroUB), 08028 Barcelona, Spain
4
Bioinformatics, ESCI-UPF, 08003 Barcelona, Spain
5
School of Chemistry, Universitat de Barcelona, 08007 Barcelona, Spain
*
Author to whom correspondence should be addressed.
These authors contributed equally to this work.
These authors contributed equally to this work.
Int. J. Mol. Sci. 2022, 23(21), 12801; https://doi.org/10.3390/ijms232112801
Submission received: 12 August 2022 / Revised: 4 October 2022 / Accepted: 14 October 2022 / Published: 24 October 2022
(This article belongs to the Special Issue New Insight into Cannabinoid Effects 2.0)

Abstract

Microdialysis assays demonstrated a possible role of orexin in the regulation of amyloid beta peptide (Aß) levels in the hippocampal interstitial fluid in the APP transgenic model. CB2R is overexpressed in activated microglia, showing a neuroprotective effect. These two receptors may interact, forming CB2-OX1-Hets and becoming a new target to combat Alzheimer’s disease. Aims: Demonstrate the potential role of CB2-OX1-Hets expression and function in microglia from animal models of Alzheimer’s disease. Receptor heteromer expression was detected by immunocytochemistry, bioluminescence resonance energy transfer (BRET) and proximity ligation assay (PLA) in transfected HEK-293T cells and microglia primary cultures. Quantitation of signal transduction events in a heterologous system and in microglia cells was performed using the AlphaScreen® SureFire® kit, western blot, the GCaMP6 calcium sensor and the Lance Ultra cAMP kit (PerkinElmer). The formation of CB2-OX1 receptor complexes in transfected HEK-293T cells has been demonstrated. The tetrameric complex is constituted by one CB2R homodimer, one OX1R homodimer and two G proteins, a Gi and a Gq. The use of TAT interfering peptides showed that the CB2-OX1 receptor complex interface is TM4-TM5. At the functional level it has been observed that the OX1R antagonist, SB334867, potentiates the action induced by CB2R agonist JWH133. This effect is observed in transfected HEK-293T cells and microglia, and it is stronger in the Alzheimer’s disease (AD) animal model APPSw/Ind where the expression of the complex assessed by the proximity ligation assay indicates an increase in the number of complexes compared to resting microglia. The CB2-OX1 receptor complex is overexpressed in microglia from AD animal models where OX1R antagonists potentiate the neuroprotective actions of CB2R activation. Taken together, these results point to OX1R antagonists as drugs with therapeutic potential to combat AD. Data access statement: Raw data will be provided by the corresponding author upon reasonable requirement.

1. Introduction

Orexin (hypocretin) receptor-mediated signaling has been mainly studied from the point of view of endocrinology and in relationship to eating disorders. However, orexin-actions are also important from the point of view of neurodegenerative diseases. Regarding Alzheimer’s disease (AD), microdialysis assays showed that orexin treatment resulted in the regulation of amyloid beta peptide (Aß) levels in the hippocampal interstitial fluid of a transgenic model that overexpresses a mutant form of the amyloid precursor protein (APP). The effect of orexin was mediated by receptors as it was blocked by orexin receptor antagonists [1]. A further link between the orexigenic actions and the pathophysiology of AD comes from the role of orexin receptors in sleep-wake cycles, which are altered in AD patients (see [2] for review). In addition, a case-control study showed that (i) the levels of orexin in the cerebrospinal fluid (CSF) were significantly higher in AD patients than in non-demented controls, and (ii) a positive correlation of orexin and tau levels in the CSF of AD patients [3]. Furthermore, it has been observed that in the APP/PS1 transgenic AD model, orexin-A aggravated cognitive deficits by a mechanism that, at least in part, involved alterations in mitochondrial function [4]. A detailed review of the relationships between the orexigenic pathways and their potential impact on pathophysiological aspects of AD is found elsewhere [5].
Two main orexin neuropeptides have been discovered, orexin-A (HCRT1, O43612, orexin-A) and B (HCTR2, orexin-B), which arise from the precursor gene prepro-orexin and act via cell surface G-protein coupled receptors (GPCRs). Orexin-A is a 33 amino acid peptide with two intrachain disulfide bonds while OXB is a linear 28 amino acid peptide [6]. Orexins have neuroprotective and immunoregulatory properties (Couvineau et al., 2019) [7]. There are two types of orexin receptors, OX1R and OX2R, which belong to the class A family and are mainly coupled to heterotrimeric Gq proteins. Thus, they can activate phospholipase A2, C and D, diacilglycerol lipase and calcium ion-mediated responses [8,9]. The amino acid sequence identity of human orexin receptors is 64% [10]. Orexin-A shows approximately equal affinity for both receptors while OXB shows a higher affinity for OX2R than OX1R [11,12,13]. The mRNAs encoding the two receptors are both enriched in the brain and moderately abundant in the hypothalamus but display remarkably different distributions. OX1R mRNA is expressed in many brain regions including the prefrontal and infralimbic cortex, hippocampus, paraventricular thalamic nucleus, ventromedial hypothalamic nucleus, dorsal raphe nucleus, and locus coeruleus. OX2R mRNA is prominently expressed in complementary distribution including the cerebral cortex, septal nuclei, hippocampus, medial thalamic groups, raphe nuclei, and many hypothalamic nuclei including the tuberomammillary nucleus, dorsomedial nucleus, paraventricular nucleus, and ventral premammillary nucleus [14]. The orexigenic system is involved in the regulation of endocrine, autonomic, and behavioral responses to maintain homeostasis [15], being involved in processes such as motivation, sleep-wake, learning and memory [7]. It has been demonstrated that orexigenic function degenerates with age, and thus dysregulation can result in several cognitive and behavioral deficits [13].
The most abundant cell surface GPCR in the mammalian brain is the cannabinoid CB1 receptor (CB1R), which is expressed in both neurons and glia. A second cannabinoid receptor, CB2R, is less present in neurons but is expressed in glia. In particular, it is overexpressed in activated glial cells, for instance in activated microglia [16]. The canonical G protein to which both receptors couple is Gi, i.e., the activation of cannabinoid receptors leads to decreases in the level of cytosolic cAMP and inactivation of protein kinase A-dependent pathways [6]. It has been previously shown in the cortex of AD patients that the expression of the CB1R is decreased and that this decrease correlates with hypophagia. In contrast, the CB2 receptor (CB2R) was upregulated and the expression increase correlated with higher glial marker expression and, importantly, with senile plaque score and Aß levels [17]. The therapeutic potential of targeting the CB2R has gained interest due to its involvement in microglial activation, which is one of the features of AD. Preclinical research has demonstrated in a variety of models that cannabinoids devoid of psychotropic effects and mainly targeting the CB2Rs have benefits in improving cognition while reducing neuroinflammation and preventing abnormal APP and tau processing (see [18,19] for review).
The first aim of this study was to find out if the CB2R and the OX1R can establish direct receptor-receptor interactions. A second aim was to discover the interrelationships between the signaling mediated by these two receptors and their potential as therapeutic targets to combat AD, with special emphasis on evaluating their role in activated microglia.

2. Results

2.1. Direct Interaction of Cannabinoid CB2R and Orexin OX1R Receptors in a Heterologous Expression System

We first aimed to assess whether the cannabinoid CB2 (CB2R) and orexin OX1 (OX1R) receptors might interact. Immunocytochemistry assays were performed in HEK-293T cells expressing the CB2R fused to YFP, the OX1R fused to Rluc, or both (Figure 1A). CB2R-YFP was detected by the YFP green fluorescence and OX1R-Rluc was detected by a mouse monoclonal anti-Rluc antibody and a secondary Cy3 conjugated anti-mouse IgG antibody. Results in Figure 1A show that when independently transfected, both receptors are expressed at the plasma membrane level and also at the cytosol. Moreover, in cells expressing both fusion proteins, receptors colocalize at the plasma membrane and intracellularly (Figure 1A). As colocalization does not demonstrate direct interaction, bioluminescence resonance energy transfer (BRET) assays were carried out in HEK-293T cells expressing a constant amount of OX1R-Rluc and increasing amounts of CB2R-YFP. A hyperbolic BRET saturation curve indicated a specific interaction between the receptors and the formation of CB2R-OX1R heteromers with the following parameters: BRETmax = 127 ± 7 mBU and BRET50 = 110 ± 20 mBU (Figure 1B). BRETmax results from donor/acceptor proximity and the number of CB2R-OX1R heteromers while BRET50 gives an idea of the affinity of the interaction. Accordingly, these parameters indicate that the interaction of the two receptors is strong. As negative control, GABAB-Rluc was used instead of OX1R-Rluc, and a linear signal was obtained, indicating the lack of interaction between CB2R and GABAB receptors (Figure 1C).

2.2. OX1R Antagonists Potentiate CB2R-Mediated Signalling in Transfected HEK-293T Cells

Signaling studies were first performed in single transfected cells. CB2R couples to Gi protein, thus leading to the inhibition of adenylate cyclase and the decrease of intracellular cAMP levels. The concentration of this second messenger was measured in cells expressing CB2Rs and pretreated with forskolin to activate adenylate cyclase and increase the cAMP levels. In CB2R expressing cells, the selective agonist JWH133 induced a 70% decrease in forskolin-induced cAMP levels (Figure 2A). This effect was specific as it was completely blocked by pretreatment with the selective CB2R antagonist, SR144528. OX1R can couple to different G proteins depending on the heteromeric complexes in which the receptor is involved, hence we first performed assays assuming that it could couple to the Gi protein. Determination of cAMP levels in HEK-293T cells expressing the OX1R showed that orexin-A induced a 70% decrease of forskolin-induced cAMP levels and that SB334867, a selective antagonist, completely blocked this effect (Figure 2B). When similar assays were performed in cells coexpressing both CB2R and OX1R, the agonists of the two receptors exerted a significant effect that was reverted by the corresponding antagonists (Figure 2E). However, the CB2R antagonist not only blocked the JWH133-induced effect but also the effect of the OX1R agonist. This phenomenon is known as cross-antagonism and can be used as a print to detect CB2R-OX1R heteromers in homologous systems. In contrast, the OX1R antagonist blocked the effect triggered by orexin-A, but potentiated the effect of the CB2R agonist (Figure 2E). This result is relevant, as it suggests that OX1R antagonists might potentiate the neuroprotective effects mediated by CB2R. On the other hand, when activating the same cells with both agonists, orexin-A and JWH133, a similar effect was observed to that induced by the activation of only one of the receptors (Figure 2E).
Due to the capability of OX1R to couple to the Gq protein and subsequently increase the cytosolic concentration of calcium ion (Ca2+), assays were performed to measure this second messenger in cells expressing OX1R or both receptors. First, experiments were performed in cells expressing the CB2R and the calcium sensor GCaMP6; JWH133 stimulation did not lead to any effect, thus confirming that CB2R is not coupled to Gq (Figure 2C). Orexin-A in cells expressing the OX1 receptor or OX1 and CB2 receptor produced a transient increase of Ca2+ concentration that was blocked by the OX1R antagonist (Figure 2F,G). As expected, JWH133 in these cells did not trigger any significant variation of calcium ion levels. The CB2R antagonist did not significantly modify the effect of orexin-A (Figure 2F).
Finally, the mitogen-activated protein kinase (MAPK) pathway was analyzed in single transfected and in cotransfected cells. Data of ERK1/2 phosphorylation obtained by Western blotting and normalized by total ERKs are shown in Figure 2F. JWH133 and orexin-A induced a, respectively, 70% and 50% increase in ERK1/2 phosphorylation over basal phosphorylation levels. The effect was blocked when the two receptors were simultaneously activated. This phenomenon where the agonist of one receptor blocks the activation of the other protomer of the receptor complex is named negative cross-talk, becoming a print to demonstrate the existence of this complex in native tissue. Moreover, pretreatment with the CB2R antagonist not only blocked the JWH133-induced effect but also the effect of orexin- A. This cross-antagonism was also found when the OX1R antagonist was used.

2.3. CB2R and OX1R form Tetrameric Complexes via a TM4-TM5 Interface

To characterize the CB2R-OX1R complex structure, a complementation approach was first used. CB2R was fused to the non-fluorescent C-terminal part of the YFP (cYFP hemiprotein) while OX1R was fused to the non-fluorescent N-terminal part of the YFP (nYFP hemiprotein). Fluorescence in cells coexpressing these hemiproteins showed bimolecular fluorescence complementation (BiFC), i.e., YFP was reconstituted due to interaction of the receptors. To identify the interacting domains, cells were treated with interfering peptides consisting of the sequence of transmembrane domains (TM) of the receptors fused to a sequence, the TAT cell-penetrating peptide. It has been previously shown that these TAT-derived peptides can be inserted into the plasma membrane and disrupt the interaction of cell surface GPCRs [20]. We found that sequences of the OX1R, TAT-TM4 (400 nM), and TAT-TM5 (400 nM) led to a significant decrease in the YFP reconstitution. Similar results were obtained with TAT-TM4 (400 nM) and TAT-TM5 (400 nM) when using CB2R TM sequences. These results indicate that the CB2R-OX1R complex has a TM4-TM5 interface (Figure 3A). To gain insight into the structure of the complex, we explored the possibility that CB2R and OX1R could form tetrameric complexes. We attempted to obtain BRET in cells expressing a constant amount of the “hemiproteins” OX1R-nRLuc and OX1R-cRluc and increasing amounts of the “hemiproteins” CB2R-nYFP and CB2R-cYFP. A hyperbolic BRET signal saturation curve was obtained (BRETmax 50 ± 2 mBU; BRET50 50 ± 10 mBU), indicating the formation of tetramers formed by two CB2Rs and two OX1Rs (Figure 3B).
It was further investigated whether the heteromer print disappeared when disrupting the heteromeric complex using TAT-TM peptides. Assays of cAMP level determination were performed in HEK-293T cells coexpressing the two receptors and treated with TAT-TM peptides. Interestingly, it was observed that the heteromer print disappeared in the presence of TAT-TM4 (400 nM) or TAT-TM5 (400 nM) (CB2R sequence) but not when other TAT-TM peptides were used. These two peptides prevented the potentiation of the effect of the CB2R agonist-induced by the OX1R antagonist (Figure 3E). The action of these peptides was specific, as the TAT-TM2 (400 nM) peptide or vehicle were ineffective.
Finally, we investigated which G alpha proteins were coupled to the macromolecular CB2R-OX1R complex. Experiments were performed in HEK-293T cells coexpressing the two receptors and pretreated with either cholera toxin (CTX; 100 ng/mL), which alters Gs-mediated signaling, pertussis toxin (PTX; 10 ng/mL), which alters G-mediated signaling, or the Gq inhibitor, YM254890 (1 µM), which blocks Gq-mediated signaling and was also used as a further control. In calcium mobilization assays, the effect of orexin-A was partially blocked by PTX and, also, by YM254890 (Figure 3C), suggesting the occurrence of one Gi and one Gq protein in the heteromeric complex. In cAMP determination assays, PTX treatment completely blocked the decrease in cAMP upon treatment with orexin-A or JWH133 (Figure 3D). Thus, it may be assumed that the tetramer contains at least one Gi protein. Furthermore, the fact that CTX did not affect any of the agonistic effects indicates that the complex does not couple to Gs proteins.

2.4. Blockade of OX1R Potentiates CB2R Function in the Microglia from APPSw/Ind Mice

Different studies have shown an important increase in CB2R expression in activated microglia compared to resting cells [21]. Accordingly, the expression and function of the CB2-OX1 receptor complex in the microglia of the Alzheimer’s model and in control mice was determined. To characterize the CB2-OX1 receptor complex function in microglial cells, cAMP level determination assays were carried out. In resting microglia from control mice, we observed that both JWH133 and orexin-A induced a significant effect that was non-additive upon receptor coactivation. Interestingly, in the presence of the OX1R antagonist, JWH133 induced a more marked effect (Figure 4A). When analyzing microglia from APPSw/Ind mice, both JWH133 and orexin-A provoked a significant decrease over forskolin-induced cAMP levels (Figure 4B) that was non additive in coactivation; such a negative crosstalk was not observed in control microglia. However, pretreatment with the OX1R antagonist strongly potentiated CB2R signaling, as observed in transfected HEK-293T cells, indicating again that the blockade of OX1R potentiates CB2R-induced signaling. A cross-antagonism was also found when the CB2R antagonist was used; SR144528 blocked the effect triggered by both JWH133 and orexin-A.
Analysis of the MAPK signaling pathway led to the finding that coactivation with orexin-A and JWH133 induced a lower effect than that observed by activation of one of the receptors, thus, negative crosstalk was stronger in the microglia from control mice but also observed in APPSw/Ind mice (Figure 4C,D). Interestingly, in APPSw/Ind mice microglia the CB2R antagonist potentiated the OX1R-induced function. This phenomenon was not observed in control miceor in transfected HEK-293T cells and could be explained due to a differential expression of CB2R in activated microglia.
Finally, by PLA the formation of CB2-OX1 receptor complexes in control and APPSw/Ind mice microglia was demonstrated. Interestingly, the expression of the heteromer was two-fold higher in the microglia from the AD model than in the microglia from control animals (Figure 4E). The important increase in the CB2-OX1 complexes in APPSw/Ind mice microglia could explain the functional differences observed in cAMP levels and MAPK phosphorylation assays.

3. Discussion

The interaction of two receptors that are expressed in microglia opens new perspectives for the regulation of the activation of these cells. In addition, the interaction between CB2R and OX1R is relevant for understanding the mechanisms underlying orexigenic and cannabinoid functional interactions at the CNS level. A recent study has shown by ligand-binding assays that the phytocannabinoid CBD can bind OX1R at low micromolar range where it acts as an antagonist by decreasing calcium mobilization [22]. This result does not become clear evidence of a direct relationship between the cannabinoid and the orexinergic systems because this compound also binds to other receptors such as serotonin receptors [23]. Another study in the amygdala shows that 2-arachidonoylglycerol acting on the CB2R reverts the fear extinction deficits induced by orexin-A. This finding seems a consequence of a higher 2-arachidonoylglycerol production by the action of orexin-A. Importantly, the effect of the peptide correlated with an increase in the expression of the CB2R in microglial cells [24]. The cannabinoid receptor has been proposed as a target for neuroprotection by regulating microglial activation and polarization. The mechanisms favoring microglia polarization to a neuroprotectivephenotype, also known as M2, are not known, although there are GPCRs that may regulate their production. On the one hand, cannabinoids acting on the CB2R may afford neuroprotection and prevent the progression of neurodegenerative diseases (see [25,26] and references therein). On the other hand, the CB2R is upregulated in activated microglia. The results afforded by this manuscript demonstrate that the OX1R antagonist, SB334867, not only blocks the orexin-A-induced effect, but also potentiates cannabinoid CB2R function in cAMP and MAPK signaling pathways. Moreover, this effect is potentiated in activated microglia compared to resting cells. In this sense, OX1R antagonists could become a new therapeutic target to consider in AD and other neurodegenerative diseases that trigger with microglia activation.
In the periphery, at the level of the intestinal barrier, orexin-A regulates neuroinflammation by acting on enterocytes and/or microglia [27]. In another of the few papers on orexin-A actions on activated microglia it was reported that the peptide favors the production and release of neuroprotective factors [28]. In animal models, orexin-A also affords protection against neuroinflammation occurring after brain ischemic insult [29]. The hypothesis underlying the research described in this paper was based on the possible co-occurrence and potential interaction of CB2R and OX1R receptors in microglia. The results confirm that CB2R and OX1R may interact in both a heterologous expression system and in primary microglia from mouse brain.
Unfortunately, the 3D structure of heteromers formed by two class A GPCRs has not yet been solved. However, several determined structures display crystallographic interfaces potentially compatible with physiological interactions. Reliable models that have been deciphered using the approach of interfering peptides employed in this study, such as the adenosine A1 and A2A heterotetramer coupled to one Gs protein and to one Gi protein [30,31,32] Previous studies have demonstrated that OX1R can form complexes with other proteins with the same TM4-5 interface; a clear example is the heteromeric complex between the apelin receptor APJ and OX1R [33].
To have a framework to understand the functional regulation within the CB2R-OX1R hetereomer, we created two structural models of the TM4/5 interface using experimentally determined structures and molecular modeling (see Section 4). The models reveal that the orthosteric binding pockets of CB2R and OX1R are connected by a network of aromatic residues. It turns out that both the CB2R and the OX1R antagonists used in the present study place groups near TM5 that trigger a larger opening of the extracellular part of this helix than other antagonists [34,35]. Although the study of this network is beyond the scope of the present work, it is tempting to speculate that an antagonist of one receptor could concertedly push the aromatic residues in this network bringing changes to the orthosteric pocket of the second receptor leading to either cross-activation or cross-inactivation. Figure 5A shows how the SB334867 could affect the signal triggered by the CB2R agonist JWH133. Figure 5B shows how the CB2R antagonist SR144528 could affect the signal triggered by the endogenous OX1R agonist orexin-A. We propose that the opening of TM5 in either case, required to accommodate an antagonist, would modulate the interface. The fact that TM5 exhibits different orientations with different ligands (Figure 5C) could be the basis of the opposite effects of the antagonists (cross-antagonism vs. positive modulation). Thus, the OX1R antagonist SB334867 allosterically stabilizes the active form of CB2R, potentiating the action induced by the agonist JWH133. By contrast, the CB2R antagonist SR144528 allosterically stabilizes an inactive state of the OX1R that hinders OXA binding, probably because the second extracellular loop that connects TMs 4 and 5 occludes its access.
Our heterodimeric models in Figure 4 imply the binding of a single G-protein (Supplementary Materials Figure S1). It is possible that both receptors bind a G-protein (Gi or Gq) in an active complex, but it is not possible that both bind it simultaneously because they would clash sterically. This dimeric model already provides the framework to understand the allosteric regulations by different protomers. Further work would be required to understand the benefits of having a heterotetramer compared to a heterodimer. The results in transfected HEK-293T cells have demonstrated the formation of tetrameric complexes with one homodimer of CB2R and one homodimer of OX1R able to signal through both Gi and a Gq. A tetramer could eventually allow the binding of Gq to one OX1 protomer and Gi to another. In fact, a tetramer assuming symmetric TM1 interfaces could simultaneously bind up to three G-proteins (Supplementary Materials Figure S1).
Some studies have demonstrated the exchange of G protein coupling to GPCRs when forming complexes in specific tissues. One of the first examples is that described by M Glass and collaborators, where cotreatment with a CB1R agonist and a dopaminergic D2R agonist increased cAMP levels in striatal neurons [36]. Thus, this indicates that two receptors that typically couple to the Gi protein can couple to a Gs protein when forming CB1R-D2R complexes in striatal neurons. Another example is D1R and D2R mediated signaling via the established Gs/olf and Gi/o, respectively. This is abolished when the heterodimer is stimulated, leading to new signal transduction by Gq/11 in the striatum [37]. In this sense, we have demonstrated that the newly described complex functions through the OX1R and CB2R characteristic proteins, a Gq and a Gi, respectively, and, although the heteromer permits the OX1R to signal via Gi as well.

4. Materials and Methods

4.1. Reagents

JWH133, SR144528, orexin-A, SB334867 and YM 254890 were purchased from Tocris Bioscience (Bristol, UK). Forskolin, cholera toxin from Vibrio cholerae (CTX) and pertussis toxin (PTX) from Bordetella pertussis were purchased from Sigma-Aldrich (St. Louis, MO, USA), and the Gq inhibitor, YM254890, was obtained from Focus Biomolecules (Plymouth Meeting, PA, USA).

4.2. Cell Isolation and Culturing

HEK-293T cells (batch 70022180) were acquired from the American Type Culture Collection (ATCC). Cells were amplified and frozen in liquid nitrogen in several aliquots. Cells from each aliquot were used until passage 18. HEK-293T cells were grown in Dulbecco’s Modified Eagle’s Medium (DMEM) (Gibco) supplemented with 2 mM L-glutamine, 100 μg/mL sodium pyruvate, 100 U/mL penicillin/streptomycin, MEM non-essential amino acids solution (1/100) and 5% (v/v) heat-inactivated fetal bovine serum (FBS) (all supplements were from Invitrogen, Paisley, Scotland, UK) and maintained at 37 °C in a humid atmosphere of 5% CO2.
CD-1 strain mice handling, sacrifice, and further experiments were conducted according to the guidelines set in Directive 2010/63/EU of the European Parliament and the Council of the European Union that is enforced in Spain by National and Regional organizations; the 3R rule (replace, refine, reduce) for animal experimentation was also considered. Primary cultures of microglia were obtained from 2–3-day-old pups. Cells were isolated as described in [41] and plated at a confluence of 40,000 cells/0.32 cm2. Briefly, the samples were dissected, carefully stripped of their meninges and digested with 0.25% trypsin for 20 min at 37 °C. Trypsinization was stopped by repeated washes with Hanks′ balanced salt solution (HBSS composition: 1.26 mM CaCl2, 5 mM KCl, 0.44 mM KH2PO4, 0.5 mM MgCl2, 0.4 mM MgSO4, 137 mM NaCl, 0.34 mM Na2HPO4 and 10 mM Hepes, pH: 7.4). Cells were brought to a single cell suspension by repeated pipetting followed by passage through a 100 µm-pore mesh. Cells were then resuspended in supplemented DMEM and seeded at a density of 3.5 × 105 cells/mL in 6-well plates or 96-well plates for functional assays and in twelve-well plates for immunocytochemistry or PLA assays. Cultures were maintained at 37 °C in a humidified 5% CO2 atmosphere. The medium was replaced every 4–5 days. Immunodetection of specific markers (CD-11b) showed that microglia preparations contained at least 98% microglial cells [42]

4.3. Cell Transfection

HEK-293T cells were transiently transfected with the corresponding cDNA by the PEI (PolyEthylenImine, Sigma-Aldrich) method. Briefly, the corresponding cDNA diluted in 150 mM NaCl was mixed with PEI (5.5 mM in nitrogen residues), also prepared in 150 mM NaCl for 10 min. The cDNA-PEI complexes were transferred to HEK-293T cells and were incubated for 4 h in a serum-starved medium. The medium was then replaced by a fresh supplemented culture medium and cells were maintained at 37 °C in a humid atmosphere of 5% CO2. Forty-eight hours after transfection, cells were washed, detached, and resuspended in the assay buffer.

4.4. Fusion Proteins and Expression Vectors

Plasmids encoding for CB2R-YFP, CB2R-nYFP, CB2R-cYFP, OX1R-Rluc, OX1R-nRluc, OX1R-cRluc, and OX1R-nYFP proteins were available in our laboratory.
Amplified cDNA fragments of the receptor were subcloned to be in-frame with restriction sites of pRluc-N1, pEYFP-N1, nYFP-pcDNA3.1, cYFP-pcDNA3.1, nRluc-pcDNA3.1 and cRluc-pcDNA3.1 vectors to provide plasmids that express proteins fused to the C-terminal end of Rluc, YFP, nRluc or cRluc.

4.5. Transgenic Alzheimer’s Disease (AD) Animal Model

APPSw,Ind transgenic mice (line J9; C57BL/6 background) expressing human APP695 harboring the FAD-linked Swedish (K670N/M671L) and Indiana (V717F) mutations under the PDGF promoter were obtained by crossing APPSw,Ind to non-transgenic (WT) mice [43]. APPSw,Ind-derived embryos or pups, individually genotyped and divided into “APPSw,Ind” and “control”, were used for preparing primary cultures. Animal care and experimental procedures were in accordance with European and Spanish regulations (86/609/CEE; RD1201/2005). Mice were handled, as per law, by personnel with the ad hoc permit (issued by the Generalitat de Catalunya), which allows animal handling for research purposes.

4.6. Immunocytochemistry

HEK-293T cells were seeded on glass coverslips in 12-well plates. Twenty-four hours later, cells were transfected with CB2R-YFP cDNA (1 μg) and/or OX1R-Rluc cDNA (1 μg). Forty-eight hours after, cells were fixed in 4% paraformaldehyde for 15 min and washed twice with PBS containing 20 mM glycine before permeabilization with PBS-glycine containing 0.2% Triton X-100 (5 min incubation). Cells were blocked during 1 h with PBS containing 1% bovine serum albumin. HEK-293T cells were labeled with a mouse anti-Rluc antibody (1/100, MAB4400, Millipore, Merck, Darmstadt, Germany) and subsequently treated with a Cy3-conjugated anti-mouse (1/200, 715-166-150 (red), Jackson ImmunoResearch, St. Thomas Place, UK) IgG secondary antibody (1 h each). The CB2R-YFP expression was detected by the YFP’s own fluorescence. Nuclei were stained with Hoechst (1/100 from stock 1 mg/mL; Sigma-Aldrich). Samples were washed several times and mounted with 30% Mowiol (Calbiochem). Images were obtained in a Zeiss LSM 880 confocal microscope (ZEISS, Germany) with the 63X oil objective.

4.7. Bioluminescence Resonance Energy Transfer (BRET) Assay and BRET with BiFC Assays

For the BRET assay, HEK-293T cells were transiently cotransfected with a constant amount of cDNA encoding for OX1R-Rluc (1 μg) and with increasing amounts of cDNA corresponding to CB2R-YFP (0.4 to 1.6 μg). As negative control, HEK-293T cells were transiently cotransfected with a constant amount of cDNA encoding for GABAB-Rluc (0.4 μg) and with increasing amounts of cDNA corresponding to CB2R-YFP (0.8 to 5 μg). For the BRET assays with Bimolecular fluorescence complementation (BiFC), HEK-293T cells were transiently cotransfected with a constant amount of cDNA encoding for proteins fused to Rluc hemiproteins (nRluc, cRluc), OX1R-nRluc8 (1.5 μg) and OX1R-cRluc8 (1.5 μg) and with increasing amounts of the cDNA corresponding to proteins fused to YFP hemiproteins (nYFP, cYFP), CB2R-nYFP Venus (0.3–2.5 µg), or CB2R-cYFP Venus (0.3–2.5 µg). To control the cell number, the sample protein concentration was determined using a Bradford assay kit (Bio-Rad, Munich, Germany) using bovine serum albumin (BSA) dilutions as standards. To quantify fluorescent proteins, cells (20 μg of total protein) were distributed in 96-well microplates (black plates with a transparent bottom) and fluorescence was read in a Fluostar Optima Fluorimeter (BMG Labtech, Ofenburg, Germany) equipped with a high-energy xenon flash lamp using a 10-nm bandwidth excitation filter at 485 nm. For BRET measurements, the equivalent of 20 μg of total protein cell suspension was distributed in 96-well white microplates with a white bottom (Corning 3600, Corning, NY). For BRET measurements, the equivalent to 20 µg cell suspension was distributed in 96-well microplates (white plates, Porvair, Leatherhead, UK) and 5 µM coelenterazine H was added (PJK GMBH, Kleinblittersdorf, Germany). One minute after coelenterazine H addition, the readings were collected using a Mithras LB 940 (Berthold, Bad Wildbad, Germany), which allowed the integration of the signals detected in the short-wavelength filter at 485 nm (440–500 nm) and the long-wavelength filter at 530 nm (510–590 nm). To quantify receptor-Rluc expression, luminescence readings were collected 10 min after the addition of 5 µM coelenterazine H. The net BRET is defined as [(long-wavelength emission)/(short-wavelength emission)]-Cf, where Cf corresponds to [(long-wavelength emission)/(short-wavelength emission)] for the Rluc construct expressed alone in the same experiment. Data in BRET curves that depict an equilateral hyperbola were fitted by a non-linear regression equation using GraphPad Prism software (San Diego, CA, USA). BRET values for specific interactions are given as milli BRET units (mBU: 1000 × net BRET). For BiFC assays, HEK-293T cells were transiently transfected with a constant amount of cDNA encoding for proteins fused to nVenus (OX1R-nYFP) or cVenus (CB2-cYFP) and incubated for 4 h in complete DMEM containing the interfering TAT peptides (with similar sequences to those in TM1 to TM7 for CB2R or TM4, TM5 or TM7 for OX1R). YFP resulting from complementation was detected by placing cells (20 μg protein) in 96-well microplates (black plates with a transparent bottom) and reading the fluorescence in a Fluostar Optima Fluorimeter (BMG Labtech, Offenburg, Germany) using a 30-nm bandwidth excitation filter (485 nm).

4.8. TAT-TM Peptides

Peptides with the sequence of the TM of CB2R and OX1R fused to the HIV TAT peptide (YGRKKRRQRRR) were used as oligomer-disrupting molecules (synthesized by Genemad Synthesis Inc. San Antonio, TX, USA). The cell penetrating TAT peptide allows for the intracellular delivery of fused peptides [20]. The TAT-fused TM peptide can then be inserted effectively into the plasma membrane because of the penetration capacity of the TAT peptide and the hydrophobic property of the TM moiety [44]. To obtain the right orientation of the inserted peptide, the HIV-TAT peptide was fused to the C-terminus or to the N-terminus as indicated:
TAVAVLCTLLGLLSALENVAVLYLIL-YGRKKRRQRRR for CB2R TM1,
YGRKKRRQRRR-YLFIGSLAGADFLASVVFACSFVNF for CB2R TM2,
AVFLLKIGSVTMTFTASVGSLLLTAI-YGRKKRRQRRR for CB2R TM3,
YGRKKRRQRRR-ALVTLGIMWVLSALVSYLPLMGW for CB2R TM4,
YLLSWLLFIAFLFSGIIYTYGHVLW-YGRKKRRQRRR for CB2R TM5,
YGRKKRRQRRR-TLGLVLAVLLICWFPVLALMAH for CB2R TM6,
AFAFCSMLCLINSMVNPVIYAL-YGRKKRRQRRR for CB2R TM7,
YGRKKRRQRRR-ILGIWAVSLAIMVPQAAVME for OX1R TM4,
SSFFIVTYLAPLGLMAMAYFQIF-YGRKKRRQRRR for OX1R TM5,
YASFTFSHWLVYANSAANPIIYNF-YGRKKRRQRRR for OX1R TM7.

4.9. cAMP Level Determination

The analysis of cAMP levels was performed in HEK-293T cells cotransfected with the cDNA for CB2R (1.5 μg) and the cDNA for the OX1R (1.5 μg), in primary microglia and primary neurons prepared from wild-type mice or the transgenic APPSw/Ind AD mice model. In the case of HEK-293T cells, when indicated, were treated overnight with the required TAT peptides TM2, TM4, and TM5 (0.4 µM) or with 10 ng/mL pertussis toxin (PTX; ref: P7208-50UG, Sigma-Aldrich, over-night), 100 ng/mL cholera toxin (CTX; ref:C8052-5M, Sigma-Aldrich, 2 h) or 1µM Gq inhibidor (YM 254890, 2 h). Two hours before the experiment, the medium was replaced by serum-starved DMEM medium. Cells growing in a medium containing 50 μM zardaverine were distributed in 384-well microplates (2000 HEK-293T or 4000 primary cells per well) treated at 37 °C with selective antagonists (1 µM SB334867 or 1 µM SR144528) for 15 min prior stimulation with OX1R and/or CB2R agonists (100 nM orexin-A and/or 100 nM JWH133); 15 min after agonists treatment, cells were treated (15 min) with 0.5 μM forskolin or vehicle. Homogeneous time-resolved fluorescence energy transfer (HTRF) measurements were performed using the Lance Ultra cAMP kit (PerkinElmer). Fluorescence at 665 nm was analyzed on a PHERAstar Flagship microplate reader equipped with an HTRF optical module (BMG Labtech). A standard curve for cAMP was obtained in each experiment.

4.10. Detection of Cytoplasmic Calcium Levels

HEK-293T cells were cotransfected with the cDNA for the protomers of the CB2R (1.5 μg), the cDNA for OX1R (1.5 μg) and with the cDNA for the GCaMP6 calcium sensor (1 μg) by the PEI method (Section 4.3). Forty-eight hours after transfection, HEK-293T cells plated in 6-well black, clear bottom plates, were incubated with Mg2+-free Locke’s buffer (154 mM NaCl, 5.6 mM KCl, 3.6 mM NaHCO3, 2.3 mM CaCl2, 5.6 mM glucose, 5 mM HEPES, 10 μM glycine, pH 7.4). Online recordings were performed right after the addition of agonists. When indicated, cells were pre-treated with receptor antagonists for 10 min. Fluorescence emission intensity due to complex GCaMP6 was recorded at 515 nm upon excitation at 488 nm on the EnSpire® Multimode Plate Reader for 150 s every 5 s at 100 flashes per well.

4.11. Extracellular Signal-Regulated Kinase (ERK) Phosphorylation Assays

HEK-293T cells were transfected with the cDNA encoding for CB2R and for OX1R. Two to four hours before initiating the experiment, the culture medium was replaced by serum-starved DMEM medium. Cells were treated at 37 °C with selective antagonists (1 µM SB334867 or 1 µM SR144528) for 10 min prior to stimulation with OX1R and/or CB2R agonists (100 nM orexin-A and/or 100 nM JWH133) for 7 min. Cells were then placed in an ice-water bath and washed twice with cold PBS and lysed with the addition of ice-cold lysis buffer (50 mM Tris-HCl pH 7.4, 50 mM NaF, 150 mM NaCl, 45 mM ß-glycerolphosphate, 1% Triton X-100, 20 µM phenyl-arsine oxide, 0.4mMNaVO4 and the protease inhibitor mixture (MERK, St. Louis, MO, USA)). Cellular debris were removed by centrifugation at 12,000 rpm for 10 min at 4 °C, and protein was adjusted to 1 mg/mL by the bicinchoninic acid method (ThermoFisher Scientific, Waltham, MA, USA) using a commercial bovine serum albumin dilution (BSA) (ThermoFisher Scientific) for standardization. Finally, cells were denatured by placing them at 100 °C for 5 min. ERK1/2 phosphorylation were determined by western blot. Equivalent amounts of protein (20 µg) were subjected to electrophoresis (10% SDS-polyacrylamide gel) and transferred onto PVDF membranes (Immobilon-FLPVDF membrane, MERK, St. Louis, MO, USA) for 90 min. The membranes were then blocked for 1 h at room temperature (constant shaking) with Odyssey Blocking Buffer (LI-COR Biosciences, Lincoln, NE, USA) and labelled with a mixture of primary mouse anti-phospho-ERK1/2 antibody (1:2000, MERK, Ref. M8159), primary rabbit anti-ERK1/2 antibody (1:40,000, MERK, Ref. M5670), which recognizes both phosphorylated and unphosphorylated ERK1/2 overnight at 4 °C with shaking. The membranes were then washed three times with PBS containing 0.05% tween and visualized by the addition of a mixture of IRDye 800 anti-mouse antibody (1:10,000, MERK, Ref. 926-32210) and IRDye 680 anti-rabbit antibody (1:10,000, MERK, Ref. 926-68071) for 2 h at room temperature. Membranes were washed three times with PBS-tween 0.05% and once with PBS and left to dry. Bands were analyzed using an Odyssey infrared scanner (LI-COR Biosciences).
Band densities were quantified using Fiji software, and the level of phosphorylated ERK1/2 was normalized using the total ERK1/2 protein band intensities. Results obtained are represented as the percent over basal (non-stimulated cells).
To determine the ERK1/2 phosphorylation in primary cultures, 50,000 cells/well were plated in transparent 96-well microplates and kept in the incubator for 14 days. Two hours before initiating the experiment, the medium was substituted by serum-starved DMEM medium. Cells were then treated at 37 °C with selective antagonists (1 µM SB334867 or 1 µM SR144528) for 7 min prior stimulation (25 °C) with OX1R and/or CB2R agonists (100 nM orexin-A and/or 100 nM JWH133). ERK1/2 phosphorylation was determined using an AlphaScreen® SureFire® kit (Perkin Elmer) following the instructions of the supplier and using an EnSpire® Multimode Plate Reader (PerkinElmer, Waltham, MA, USA).

4.12. Proximity Ligation Assay (PLA)

Direct interaction between CB2R and OX1R was detected using the Duolink in situ PLA detection Kit (OLink; Bioscience, Uppsala, Sweden) following the instructions of the supplier. Primary neurons and microglia were grown on glass coverslips, fixed in 4% paraformaldehyde for 15 min, washed with PBS containing 20 mM glycine to quench the aldehyde groups and permeabilized with the same buffer containing 0.05% Triton X-100 (20 min). Samples were then successively washed with PBS. After 1 h of incubation at 37 °C with the blocking solution in a pre-heated humidity chamber, cells were incubated overnight in the antibody diluent medium with a mixture of equal amounts of rabbit anti-CB2R (ab230791, Abcam, Cambridge,UK) directly coupled to a plus DNA strand (obtained following the instructions of the Sigma-Aldrich supplier, ref: DUO92010-1KT) (1/100) and rabbit anti-OX1R (ab83960, Abcam Cambridge,UK) directly coupled to a minus DNA strand (obtained following the instructions of the Sigma-Aldrich supplier, ref: DUO92009-1KT) (1/100). Ligation and amplification were conducted as indicated by the supplier. Samples were mounted using the mounting medium with Hoechst (1/100; Sigma-Aldrich, St. Louis, MO, USA) to stain nuclei. Samples were observed in a Zeiss 880 confocal microscope (Carl Zeiss, Oberkochen, Germany) equipped with an apochromatic 63× oil immersion objective (N.A. 1.4) and 405 nm and 561 nm laser lines. For each field of view, a stack of two channels (one per staining) and four Z stacks with a step size of 1 µm were acquired. The number of neurons or microglia containing one or more red spots versus total cells (blue nucleus) was determined, and Bonferroni’s multiple comparison post hoc test was used to compare the values (red dots/cell).

4.13. Statistical Analysis

GraphPad Prism 8 software (San Diego, CA, USA) was used for data fitting and statistical analysis. One-way ANOVA followed by post hoc Bonferroni’s test was used when comparing multiple values. From PLA confocal images the number of red dots/cell was quantified using the Andy’s algorithm Fiji’s plug-in [45].

4.14. Molecular Modelling

We used experimentally determined structures to model the monomeric structures of both CB2R and OX1R in inactive and active states. The complex CB2R/JWH133 was modeled based on the active structure of CB2R bound to the structurally related hexaydrocannabinol (PDB id 6KPF; [46]). The complex CB2R/SR144528 was modeled based on the inactive structure of CB2R bound to antagonist AM10257 (PDB id 5ZTY; [47], which also shares the central pyrazole ring located in the same position [34].The complex OX1R/SB334867 has been determined experimentally (PDB id 6TQ7; [35]. The complex (N-terminal part of) OX1R/orexin-A was modeled based on the OX2R/orexin-B complex (PDB id 7L1U; [48].
We used DIMERBOW [49]) to explore for possible TM4/5 interfaces to model the CB2R/OX1 dimer. We selected the structure of the 5-HT2C receptor (PDB id 6BQG; [50]), which reported a compact symmetric TM4/5 interface. In turn, we superposed one CB2R and one OX1R monomeric complex to the 5-HT2C dimer to obtain the dimeric complexes CB2R/JWH133-OX1R/SB334867 and CB2R/SR144528-OX1R/orexin-A. Because these structures showed clashes between helices TMs 4–5 of both protomers, we created new monomeric models incorporating the TMs 4 and 5 and proximal parts of the second extracellular loop in the conformation observed in the 5-HT2C receptor. All homology models of monomers were created using Modeller 10.3 [51]. All complexes (monomeric and dimeric) were energy minimized with AMBER22 using the ff19SB forcefield [52]. Ligands were parametrized using GAFF2 [53].

Supplementary Materials

The supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms232112801/s1.

Author Contributions

Conceptualization, R.F. and G.N.; methodology, I.R. and J.B.R.; validation, R.F., G.N. and A.C.; formal analysis, J.B.R., I.R. and G.N.; investigation, J.B.R., I.R., I.R.-R., J.L., R.R.-S. and A.L.; writing—original draft preparation, I.R., J.B.R., R.F. and G.N.; writing—review and editing I.R., J.B.R., J.L., A.C., R.R.-S., A.L., I.R.-R., R.F. and G.N. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by grants PID2020-113430RB-I00 from the Spanish Ministerio de Ciencia, Innovación y Universidades (MCIU; or equivalent) and Spanish Agencia Estatal de Investigación (AEI); they include UE FEDER funds.

Institutional Review Board Statement

The study was conducted in accordance with the Declaration of Helsinki, and approved by the Institutional Review Board of Hospital Clinico San Carlos-IdISSC (Madrid, Spain, protocol code ProEx 165/19, date of approval 25/02/2019).

Informed Consent Statement

Not applicable.

Data Availability Statement

Data that may be eventually missing can be obtained from the corresponding author upon reasonable request.

Conflicts of Interest

J.L., I.R., L.S., D.A.Z., A.L., J.M.O., R.F. and G.N. declare that they have no conflict of interest. CFV and VSM declare that they work for Phytoplant Research SL, a research company that does not directly sell any product but has provided the purified phytocannabinoids obtained from Cannabis sativa L. that have been used in this research (web page: https://www.phytoplantresearch.com/).

References

  1. Kang, J.E.; Lim, M.M.; Bateman, R.J.; Lee, J.J.; Smyth, L.P.; Cirrito, J.R.; Fujiki, N.; Nishino, S.; Holtzman, D.M. Amyloid-beta dynamics are regulated by orexin and the sleep-wake cycle. Science 2009, 326, 1005–1007. [Google Scholar] [CrossRef] [PubMed]
  2. Dauvilliers, Y. Hypocretin/Orexin, Sleep and Alzheimer’s Disease. Front. Neurol. Neurosci. 2021, 45, 139–149. [Google Scholar] [PubMed]
  3. Liguori, C.; Romigi, A.; Nuccetelli, M.; Zannino, S.; Sancesario, G.; Martorana, A.; Albanese, M.; Mercuri, N.B.; Izzi, F.; Bernardini, S.; et al. Orexinergic system dysregulation, sleep impairment, and cognitive decline in Alzheimer disease. JAMA Neurol. 2014, 71, 1498–1505. [Google Scholar] [CrossRef] [PubMed]
  4. Li, M.; Meng, Y.; Chu, B.; Shen, Y.; Xue, X.; Song, C.; Liu, X.; Ding, M.; Cao, X.; Wang, P.; et al. Orexin-A exacerbates Alzheimer’s disease by inducing mitochondrial impairment. Neurosci. Lett. 2020, 718, 134741. [Google Scholar] [CrossRef]
  5. Liguori, C. Orexin and Alzheimer’s Disease. Curr. Top. Behav. Neurosci. 2017, 33, 305–322. [Google Scholar]
  6. Kourosh-Arami, M.; Gholami, M.; Alavi-Kakhki, S.S.; Komaki, A. Neural correlates and potential targets for the contribution of orexin to addiction in cortical and subcortical areas. Neuropeptides 2022, 95, 102259. [Google Scholar] [CrossRef]
  7. Couvineau, A.; Voisin, T.; Nicole, P.; Gratio, V.; Abad, C.; Tan, Y.-V. Orexins as Novel Therapeutic Targets in Inflammatory and Neurodegenerative Diseases. Front. Endocrinol. 2019, 10, 709. [Google Scholar] [CrossRef]
  8. Alexander, S.P.; Kelly, E.; Mathie, A.; Peters, J.A.; Veale, E.L.; Armstrong, J.F.; Faccenda, E.; Harding, S.D.; Pawson, A.J.; Southan, C.; et al. The concise guide to PHARMACOLOGY 2021/22: Introduction and Other Protein Targets. Br. J. Pharmacol. 2021, 178 (Suppl. S1), S1–S26. [Google Scholar] [CrossRef]
  9. Coleman, P.; de Lecea, L.; Gotter, A.; Hagan, J.; Hoyer, D.; Kilduff, T.; Kukkonen, J.P.; Porter, R.; Renger, J.; Siegel, J.M.; et al. Orexin receptors in GtoPdb v.2021.3. IUPHAR/BPS Guide Pharmacol. CITE 2021, 2021. [Google Scholar] [CrossRef]
  10. Nakamachi, T. Orexin. In Handbook of Hormones; Elsevier: Amsterdam, The Netherlands, 2016; pp. 83–84, e10B-1–e10B-2. [Google Scholar]
  11. Leonard, C.S.; Kukkonen, J.P. Orexin/hypocretin receptor signalling: A functional perspective. J. Cereb. Blood Flow Metab. 2013, 171, 294–313. [Google Scholar] [CrossRef]
  12. Gotter, A.L.; Roecker, A.J.; Hargreaves, R.; Coleman, P.J.; Winrow, C.J.; Renger, J.J. Orexin receptors as therapeutic drug targets. Prog. Brain Res. 2012, 198, 163–188. [Google Scholar] [CrossRef] [PubMed]
  13. Calva, C.B.; Fayyaz, H.; Fadel, J.R. Effects of Intranasal Orexin-A (Hypocretin-1) Administration on Neuronal Activation, Neurochemistry, and Attention in Aged Rats. Front. Aging Neurosci. 2020, 11, 362. [Google Scholar] [CrossRef] [PubMed]
  14. De Lecea, L.; Sutcliffe, G.J.; Fabre, V. Hypocretins/orexins as integrators of physiological information: Lessons from mutant animals. Neuropeptides 2002, 36, 85–95. [Google Scholar] [CrossRef] [PubMed]
  15. Bonaventure, P.; Yun, S.; Johnson, P.; Shekhar, A.; Fitz, S.D.; Shireman, B.T.; Lebold, T.P.; Nepomuceno, D.; Lord, B.; Wennerholm, M.; et al. A Selective Orexin-1 Receptor Antagonist Attenuates Stress-Induced Hyperarousal without Hypnotic Effects. J. Pharmacol. Exp. Ther. 2015, 352, 590–601. [Google Scholar] [CrossRef] [PubMed]
  16. Young, A.P.; Denovan-Wright, E.M. The Dynamic Role of Microglia and the Endocannabinoid System in Neuroinflammation. Front. Pharmacol. 2022, 12, 806417. [Google Scholar] [CrossRef]
  17. Solas, M.; Francis, P.T.; Franco, R.; Ramirez, M.J. CB2 receptor and amyloid pathology in frontal cortex of Alzheimer’s disease patients. Neurobiol. Aging 2013, 34, 805–808. [Google Scholar] [CrossRef]
  18. Aso, E.; Ferrer, I. CB2 Cannabinoid Receptor As Potential Target against Alzheimer’s Disease. Front. Neurosci. 2016, 10, 243. [Google Scholar] [CrossRef]
  19. López, A.; Aparicio, N.; Pazos, M.R.; Grande, M.T.; Barreda-Manso, M.A.; Cuesta, I.B.; Vázquez, C.; Amores, M.; Ruiz-Pérez, G.; García-García, E.; et al. Cannabinoid CB2 receptors in the mouse brain: Relevance for Alzheimer’s disease. J. Neuroinflamm. 2018, 15, 158. [Google Scholar] [CrossRef]
  20. Schwarze, S.R.; Ho, A.; Vocero-Akbani, A.; Dowdy, S.F. In vivo protein transduction: Delivery of a biologically active protein into the mouse. Science 1999, 285, 1569–1572. [Google Scholar] [CrossRef]
  21. Maresz, K.; Carrier, E.J.; Ponomarev, E.D.; Hillard, C.J.; Dittel, B.N. Modulation of the cannabinoid CB2 receptor in microglial cells in response to inflammatory stimuli. J. Neurochem. 2005, 95, 437–445. [Google Scholar] [CrossRef]
  22. Vitale, R.; Iannotti, F.; Moriello, A.S.; Tunisi, L.; Piscitelli, F.; Savopoulos, R.; Cristino, L.; De Petrocellis, L.; Amodeo, P.; Gray, R.; et al. Identification and Characterization of Cannabidiol as an OX1R Antagonist by Computational and In Vitro Functional Validation. Biomolecules 2021, 11, 1134. [Google Scholar] [CrossRef] [PubMed]
  23. Barata, L.; de Hoz-Rivera, M.; Romero, A.; Martínez, M.; Silva, L.; Villa, M.; Campa, L.; Jiménez-Sánchez, L.; Martínez-Orgado, J. Role of 5HT1A Receptors in the Neuroprotective and Behavioral Effects of Cannabidiol in Hypoxic–Ischemic Newborn Piglets. Front. Pharmacol. 2022, 13, 925740. [Google Scholar] [CrossRef] [PubMed]
  24. Ten-Blanco, M.; Flores, Á.; Pereda-Pérez, I.; Piscitelli, F.; Izquierdo-Luengo, C.; Cristino, L.; Romero, J.; Hillard, C.J.; Maldonado, R.; Di Marzo, V.; et al. Amygdalar CB2 cannabinoid receptor mediates fear extinction deficits promoted by orexin-A/hypocretin-1. Biomed. Pharmacother. 2022, 149, 112925. [Google Scholar] [CrossRef] [PubMed]
  25. Pérez-Olives, C.; Rivas-Santisteban, R.; Lillo, J.; Navarro, G.; Franco, R. Recent Advances in the Potential of Cannabinoids for Neuroprotection in Alzheimer’s, Parkinson’s, and Huntington’s Diseases. Adv. Exp. Med. Biol. 2021, 1264, 81–92. [Google Scholar] [PubMed]
  26. Navarro, G.; Morales, P.; Cueto, C.R.; Fernández-Ruiz, J.; Jagerovic, N.; Franco, R. Targeting Cannabinoid CB2 Receptors in the Central Nervous System. Medicinal Chemistry Approaches with Focus on Neurodegenerative Disorders. Front. Neurosci. 2016, 10, 406. [Google Scholar] [CrossRef]
  27. Tunisi, L.; Forte, N.; Fernández-Rilo, A.C.; Mavaro, I.; Capasso, R.; D’Angelo, L.; Milić, N.; Cristino, L.; Di Marzo, V.; Palomba, L. Orexin-A Prevents Lipopolysaccharide-Induced Neuroinflammation at the Level of the Intestinal Barrier. Front. Endocrinol. 2019, 10, 219. [Google Scholar] [CrossRef]
  28. Duffy, C.M.; Yuan, C.; Wisdorf, L.E.; Billington, C.J.; Kotz, C.M.; Nixon, J.P.; Butterick, T.A. Role of orexin A signaling in dietary palmitic acid-activated microglial cells. Neurosci. Lett. 2015, 606, 140–144. [Google Scholar] [CrossRef]
  29. Xiong, X.; White, R.E.; Xu, L.; Yang, L.; Sun, X.; Zou, B.; Pascual, C.; Sakurai, T.; Giffard, R.G.; Xie, X. Mitigation of Murine Focal Cerebral Ischemia by the Hypocretin/Orexin System is Associated With Reduced Inflammation. Stroke 2013, 44, 764–770. [Google Scholar] [CrossRef]
  30. Navarro, G.; Cordomí, A.; Zelman-Femiak, M.; Brugarolas, M.; Moreno, E.; Aguinaga, D.; Perez-Benito, L.; Cortés, A.; Casadó, V.; Mallol, J.; et al. Quaternary structure of a G-protein-coupled receptor heterotetramer in complex with Gi and Gs. BMC Biol. 2016, 14, 26. [Google Scholar] [CrossRef]
  31. Navarro, G.; Cordomí, A.; Brugarolas, M.; Moreno, E.; Aguinaga, D.; Pérez-Benito, L.; Ferre, S.; Cortés, A.; Casadó, V.; Mallol, J.; et al. Cross-communication between Gi and Gs in a G-protein-coupled receptor heterotetramer guided by a receptor C-terminal domain. BMC Biol. 2018, 16, 24. [Google Scholar] [CrossRef]
  32. Franco, R.; Cordomí, A.; del Torrent, C.L.; Lillo, A.; Serrano-Marín, J.; Navarro, G.; Pardo, L. Structure and function of adenosine receptor heteromers. Cell. Mol. Life Sci. 2021, 78, 3957–3968. [Google Scholar] [CrossRef] [PubMed]
  33. Wan, L.; Xu, F.; Liu, C.; Ji, B.; Zhang, R.; Wang, P.; Wu, F.; Pan, Y.; Yang, C.; Wang, C.; et al. Transmembrane peptide 4 and 5 of APJ are essential for its heterodimerization with OX1R. Biochem. Biophys. Res. Commun. 2019, 521, 408–413. [Google Scholar] [CrossRef]
  34. Kotsikorou, E.; Navas, I.I.I.F.; Roche, M.J.; Gilliam, A.F.; Thomas, B.F.; Seltzman, H.H.; Kumar, P.; Song, Z.H.; Hurst, D.P.; Lynch, D.L.; et al. The importance of hydrogen bonding and aromatic stacking to the affinity and efficacy of cannabinoid receptor CB2 antagonist, 5-(4-chloro-3-methylphenyl)-1-[(4-methylphenyl)methyl]-N-[(1S,2S,4R)-1,3,3-trimethylbicyclo[2.2.1]hept-2-yl]-1H-pyrazole-3-carboxamide (SR144528). J. Med. Chem. 2013, 56, 6593–6612. [Google Scholar] [PubMed]
  35. Rappas, M.; Ali, A.A.E.; Bennett, K.A.; Brown, J.D.; Bucknell, S.J.; Congreve, M.; Cooke, R.M.; Cseke, G.; De Graaf, C.; Doré, A.S.; et al. Comparison of Orexin 1 and Orexin 2 Ligand Binding Modes Using X-ray Crystallography and Computational Analysis. J. Med. Chem. 2019, 63, 1528–1543. [Google Scholar] [CrossRef] [PubMed]
  36. Cell Surface Expression of Myc-OX1R and CB1. The Cell Surface. Available online: https://www.researchgate.net/figure/Cell-surface-expression-of-Myc-OX1R-and-CB1-The-cell-surface-expression-of-CB1-and_fig1_10809736 (accessed on 11 August 2022).
  37. Rashid, A.J.; So, C.H.; Kong, M.M.; Furtak, T.; El-Ghundi, M.; Cheng, R.; O’Dowd, B.F.; George, S.R. D1-D2 dopamine receptor heterooligomers with unique pharmacology are coupled to rapid activation of Gq/11 in the striatum. Proc. Natl. Acad. Sci. USA 2007, 104, 654–659. [Google Scholar] [CrossRef]
  38. Franco, R.; Reyes-Resina, I.; Aguinaga, D.; Lillo, A.; Jiménez, J.; Raïch, I.; Borroto-Escuela, D.O.; Ferreiro-Vera, C.; Canela, E.I.; de Medina, V.S.; et al. Potentiation of cannabinoid signaling in microglia by adenosine A 2A receptor antagonists. Glia 2019, 67, 2410–2423. [Google Scholar] [CrossRef]
  39. Navarro, G.; Borroto-Escuela, D.; Angelats, E.; Etayo, Í.; Reyes-Resina, I.; Pulido-Salgado, M.; Rodríguez-Pérez, A.I.; Canela, E.I.; Saura, J.; Lanciego, J.L.; et al. Receptor-heteromer mediated regulation of endocannabinoid signaling in activated microglia. Role of CB1 and CB2 receptors and relevance for Alzheimer’s disease and levodopa-induced dyskinesia. Brain Behav. Immun. 2018, 67, 139–151. [Google Scholar] [CrossRef]
  40. Franco, R.; Rivas-Santisteban, R.; Casanovas, M.; Lillo, A.; Saura, C.A.; Navarro, G. Adenosine A 2A Receptor Antagonists Affects NMDA Glutamate Receptor Function. Potential to Address Neurodegeneration in Alzheimer’s Disease. Cells 2020, 9, 1075. [Google Scholar] [CrossRef]
  41. Hradsky, J.; Mikhaylova, M.; Karpova, A.; Kreutz, M.R.; Zuschratter, W. Super-Resolution Microscopy of the Neuronal Calcium-Binding Proteins Calneuron-1 and Caldendrin. Methods Mol. Biol. 2012, 963, 147–169. [Google Scholar] [CrossRef]
  42. Franco, R.; Aguinaga, D.; Reyes, I.; Canela, E.I.; Lillo, J.; Tarutani, A.; Hasegawa, M.; del Ser-Badia, A.; Del Rio, J.A.; Kreutz, M.R.; et al. N-Methyl-d-Aspartate Receptor Link to the MAP Kinase Pathway in Cortical and Hippocampal Neurons and Microglia Is Dependent on Calcium Sensors and Is Blocked by α-Synuclein, Tau, and Phospho-Tau in Non-transgenic and Transgenic APP Sw,Ind Mice. Front. Mol. Neurosci. 2018, 11, 273. [Google Scholar] [CrossRef]
  43. Mucke, L.; Masliah, E.; Yu, G.Q.; Mallory, M.; Rockenstein, E.M.; Tatsuno, G.; Hu, K.; Kholodenko, D.; Johnson-Wood, K.; McConlogue, L. High-level neuronal expression of abeta 1-42 in wild-type human amyloid protein precursor transgenic mice: Synaptotoxicity without plaque formation. J. Neurosci. 2000, 20, 4050–4058. [Google Scholar] [CrossRef] [PubMed]
  44. He, S.-Q.; Zhang, Z.-N.; Guan, J.-S.; Liu, H.-R.; Zhao, B.; Wang, H.-B.; Li, Q.; Yang, H.; Luo, J.; Li, Z.-Y.; et al. Facilitation of μ-Opioid Receptor Activity by Preventing δ-Opioid Receptor-Mediated Codegradation. Neuron 2011, 69, 120–131. [Google Scholar] [CrossRef] [PubMed]
  45. Law, A.M.K.; Yin, J.X.M.; Castillo, L.; Young, A.; Piggin, C.; Rogers, S.; Caldon, C.E.; Burgess, A.; Millar, E.; O’Toole, S.A.; et al. Andy’s Algorithms: New automated digital image analysis pipelines for FIJI. Sci. Rep. 2017, 7, 15717. [Google Scholar] [CrossRef] [PubMed]
  46. Hua, T.; Li, X.; Wu, L.; Iliopoulos-Tsoutsouvas, C.; Wang, Y.; Wu, M.; Shen, L.; Brust, C.A.; Nikas, S.P.; Song, F.; et al. Activation and Signaling Mechanism Revealed by Cannabinoid Receptor-Gi Complex Structures. Cell 2020, 180, 655–665.e18. [Google Scholar] [CrossRef]
  47. Li, X.; Hua, T.; Vemuri, K.; Ho, J.H.; Wu, Y.; Wu, L.; Popov, P.; Benchama, O.; Zvonok, N.; Qu, L.; et al. Crystal Structure of the Human Cannabinoid Receptor CB2. Cell 2019, 176, 459–467.e13. [Google Scholar]
  48. Hong, C.; Byrne, N.J.; Zamlynny, B.; Tummala, S.; Xiao, L.; Shipman, J.M.; Partridge, A.T.; Minnick, C.; Breslin, M.J.; Rudd, M.T.; et al. Structures of active-state orexin receptor 2 rationalize peptide and small-molecule agonist recognition and receptor activation. Nat. Commun. 2021, 12, 815. [Google Scholar] [CrossRef]
  49. García-Recio, A.; Navarro, G.; Franco, R.; Olivella, M.; Guixà-González, R.; Cordomí, A. DIMERBOW: Exploring possible GPCR dimer interfaces. Bioinformatics 2020, 36, 3271–3272. [Google Scholar] [CrossRef]
  50. Peng, Y.; McCorvy, J.D.; Harpsøe, K.; Lansu, K.; Yuan, S.; Popov, P.; Qu, L.; Pu, M.; Che, T.; Nikolajsen, L.F.; et al. 5-HT2C Receptor Structures Reveal the Structural Basis of GPCR Polypharmacology. Cell 2018, 172, 719–730.e14. [Google Scholar] [CrossRef]
  51. Webb, B.; Sali, A. Comparative Protein Structure Modeling Using MODELLER. Curr. Protoc. Protein Sci. 2016, 86, 2.9.1–2.9.37. [Google Scholar]
  52. Tian, C.; Kasavajhala, K.; Belfon, K.A.A.; Raguette, L.; Huang, H.; Migues, A.N.; Bickel, J.; Wang, Y.; Pincay, J.; Wu, Q.; et al. ff19SB: Amino-Acid-Specific Protein Backbone Parameters Trained against Quantum Mechanics Energy Surfaces in Solution. J. Chem. Theory Comput. 2019, 16, 528–552. [Google Scholar] [CrossRef]
  53. He, X.; Man, V.H.; Yang, W.; Lee, T.-S.; Wang, J. A fast and high-quality charge model for the next generation general AMBER force field. J. Chem. Phys. 2020, 153, 114502. [Google Scholar] [CrossRef] [PubMed]
Figure 1. The OX1R and CB2R interact in a heterologous expression system. (A) Immunocytochemistry assays were performed in HEK-293T cells expressing CB2R-YFP (1 μg cDNA), which was detected by its own fluorescence (green) and/or OX1R-Rluc (1 μg cDNA) that was detected by a mouse monoclonal anti-Rluc antibody and a secondary Cy3-conjugated anti-mouse IgG antibody (red). Colocalization is shown in yellow. Cell nuclei were stained with Hoechst (blue). Scale bar: 15 μm. (B) BRET assays were performed in HEK-293T cells transfected with a constant amount of cDNA for OX1R-Rluc (0.4 μg) and increasing amounts of cDNA for CB2R-YFP (0.4 to 1.6 μg) or, as negative control (C), a constant amount of GABAB-Rluc (0.4 μg cDNA) and increasing amounts of CB2R- YFP (0.4 to 1.6 μg cDNA). Values correspond to six independent experiments.
Figure 1. The OX1R and CB2R interact in a heterologous expression system. (A) Immunocytochemistry assays were performed in HEK-293T cells expressing CB2R-YFP (1 μg cDNA), which was detected by its own fluorescence (green) and/or OX1R-Rluc (1 μg cDNA) that was detected by a mouse monoclonal anti-Rluc antibody and a secondary Cy3-conjugated anti-mouse IgG antibody (red). Colocalization is shown in yellow. Cell nuclei were stained with Hoechst (blue). Scale bar: 15 μm. (B) BRET assays were performed in HEK-293T cells transfected with a constant amount of cDNA for OX1R-Rluc (0.4 μg) and increasing amounts of cDNA for CB2R-YFP (0.4 to 1.6 μg) or, as negative control (C), a constant amount of GABAB-Rluc (0.4 μg cDNA) and increasing amounts of CB2R- YFP (0.4 to 1.6 μg cDNA). Values correspond to six independent experiments.
Ijms 23 12801 g001
Figure 2. Functionality of OX1R-CB2R heteromer in HEK-293T cells. (A,B,E) HEK-293T cells were transfected with the cDNA for the CB2 receptor (1 μg) (A), for the OX1 receptor (1 μg) (B) or both (E) and were pretreated with selective receptor antagonists (1 μM SB334867 for OX1R or 1 μM SR144528 for CB2R) or vehicle and treated with selective agonists (100 μM Orexin-A for OX1R and/or 100 nM JWH133 for CB2R) followed by 0.5 μM forskolin stimulation (15 min). Values are the mean ± S.E.M. of six independent experiments performed in triplicates. One-way ANOVA followed by Bonferroni’s multiple comparison post hoc test were used for statistical analysis (** p < 0.01, *** p < 0.001) versus FK condition. (C,D,F) HEK-293T cells were transfected with the cDNA for the GCaMP6 calcium sensor (1 μg) and for the CB2 receptor (1 μg) (C), for the OX1 receptor (1 μg) (D) or both receptors (F). Receptors were activated using selective agonists (100 nM orexin-A for OX1R and/or 100 nM JWH133 for CB2R). When indicated, cells were pretreated with selective antagonists (1 μM SB334867 for OX1R or 1 μM SR144528 for CB2R). Cytosolic calcium readings were collected and data are the mean ± S.E.M. from six independent experiments. (G) ERK1/2 phosphorylation was determined in HEK-293T cells expressing the CB2 receptor (1 μg cDNA) and the OX1 receptor (1 μg cDNA). Results are expressed in percentage with respect to basal condition. Values are the mean ± S.E.M. of five independent experiments performed in triplicates. A resentative Western blot is shown (bottom). p-ERK1/2: phosphorylated ERKs; t-ERK1/2: total ERKs. * p < 0.05, *** p < 0.001. One-way ANOVA followed by Bonferroni’s multiple comparison post hoc test were used for statistical analysis * p < 0.05 versus basal condition in ERK1/2 phospohorylation assays or versus FK condition in cAMP determination assays (dashed line).
Figure 2. Functionality of OX1R-CB2R heteromer in HEK-293T cells. (A,B,E) HEK-293T cells were transfected with the cDNA for the CB2 receptor (1 μg) (A), for the OX1 receptor (1 μg) (B) or both (E) and were pretreated with selective receptor antagonists (1 μM SB334867 for OX1R or 1 μM SR144528 for CB2R) or vehicle and treated with selective agonists (100 μM Orexin-A for OX1R and/or 100 nM JWH133 for CB2R) followed by 0.5 μM forskolin stimulation (15 min). Values are the mean ± S.E.M. of six independent experiments performed in triplicates. One-way ANOVA followed by Bonferroni’s multiple comparison post hoc test were used for statistical analysis (** p < 0.01, *** p < 0.001) versus FK condition. (C,D,F) HEK-293T cells were transfected with the cDNA for the GCaMP6 calcium sensor (1 μg) and for the CB2 receptor (1 μg) (C), for the OX1 receptor (1 μg) (D) or both receptors (F). Receptors were activated using selective agonists (100 nM orexin-A for OX1R and/or 100 nM JWH133 for CB2R). When indicated, cells were pretreated with selective antagonists (1 μM SB334867 for OX1R or 1 μM SR144528 for CB2R). Cytosolic calcium readings were collected and data are the mean ± S.E.M. from six independent experiments. (G) ERK1/2 phosphorylation was determined in HEK-293T cells expressing the CB2 receptor (1 μg cDNA) and the OX1 receptor (1 μg cDNA). Results are expressed in percentage with respect to basal condition. Values are the mean ± S.E.M. of five independent experiments performed in triplicates. A resentative Western blot is shown (bottom). p-ERK1/2: phosphorylated ERKs; t-ERK1/2: total ERKs. * p < 0.05, *** p < 0.001. One-way ANOVA followed by Bonferroni’s multiple comparison post hoc test were used for statistical analysis * p < 0.05 versus basal condition in ERK1/2 phospohorylation assays or versus FK condition in cAMP determination assays (dashed line).
Ijms 23 12801 g002
Figure 3. Transmembrane domains involved in the OX1R-CB2R interaction. (A) Bimolecular complementation experiments were determined in HEK-293T cells coexpressing OX1R-nYFP (1.5 µg) and CB2R-cYFP (1.5 µg) and treated for 4 h with interfering peptides having sequences with homologies to transmembrane (TM) domains (0.4 μM). Values represent the mean ± SEM of eight independent experiments. A statistical analysis was performed using a one-way ANOVA followed by Bonferroni’s post hoc test (* p < 0.05 versus basal condition). (B) BRET assays were determined in cells expressing a constant amount of cDNA for OX1R-cRluc (1.5 µg) and OX1R-nRluc (1.5 µg) and increasing amounts of cDNA for CB2R-cYFP (0.3–2.5 µg) and CB2R-nYFP (0.3–2.5 µg). (C) HEK-293T cells expressing CB2R, OX1R and the engineered calcium sensor, GCaMP6 (1 μg) were incubated overnight with vehicle or pertussis toxin (PTX; 10 ng/mL), or for 2 h with cholera toxin (CTX; 100 ng/mL) or YM254890 (YM; 100 ng/mL) and exposed to orexin-A (100 nM). Cytosolic calcium readings were collected, and data from a representative experiment are shown. (D) HEK-293T cells expressing the receptors were incubated overnight with vehicle or pertussis toxin (PTX; 10 ng/mL), or for 2 h with cholera toxin (CTX; 100 ng/mL) or YM254890 (YM; 100 ng/mL) and exposed to JWH133 (100 nM), SB334867 (1 μM) or both in the presence of forskolin (0.5 μM). (E) Cells coexpressing cDNAs for OX1R (1.5 µg) and CB2R (1.5 µg) were preincubated for 4 h with interfering peptides (0.4 µM), pretreated with CB2R antagonist (SB334867 1 µM) for 15 min and then treated for 15 min with the selective CB2R agonist, JWH133 (100 nM), in the presence of forskolin before determining cAMP levels. A statistical analysis was performed using a one-way ANOVA followed by Bonferroni’s post hoc test. * p < 0.05 versus forskolin treatment # p < 0.05 versus JWH133 + FK condition. Values are the mean ± S.E.M. of five different experiments performed in triplicates. Values are expressed as percentage of cAMP accumulation provoked by forskolin (FK) (n =  3, in triplicates). One-way ANOVA followed by Bonferroni’s multiple comparison tests was used for statistical analysis * p < 0.05 # p < 0.05 versus JWH133 + FK condition.
Figure 3. Transmembrane domains involved in the OX1R-CB2R interaction. (A) Bimolecular complementation experiments were determined in HEK-293T cells coexpressing OX1R-nYFP (1.5 µg) and CB2R-cYFP (1.5 µg) and treated for 4 h with interfering peptides having sequences with homologies to transmembrane (TM) domains (0.4 μM). Values represent the mean ± SEM of eight independent experiments. A statistical analysis was performed using a one-way ANOVA followed by Bonferroni’s post hoc test (* p < 0.05 versus basal condition). (B) BRET assays were determined in cells expressing a constant amount of cDNA for OX1R-cRluc (1.5 µg) and OX1R-nRluc (1.5 µg) and increasing amounts of cDNA for CB2R-cYFP (0.3–2.5 µg) and CB2R-nYFP (0.3–2.5 µg). (C) HEK-293T cells expressing CB2R, OX1R and the engineered calcium sensor, GCaMP6 (1 μg) were incubated overnight with vehicle or pertussis toxin (PTX; 10 ng/mL), or for 2 h with cholera toxin (CTX; 100 ng/mL) or YM254890 (YM; 100 ng/mL) and exposed to orexin-A (100 nM). Cytosolic calcium readings were collected, and data from a representative experiment are shown. (D) HEK-293T cells expressing the receptors were incubated overnight with vehicle or pertussis toxin (PTX; 10 ng/mL), or for 2 h with cholera toxin (CTX; 100 ng/mL) or YM254890 (YM; 100 ng/mL) and exposed to JWH133 (100 nM), SB334867 (1 μM) or both in the presence of forskolin (0.5 μM). (E) Cells coexpressing cDNAs for OX1R (1.5 µg) and CB2R (1.5 µg) were preincubated for 4 h with interfering peptides (0.4 µM), pretreated with CB2R antagonist (SB334867 1 µM) for 15 min and then treated for 15 min with the selective CB2R agonist, JWH133 (100 nM), in the presence of forskolin before determining cAMP levels. A statistical analysis was performed using a one-way ANOVA followed by Bonferroni’s post hoc test. * p < 0.05 versus forskolin treatment # p < 0.05 versus JWH133 + FK condition. Values are the mean ± S.E.M. of five different experiments performed in triplicates. Values are expressed as percentage of cAMP accumulation provoked by forskolin (FK) (n =  3, in triplicates). One-way ANOVA followed by Bonferroni’s multiple comparison tests was used for statistical analysis * p < 0.05 # p < 0.05 versus JWH133 + FK condition.
Ijms 23 12801 g003
Figure 4. Functionality of CB2R and OX1R heteromer in the microglia from the APPSw,Ind mouse. Primary microglia from APPSw,ind (A,B) or age-matched control animals (B,D) were pre-treated with selective receptor antagonists (1 µM SR144528 for CB2 or 1 µM SB334867 for OX1 receptors) for 15 min and subsequently treated with selective agonists (100 nM JWH133 for CB2 or 100 nM orexin-A for OX1 receptors) in single or combined treatments. cAMP levels (A,B) were detected 15 min after forskolin addition. Values are the mean ± S.E.M. of seven different experiments performed in triplicates. One-way ANOVA followed by Bonferroni’s multiple comparison post hoc test was used for statistical analysis (* p < 0.05 versus forskolin treatment). (C,D) ERK1/2 phosphorylation was analyzed using an AlphaScreen® SureFire® kit (Perkin Elmer). Values are the mean ± S.E.M. of five different experiments performed in triplicates. One-way ANOVA followed by Bonferroni’s multiple comparison post hoc test were used for statistical analysis (** p < 0.01, *** p < 0.001ersus untreated cells). (E) A proximity ligation assay (PLA) was performed in primary microglia from APPSw,Ind transgenic mice or age-matched controls, using specific primary antibodies against CB2R or against OX1R (1/100). Representative images corresponding to stacks of four sequential planes are shown. Cell nuclei were stained with Hoechst (blue) and receptor complexes appear as red dots. The number of red dots/cell was quantified using Andy’s algorithm Fiji’s plug-in (see Section 4). Scale bar: 15 µm. Values are the mean ± S.E.M. of five different experiments performed in duplicates. One-way ANOVA and Bonferroni’s multiple comparison post hoc test were used for statistical analysis (* p < 0.05 versus control).
Figure 4. Functionality of CB2R and OX1R heteromer in the microglia from the APPSw,Ind mouse. Primary microglia from APPSw,ind (A,B) or age-matched control animals (B,D) were pre-treated with selective receptor antagonists (1 µM SR144528 for CB2 or 1 µM SB334867 for OX1 receptors) for 15 min and subsequently treated with selective agonists (100 nM JWH133 for CB2 or 100 nM orexin-A for OX1 receptors) in single or combined treatments. cAMP levels (A,B) were detected 15 min after forskolin addition. Values are the mean ± S.E.M. of seven different experiments performed in triplicates. One-way ANOVA followed by Bonferroni’s multiple comparison post hoc test was used for statistical analysis (* p < 0.05 versus forskolin treatment). (C,D) ERK1/2 phosphorylation was analyzed using an AlphaScreen® SureFire® kit (Perkin Elmer). Values are the mean ± S.E.M. of five different experiments performed in triplicates. One-way ANOVA followed by Bonferroni’s multiple comparison post hoc test were used for statistical analysis (** p < 0.01, *** p < 0.001ersus untreated cells). (E) A proximity ligation assay (PLA) was performed in primary microglia from APPSw,Ind transgenic mice or age-matched controls, using specific primary antibodies against CB2R or against OX1R (1/100). Representative images corresponding to stacks of four sequential planes are shown. Cell nuclei were stained with Hoechst (blue) and receptor complexes appear as red dots. The number of red dots/cell was quantified using Andy’s algorithm Fiji’s plug-in (see Section 4). Scale bar: 15 µm. Values are the mean ± S.E.M. of five different experiments performed in duplicates. One-way ANOVA and Bonferroni’s multiple comparison post hoc test were used for statistical analysis (* p < 0.05 versus control).
Ijms 23 12801 g004
Figure 5. Computational model of the heteromeric TM4/5 CB2R-OX1R interface. (A,B) The possible modulation (indicated by the black arrows) of an antagonist to a neighbor receptor through a network of aromatic residues connecting both orthosteric sites, viewed from the membrane. (A) the CB2R/JWH133-OX1R/SB334867 complex; The experimental structure of the OX1R antagonist SB334867 revealed the presence of two copies of the ligand in the binding pocket interacting antiparallelly with each other, which resulted in a large ligand volume near TM5. (B) The CB2R/SR144528-OX1R/orexin-A. Similarly, the CB2R antagonist SR144528 puts an aromatic ring at the region where most CB ligands place the alkyl chain (such as in JHW133), also towards TM5. The CB2R receptor is shown in gold and the OX1R receptor in blue. Small-molecule ligands and aromatic side chains connecting the pockets are shown as sticks; orexin-A with a thick green cartoon. Dotted boxes indicate TMs 4 and 5 of both receptors. In (C) detail of the CB2R/SR144528-OX1R/orexin-A complex viewed from the extracellular side superposing different orientations of the extracellular portion of TM5 and proximal region of the second extracellular loop (ECL2) (i) from the OX2R/orexin-B complex (PDB id 7L1U, cylinder and loop in light blue), which would clash sterically with the TM4 of the CB2R; and (ii) from the OX1R/SB334867 complex (PDB id 6TQ7, pink cylinder), which orients in a direction that does not directly face TM4 and better avoids the possible clashes with it TM4. Arrows indicate the movements of TM5 helices towards the TM5 modeled in the heteromer (see Section 4, dark blue) [33]. This complex shows a characteristic signaling where the OX1R selective antagonist potentiates the cannabinoid CB2R function in cAMP signaling while it blocks the indirect MAPK pathway. These interesting results are also observed in resting microglia. However, in activated microglia, the OX1R antagonist blockade became stronger, inducing a higher potentiation of CB2R cannabinoid signaling not only in cAMP but also in MAPK signaling. These results can be explained because in primary microglia from the transgenic AD model, the CB2-OX1 receptor heteromer expression is significantly higher than in equivalent cells from control animals, as shown by PLA. This finding suggests that the heteromer could be a target to combat neurodegeneration. We have previously shown that primary microglia from this AD model have an activated phenotype that is, likely, neuroprotective [38,39,40]. This hypothesis would explain why cognitive deficits do not appear at birth but later in life. Future research should address whether the CB2-OX1 receptor heteromer is a suitable target to skew microglia to the neuroprotective phenotype.
Figure 5. Computational model of the heteromeric TM4/5 CB2R-OX1R interface. (A,B) The possible modulation (indicated by the black arrows) of an antagonist to a neighbor receptor through a network of aromatic residues connecting both orthosteric sites, viewed from the membrane. (A) the CB2R/JWH133-OX1R/SB334867 complex; The experimental structure of the OX1R antagonist SB334867 revealed the presence of two copies of the ligand in the binding pocket interacting antiparallelly with each other, which resulted in a large ligand volume near TM5. (B) The CB2R/SR144528-OX1R/orexin-A. Similarly, the CB2R antagonist SR144528 puts an aromatic ring at the region where most CB ligands place the alkyl chain (such as in JHW133), also towards TM5. The CB2R receptor is shown in gold and the OX1R receptor in blue. Small-molecule ligands and aromatic side chains connecting the pockets are shown as sticks; orexin-A with a thick green cartoon. Dotted boxes indicate TMs 4 and 5 of both receptors. In (C) detail of the CB2R/SR144528-OX1R/orexin-A complex viewed from the extracellular side superposing different orientations of the extracellular portion of TM5 and proximal region of the second extracellular loop (ECL2) (i) from the OX2R/orexin-B complex (PDB id 7L1U, cylinder and loop in light blue), which would clash sterically with the TM4 of the CB2R; and (ii) from the OX1R/SB334867 complex (PDB id 6TQ7, pink cylinder), which orients in a direction that does not directly face TM4 and better avoids the possible clashes with it TM4. Arrows indicate the movements of TM5 helices towards the TM5 modeled in the heteromer (see Section 4, dark blue) [33]. This complex shows a characteristic signaling where the OX1R selective antagonist potentiates the cannabinoid CB2R function in cAMP signaling while it blocks the indirect MAPK pathway. These interesting results are also observed in resting microglia. However, in activated microglia, the OX1R antagonist blockade became stronger, inducing a higher potentiation of CB2R cannabinoid signaling not only in cAMP but also in MAPK signaling. These results can be explained because in primary microglia from the transgenic AD model, the CB2-OX1 receptor heteromer expression is significantly higher than in equivalent cells from control animals, as shown by PLA. This finding suggests that the heteromer could be a target to combat neurodegeneration. We have previously shown that primary microglia from this AD model have an activated phenotype that is, likely, neuroprotective [38,39,40]. This hypothesis would explain why cognitive deficits do not appear at birth but later in life. Future research should address whether the CB2-OX1 receptor heteromer is a suitable target to skew microglia to the neuroprotective phenotype.
Ijms 23 12801 g005
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Raïch, I.; Rebassa, J.B.; Lillo, J.; Cordomi, A.; Rivas-Santisteban, R.; Lillo, A.; Reyes-Resina, I.; Franco, R.; Navarro, G. Antagonization of OX1 Receptor Potentiates CB2 Receptor Function in Microglia from APPSw/Ind Mice Model. Int. J. Mol. Sci. 2022, 23, 12801. https://doi.org/10.3390/ijms232112801

AMA Style

Raïch I, Rebassa JB, Lillo J, Cordomi A, Rivas-Santisteban R, Lillo A, Reyes-Resina I, Franco R, Navarro G. Antagonization of OX1 Receptor Potentiates CB2 Receptor Function in Microglia from APPSw/Ind Mice Model. International Journal of Molecular Sciences. 2022; 23(21):12801. https://doi.org/10.3390/ijms232112801

Chicago/Turabian Style

Raïch, Iu, Joan Biel Rebassa, Jaume Lillo, Arnau Cordomi, Rafael Rivas-Santisteban, Alejandro Lillo, Irene Reyes-Resina, Rafael Franco, and Gemma Navarro. 2022. "Antagonization of OX1 Receptor Potentiates CB2 Receptor Function in Microglia from APPSw/Ind Mice Model" International Journal of Molecular Sciences 23, no. 21: 12801. https://doi.org/10.3390/ijms232112801

APA Style

Raïch, I., Rebassa, J. B., Lillo, J., Cordomi, A., Rivas-Santisteban, R., Lillo, A., Reyes-Resina, I., Franco, R., & Navarro, G. (2022). Antagonization of OX1 Receptor Potentiates CB2 Receptor Function in Microglia from APPSw/Ind Mice Model. International Journal of Molecular Sciences, 23(21), 12801. https://doi.org/10.3390/ijms232112801

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop